protein_id
large_stringlengths 6
10
| protein_names
large_stringlengths 2
2.59k
| protein_function
large_stringlengths 13
15.4k
⌀ | organism
large_stringlengths 9
178
⌀ | length
float64 3
35.4k
⌀ | subcellular_location
large_stringlengths 7
6.16k
⌀ | sequence
large_stringlengths 3
35.4k
⌀ | go_ids
large listlengths 2
815
| go_bp
large listlengths 2
708
⌀ | go_mf
large listlengths 2
83
⌀ | go_cc
large listlengths 2
102
⌀ | interpro_ids
large listlengths 1
82
⌀ | structure_path
large_stringlengths 21
38
⌀ | string_id
large_stringlengths 10
27
⌀ | interaction_partners
large listlengths 1
1.44k
⌀ | full_interaction_info
large listlengths 1
1.44k
⌀ |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
A0A024B5K5
|
endothelin-converting enzyme 1 (EC 3.4.24.71)
| null |
Danio rerio (Zebrafish) (Brachydanio rerio)
| 765
|
Cytoplasmic vesicle, secretory vesicle membrane {ECO:0000256|ARBA:ARBA00004250}. Golgi apparatus membrane {ECO:0000256|ARBA:ARBA00004194}; Single-pass membrane protein {ECO:0000256|ARBA:ARBA00004194}.
|
MSVALQDLRNNMSNYKRATFEEEDGTDVPVDGAISPDSVEVGFRKGGIQLFGPLGRRTQLEVVLAGLLLASLLALFGCAVTLGVRYNRDPARSICLTEACVTVASKIVEALDRSADPCQDFYQYACGGWVRKNPLPDGRSRWSTFNSIWDQNQAVLKHLLENGTFNSSSEAERKTQSYYLSCLNEQRIEELGAQPLMDLITKIGGWNITESWDKENFLDVLKIISGPYRAQPFFTVSVSVDPKNSNSNVIQVDQSGLFLPSRDYYLNKTNEKVLKAYLDYMVELGLLLGGDKNSTRGQMQQILDFETALANITVPQDERRDEEKIYHKITIADLQVLAPAIEWLDYLNSVLSPLELNDTEPVVVYAKEYMQQVSELINKTDHSLLNNYMIWNLVQKGASSLDQRFENAQDKLLESLYGTKKSCTPRWQTCIGNTDDTLGFALGALFVKATFDKQSKEIAEGMINEIRTAFKGALDDLKWMDEQTRQAAKDKADAIYDMIGFPDFILDSKELDDVYDGYEVTEDNFFQNMINFYNFSARVMADQLRKPPNRDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYAQDHPKALNFGGIGVVMGHELTHAFDDQGREYDKDGNLRSWWQNSSVEAFKNRTECMVDQYTQYTINGEHINGKQTLGENIADNGGLKAAYHAYRSWVQKNGEEKRLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPKYRVIGTLSNSPEFAEHFQCPLGSSMNSGHRCEVW
|
[
"GO:0032502",
"GO:0048869",
"GO:0009987",
"GO:0048856",
"GO:0043473",
"GO:0030318",
"GO:0050931",
"GO:0070285",
"GO:0008150",
"GO:0048468",
"GO:0048066",
"GO:0030154"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0009987",
"GO:0043473",
"GO:0048869",
"GO:0048856",
"GO:0048066",
"GO:0050931",
"GO:0048468",
"GO:0030154",
"GO:0030318",
"GO:0070285"
] | null | null |
[
"IPR024079",
"IPR000718",
"IPR018497",
"IPR042089",
"IPR008753"
] |
af_db/AF-A0A024B5K5-F1-model_v4.cif.gz
|
7955.ENSDARP00000135807
|
[
"7955.ENSDARP00000002773",
"7955.ENSDARP00000148726",
"7955.ENSDARP00000095917",
"7955.ENSDARP00000115695"
] |
[
{
"protein2": "7955.ENSDARP00000002773",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 0,
"textmining": 759,
"combined_score": 758
},
{
"protein2": "7955.ENSDARP00000148726",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 0,
"textmining": 744,
"combined_score": 744
},
{
"protein2": "7955.ENSDARP00000095917",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 750,
"textmining": 778,
"combined_score": 942
},
{
"protein2": "7955.ENSDARP00000115695",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 0,
"textmining": 836,
"combined_score": 836
}
] |
A0A076NAB7
|
Rad, Gem/Kir family member 3, isoform E (Rgk3L)
| null |
Drosophila melanogaster (Fruit fly)
| 486
| null |
MVDDISPMHHRMQKKTRSASICATGASIETVIHGMPGASGSATPEGGTPGYRRRRPATRSQSARITSGARSVRQKTKAQQQQQQQQHTLQETRSYCTSEPRLSETETPPQRRKLSQRRPQTHAHRKSNAFLDVPTMNMHHLRVNDDDEDVDRLRTFSASKGGIINRGDSFRRRRSRSNSLAPSSPMHTRNGVGGLGGVAGGGSSLGLGCGYNGGSSSNGFGNANAQENHQPVEFYRVEMLGSAGVGKQALLSQFRTSDCINAYDGPECDDAEQNVSIILNGTESELKFLTGNPESKDELEQADAFLVVYSCIDKESFTRAKQILSRLQDMDLLRHRPTILVANKIDLARSRAVSAQDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQVQLQLNPKKSKDKDKNKFKENTNIETVETDNCLTDLKADDGGPRDANSPAHWYKSRSVMLASMKARQMLTWILGKEDSKFKHCENLQVL
|
[
"GO:0032413",
"GO:0065007",
"GO:1901020",
"GO:0051049",
"GO:0051051",
"GO:0034766",
"GO:0008150",
"GO:0051924",
"GO:0050789",
"GO:2001258",
"GO:0032410",
"GO:0032409",
"GO:0044092",
"GO:1901386",
"GO:0032879",
"GO:0034765",
"GO:2001257",
"GO:0050794",
"GO:1903170",
"GO:0043271",
"GO:0034762",
"GO:1901019",
"GO:1904062",
"GO:1903169",
"GO:0065009",
"GO:0051926",
"GO:0032412",
"GO:0022898",
"GO:0043269",
"GO:1904063",
"GO:0048523",
"GO:0048519",
"GO:0010959",
"GO:1901385",
"GO:0034763"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050789",
"GO:0048519",
"GO:0051051",
"GO:0032879",
"GO:0050794",
"GO:0065009",
"GO:0048523",
"GO:0051049",
"GO:0032410",
"GO:0032409",
"GO:0044092",
"GO:0043271",
"GO:0034762",
"GO:0034763",
"GO:0032413",
"GO:0034766",
"GO:0034765",
"GO:0051926",
"GO:0022898",
"GO:0043269",
"GO:1901020",
"GO:2001258",
"GO:1903170",
"GO:1904062",
"GO:0032412",
"GO:1904063",
"GO:0010959",
"GO:0051924",
"GO:1901386",
"GO:2001257",
"GO:1901019",
"GO:1903169",
"GO:1901385"
] | null | null |
[
"IPR027417",
"IPR051641",
"IPR001806"
] |
af_db/AF-A0A076NAB7-F1-model_v4.cif.gz
|
7227.FBpp0309683
|
[
"7227.FBpp0306703",
"7227.FBpp0304205",
"7227.FBpp0081241"
] |
[
{
"protein2": "7227.FBpp0306703",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 727,
"database": 0,
"textmining": 84,
"combined_score": 750
},
{
"protein2": "7227.FBpp0304205",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 0,
"textmining": 791,
"combined_score": 791
},
{
"protein2": "7227.FBpp0081241",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 0,
"database": 0,
"textmining": 916,
"combined_score": 917
}
] |
A0A087WSR0
|
Predicted gene, 20835 (Predicted gene, 20855) (Predicted gene, 20894) (Predicted gene, 20916) (Predicted gene, 20920) (Predicted gene, 21317) (Sycp3 like Y-linked)
| null |
Mus musculus (Mouse)
| 188
| null |
MRRMALKKLKVIPKEGYLLLLDFDDEDDDIKVSEEALSEVKSPAFDKNENISPQAEADEDMGDEVDSMLDKSEDDIYKTLHIKRKWMETYVKESFKGSNQKLERFCKTNERERKNINNKFCEQYITTFQKSDMDVQKFNEEKEKSVNSCQKEQQALKLSKCSQNQTLEAVKEMHEKSMEVLMNLGTKN
|
[
"GO:0032502",
"GO:0019953",
"GO:0060255",
"GO:0007276",
"GO:0048869",
"GO:0009987",
"GO:0065007",
"GO:0009566",
"GO:0008150",
"GO:0022412",
"GO:0032504",
"GO:0003006",
"GO:0048232",
"GO:0007530",
"GO:0050789",
"GO:0019222",
"GO:0048609",
"GO:0030154",
"GO:0007338",
"GO:0000003",
"GO:0007283",
"GO:0010468",
"GO:0032501",
"GO:0048515",
"GO:0022414",
"GO:0005622",
"GO:0043229",
"GO:0043226",
"GO:0110165",
"GO:0005737",
"GO:0005575",
"GO:0043227",
"GO:0005634",
"GO:0043231",
"GO:0005515",
"GO:0005488",
"GO:0003674"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0009987",
"GO:0065007",
"GO:0050789",
"GO:0000003",
"GO:0032501",
"GO:0022414",
"GO:0019953",
"GO:0048869",
"GO:0009566",
"GO:0022412",
"GO:0032504",
"GO:0003006",
"GO:0019222",
"GO:0048609",
"GO:0060255",
"GO:0007276",
"GO:0007530",
"GO:0030154",
"GO:0007338",
"GO:0007283",
"GO:0048515",
"GO:0048232",
"GO:0010468"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0005515"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0005737",
"GO:0043229",
"GO:0043227",
"GO:0043231",
"GO:0005634"
] |
[
"IPR051443",
"IPR006888"
] |
af_db/AF-A0A087WSR0-F1-model_v4.cif.gz
| null | null | null |
A0A096MIY8
|
Aspartate-beta-hydroxylase
| null |
Rattus norvegicus (Rat)
| 259
|
Sarcoplasmic reticulum membrane {ECO:0000256|ARBA:ARBA00004157}; Single-pass type II membrane protein {ECO:0000256|ARBA:ARBA00004157}.
|
MAEDKEAKHGGHKNGRRGGISGGSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGVYDADGDGDFDVDDAKVLLEGPGGLAKRKTKAKGLKERSTSERTFPPEEAETQAELEEQAPEGADLEADGPAGEPQSEVEDFLTATDSDDRFEALEPGTVHEDTEDSYHVEETASQNHPNDAEEVMSEQESSDHGEAVTDDGLQQHAEEVRHEDYDEPVYEPSENERIEISDNAIDDSNIISEEINVASVEEQQDTPPDT
|
[
"GO:0006873",
"GO:0050801",
"GO:0048878",
"GO:0055082",
"GO:0051480",
"GO:0098771",
"GO:0019725",
"GO:0006874",
"GO:0055074",
"GO:0055080",
"GO:0008150",
"GO:0030003",
"GO:0042592"
] |
[
"GO:0008150",
"GO:0042592",
"GO:0048878",
"GO:0019725",
"GO:0050801",
"GO:0055082",
"GO:0098771",
"GO:0006873",
"GO:0055074",
"GO:0055080",
"GO:0006874",
"GO:0030003",
"GO:0051480"
] | null | null |
[
"IPR007943",
"IPR039038"
] |
af_db/AF-A0A096MIY8-F1-model_v4.cif.gz
| null | null | null |
A0A096MJA1
|
Tyrosine-protein phosphatase non-receptor type (EC 3.1.3.48)
|
May act at junctions between the membrane and the cytoskeleton. {ECO:0000256|PIRNR:PIRNR000927}.
|
Rattus norvegicus (Rat)
| 967
|
Cytoplasm, cytoskeleton {ECO:0000256|ARBA:ARBA00004245, ECO:0000256|PIRNR:PIRNR000927}.
|
MGRKVQSERRKAGVGGGGRGRLERRPLGALKALGRANLPGVLGPAKEPRDSQLSHGAAGVGATPNSATEPPSKARCHFRFVVRQALAIPRHAIPESQAHSYSAAVMTSRLRALGGRINNIRTSELPKEKTRSEVTCSIRFLDGLVQTFKVNKQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSPRWLEASKPLRKQLKGGLPCILHFRVRYFIPDPNTLQQEQTSQFIPDQNDDFLSKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHNLDLMIGIASAGIAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKKSVNNQYCKKVIGGMVWNPVMRRSLSVERLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSLSPKDSDSEVSQNHSPHRGSLSENNPAQSCLTQKSSSSVSPCSNAPGSFSPDGVDQQFLEDYHKVTKGGSIEEASQYYCDKNDDGDGYLVLIRITPDKEGRFGFNLKGGVDQKMPLVVSRINPESPADTCMPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRKAVRSLAEIRSEDELSQLFPEAMFPACPEGGDSLEGSMELLKKGLESGTVLIQFEQLYRKKPGLAVTFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLVVMLTTLTERGRTKCHQYWPDPPDIMDHGIFHIQCQAEDCTIAYVSREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVKYVRSLRVGGEPALVHCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQTLDPS
|
[
"GO:0048732",
"GO:0031100",
"GO:0032502",
"GO:0001889",
"GO:0031099",
"GO:0048856",
"GO:0061008",
"GO:0007275",
"GO:0032501",
"GO:0048731",
"GO:0097421",
"GO:0048513",
"GO:0008150"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0032501",
"GO:0048856",
"GO:0007275",
"GO:0031099",
"GO:0048731",
"GO:0048513",
"GO:0048732",
"GO:0031100",
"GO:0061008",
"GO:0001889",
"GO:0097421"
] | null | null |
[
"IPR019749",
"IPR014352",
"IPR035963",
"IPR019748",
"IPR019747",
"IPR000299",
"IPR018979",
"IPR018980",
"IPR001478",
"IPR036034",
"IPR011993",
"IPR029021",
"IPR000242",
"IPR041783",
"IPR016130",
"IPR003595",
"IPR000387",
"IPR012151",
"IPR029071"
] |
af_db/AF-A0A096MJA1-F1-model_v4.cif.gz
| null | null | null |
A0A096MJE4
|
Cytotoxic T-lymphocyte protein 4 (Cytotoxic T-lymphocyte-associated antigen 4)
|
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. {ECO:0000256|ARBA:ARBA00002230}.
|
Rattus norvegicus (Rat)
| 223
|
Cell membrane {ECO:0000256|ARBA:ARBA00004251}; Single-pass type I membrane protein {ECO:0000256|ARBA:ARBA00004251}.
|
MARLGVQRYKTHLQLPSRTWPFGVLLSLLFIPIFSEAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLVTAVSLNRTLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
|
[
"GO:0050777",
"GO:0042130",
"GO:0065007",
"GO:0002695",
"GO:0050670",
"GO:0050776",
"GO:0008150",
"GO:0050866",
"GO:0042127",
"GO:0042129",
"GO:0050863",
"GO:0007162",
"GO:0050789",
"GO:0032944",
"GO:0002683",
"GO:0050672",
"GO:0022407",
"GO:0008285",
"GO:1903037",
"GO:0050794",
"GO:0030155",
"GO:0048583",
"GO:0070664",
"GO:0002682",
"GO:1903038",
"GO:0002694",
"GO:0051241",
"GO:0051239",
"GO:0050868",
"GO:0022408",
"GO:0070663",
"GO:0050865",
"GO:0048523",
"GO:0048519",
"GO:0032945",
"GO:0048585",
"GO:0051250",
"GO:0051249",
"GO:0038023",
"GO:0005515",
"GO:0003674",
"GO:0005488",
"GO:0060089"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050789",
"GO:0048519",
"GO:0002683",
"GO:0050794",
"GO:0048583",
"GO:0002682",
"GO:0051241",
"GO:0051239",
"GO:0048523",
"GO:0048585",
"GO:0050777",
"GO:0002695",
"GO:0050776",
"GO:0050866",
"GO:0042127",
"GO:0007162",
"GO:0008285",
"GO:0030155",
"GO:0002694",
"GO:0050865",
"GO:0022407",
"GO:0070664",
"GO:0022408",
"GO:0070663",
"GO:0051250",
"GO:0051249",
"GO:0050670",
"GO:0050863",
"GO:0032944",
"GO:0050672",
"GO:1903037",
"GO:1903038",
"GO:0050868",
"GO:0032945",
"GO:0042130",
"GO:0042129"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0060089",
"GO:0038023",
"GO:0005515"
] | null |
[
"IPR008096",
"IPR040216",
"IPR007110",
"IPR036179",
"IPR013783",
"IPR003599",
"IPR013106"
] |
af_db/AF-A0A096MJE4-F1-model_v4.cif.gz
|
10116.ENSRNOP00000073071
|
[
"10116.ENSRNOP00000001110",
"10116.ENSRNOP00000000733",
"10116.ENSRNOP00000034235",
"10116.ENSRNOP00000031382",
"10116.ENSRNOP00000064850",
"10116.ENSRNOP00000016664",
"10116.ENSRNOP00000035610",
"10116.ENSRNOP00000006246",
"10116.ENSRNOP00000048351",
"10116.ENSRNOP00000021915",
"10116.ENSRNOP00000014163",
"10116.ENSRNOP00000070664",
"10116.ENSRNOP00000021615",
"10116.ENSRNOP00000029803",
"10116.ENSRNOP00000004590",
"10116.ENSRNOP00000013732",
"10116.ENSRNOP00000067189",
"10116.ENSRNOP00000073801",
"10116.ENSRNOP00000056412",
"10116.ENSRNOP00000001162",
"10116.ENSRNOP00000023327",
"10116.ENSRNOP00000029992",
"10116.ENSRNOP00000010029",
"10116.ENSRNOP00000003733",
"10116.ENSRNOP00000003969",
"10116.ENSRNOP00000009917",
"10116.ENSRNOP00000013701",
"10116.ENSRNOP00000050172",
"10116.ENSRNOP00000040429",
"10116.ENSRNOP00000010121",
"10116.ENSRNOP00000036799",
"10116.ENSRNOP00000064455",
"10116.ENSRNOP00000052022",
"10116.ENSRNOP00000026556",
"10116.ENSRNOP00000051906",
"10116.ENSRNOP00000004406",
"10116.ENSRNOP00000041842",
"10116.ENSRNOP00000071837",
"10116.ENSRNOP00000018776",
"10116.ENSRNOP00000059867",
"10116.ENSRNOP00000017042",
"10116.ENSRNOP00000036771",
"10116.ENSRNOP00000050320",
"10116.ENSRNOP00000063859",
"10116.ENSRNOP00000073093",
"10116.ENSRNOP00000066383",
"10116.ENSRNOP00000025743",
"10116.ENSRNOP00000049249",
"10116.ENSRNOP00000070231",
"10116.ENSRNOP00000074881",
"10116.ENSRNOP00000012936",
"10116.ENSRNOP00000003129",
"10116.ENSRNOP00000052371",
"10116.ENSRNOP00000027251",
"10116.ENSRNOP00000002089",
"10116.ENSRNOP00000038369",
"10116.ENSRNOP00000051602",
"10116.ENSRNOP00000009000",
"10116.ENSRNOP00000003998",
"10116.ENSRNOP00000020094"
] |
[
{
"protein2": "10116.ENSRNOP00000001110",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 59,
"experimental": 0,
"database": 0,
"textmining": 748,
"combined_score": 752
},
{
"protein2": "10116.ENSRNOP00000000733",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 265,
"database": 500,
"textmining": 285,
"combined_score": 720
},
{
"protein2": "10116.ENSRNOP00000034235",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 135,
"experimental": 0,
"database": 0,
"textmining": 732,
"combined_score": 758
},
{
"protein2": "10116.ENSRNOP00000031382",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 93,
"experimental": 0,
"database": 900,
"textmining": 710,
"combined_score": 971
},
{
"protein2": "10116.ENSRNOP00000064850",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 0,
"textmining": 770,
"combined_score": 769
},
{
"protein2": "10116.ENSRNOP00000016664",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 54,
"experimental": 0,
"database": 0,
"textmining": 749,
"combined_score": 752
},
{
"protein2": "10116.ENSRNOP00000035610",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 0,
"database": 0,
"textmining": 699,
"combined_score": 703
},
{
"protein2": "10116.ENSRNOP00000006246",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 111,
"experimental": 0,
"database": 0,
"textmining": 857,
"combined_score": 867
},
{
"protein2": "10116.ENSRNOP00000048351",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 119,
"database": 0,
"textmining": 865,
"combined_score": 880
},
{
"protein2": "10116.ENSRNOP00000021915",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 119,
"experimental": 119,
"database": 0,
"textmining": 950,
"combined_score": 958
},
{
"protein2": "10116.ENSRNOP00000014163",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 144,
"experimental": 0,
"database": 0,
"textmining": 724,
"combined_score": 754
},
{
"protein2": "10116.ENSRNOP00000070664",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 0,
"textmining": 755,
"combined_score": 779
},
{
"protein2": "10116.ENSRNOP00000021615",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 99,
"database": 0,
"textmining": 706,
"combined_score": 727
},
{
"protein2": "10116.ENSRNOP00000029803",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 115,
"experimental": 0,
"database": 0,
"textmining": 749,
"combined_score": 768
},
{
"protein2": "10116.ENSRNOP00000004590",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 0,
"textmining": 704,
"combined_score": 704
},
{
"protein2": "10116.ENSRNOP00000013732",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 85,
"experimental": 0,
"database": 0,
"textmining": 830,
"combined_score": 838
},
{
"protein2": "10116.ENSRNOP00000067189",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 116,
"experimental": 0,
"database": 0,
"textmining": 836,
"combined_score": 848
},
{
"protein2": "10116.ENSRNOP00000073801",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 81,
"experimental": 65,
"database": 0,
"textmining": 948,
"combined_score": 951
},
{
"protein2": "10116.ENSRNOP00000056412",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 72,
"experimental": 0,
"database": 0,
"textmining": 806,
"combined_score": 811
},
{
"protein2": "10116.ENSRNOP00000001162",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 236,
"experimental": 0,
"database": 0,
"textmining": 792,
"combined_score": 834
},
{
"protein2": "10116.ENSRNOP00000023327",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 115,
"experimental": 0,
"database": 0,
"textmining": 908,
"combined_score": 914
},
{
"protein2": "10116.ENSRNOP00000029992",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 125,
"database": 0,
"textmining": 758,
"combined_score": 781
},
{
"protein2": "10116.ENSRNOP00000010029",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 301,
"experimental": 0,
"database": 0,
"textmining": 766,
"combined_score": 829
},
{
"protein2": "10116.ENSRNOP00000003733",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 0,
"database": 0,
"textmining": 745,
"combined_score": 752
},
{
"protein2": "10116.ENSRNOP00000003969",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 0,
"database": 0,
"textmining": 702,
"combined_score": 728
},
{
"protein2": "10116.ENSRNOP00000009917",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 203,
"experimental": 0,
"database": 0,
"textmining": 910,
"combined_score": 925
},
{
"protein2": "10116.ENSRNOP00000013701",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 128,
"coexpression": 352,
"experimental": 0,
"database": 0,
"textmining": 875,
"combined_score": 923
},
{
"protein2": "10116.ENSRNOP00000050172",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 85,
"experimental": 0,
"database": 0,
"textmining": 768,
"combined_score": 778
},
{
"protein2": "10116.ENSRNOP00000040429",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 72,
"experimental": 0,
"database": 0,
"textmining": 806,
"combined_score": 811
},
{
"protein2": "10116.ENSRNOP00000010121",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 180,
"experimental": 0,
"database": 0,
"textmining": 672,
"combined_score": 719
},
{
"protein2": "10116.ENSRNOP00000036799",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 0,
"textmining": 732,
"combined_score": 734
},
{
"protein2": "10116.ENSRNOP00000064455",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 564,
"experimental": 0,
"database": 0,
"textmining": 947,
"combined_score": 975
},
{
"protein2": "10116.ENSRNOP00000052022",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 99,
"experimental": 0,
"database": 0,
"textmining": 904,
"combined_score": 909
},
{
"protein2": "10116.ENSRNOP00000026556",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 90,
"experimental": 0,
"database": 0,
"textmining": 712,
"combined_score": 727
},
{
"protein2": "10116.ENSRNOP00000051906",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 286,
"experimental": 0,
"database": 0,
"textmining": 726,
"combined_score": 795
},
{
"protein2": "10116.ENSRNOP00000004406",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 145,
"experimental": 0,
"database": 0,
"textmining": 675,
"combined_score": 709
},
{
"protein2": "10116.ENSRNOP00000041842",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 60,
"experimental": 0,
"database": 500,
"textmining": 834,
"combined_score": 915
},
{
"protein2": "10116.ENSRNOP00000071837",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 100,
"experimental": 100,
"database": 500,
"textmining": 402,
"combined_score": 725
},
{
"protein2": "10116.ENSRNOP00000018776",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 0,
"textmining": 323,
"combined_score": 807
},
{
"protein2": "10116.ENSRNOP00000059867",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 60,
"experimental": 0,
"database": 900,
"textmining": 262,
"combined_score": 924
},
{
"protein2": "10116.ENSRNOP00000017042",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 0,
"textmining": 819,
"combined_score": 820
},
{
"protein2": "10116.ENSRNOP00000036771",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 109,
"experimental": 119,
"database": 0,
"textmining": 940,
"combined_score": 948
},
{
"protein2": "10116.ENSRNOP00000050320",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 176,
"experimental": 0,
"database": 0,
"textmining": 875,
"combined_score": 892
},
{
"protein2": "10116.ENSRNOP00000063859",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 76,
"experimental": 0,
"database": 0,
"textmining": 712,
"combined_score": 722
},
{
"protein2": "10116.ENSRNOP00000073093",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 0,
"database": 0,
"textmining": 696,
"combined_score": 700
},
{
"protein2": "10116.ENSRNOP00000066383",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 214,
"experimental": 0,
"database": 0,
"textmining": 728,
"combined_score": 777
},
{
"protein2": "10116.ENSRNOP00000025743",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 116,
"experimental": 0,
"database": 0,
"textmining": 893,
"combined_score": 901
},
{
"protein2": "10116.ENSRNOP00000049249",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 89,
"experimental": 0,
"database": 0,
"textmining": 881,
"combined_score": 887
},
{
"protein2": "10116.ENSRNOP00000070231",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 312,
"experimental": 65,
"database": 500,
"textmining": 180,
"combined_score": 700
},
{
"protein2": "10116.ENSRNOP00000074881",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 150,
"experimental": 0,
"database": 0,
"textmining": 822,
"combined_score": 842
},
{
"protein2": "10116.ENSRNOP00000012936",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 110,
"experimental": 100,
"database": 500,
"textmining": 501,
"combined_score": 773
},
{
"protein2": "10116.ENSRNOP00000003129",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 132,
"experimental": 788,
"database": 900,
"textmining": 998,
"combined_score": 999
},
{
"protein2": "10116.ENSRNOP00000052371",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 118,
"experimental": 0,
"database": 0,
"textmining": 757,
"combined_score": 776
},
{
"protein2": "10116.ENSRNOP00000027251",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 182,
"experimental": 0,
"database": 0,
"textmining": 825,
"combined_score": 851
},
{
"protein2": "10116.ENSRNOP00000002089",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 792,
"database": 900,
"textmining": 999,
"combined_score": 999
},
{
"protein2": "10116.ENSRNOP00000038369",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 65,
"database": 500,
"textmining": 562,
"combined_score": 777
},
{
"protein2": "10116.ENSRNOP00000051602",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 0,
"textmining": 753,
"combined_score": 754
},
{
"protein2": "10116.ENSRNOP00000009000",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 0,
"textmining": 728,
"combined_score": 728
},
{
"protein2": "10116.ENSRNOP00000003998",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 123,
"experimental": 0,
"database": 0,
"textmining": 685,
"combined_score": 712
},
{
"protein2": "10116.ENSRNOP00000020094",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 97,
"experimental": 0,
"database": 0,
"textmining": 690,
"combined_score": 708
}
] |
A0A096MK21
|
Vesicle-associated membrane protein 4
| null |
Rattus norvegicus (Rat)
| 52
| null |
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLCVLSPARSLILVNP
|
[
"GO:0051234",
"GO:1900242",
"GO:0051649",
"GO:0030100",
"GO:0051641",
"GO:0016189",
"GO:0016050",
"GO:0016043",
"GO:0071840",
"GO:0009987",
"GO:0060627",
"GO:0051179",
"GO:0065007",
"GO:0016192",
"GO:0051049",
"GO:0008150",
"GO:0048284",
"GO:0016197",
"GO:0046907",
"GO:0099532",
"GO:0051128",
"GO:0006996",
"GO:0050789",
"GO:0007032",
"GO:0010256",
"GO:1903421",
"GO:0032879",
"GO:0006810",
"GO:0050794"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0051179",
"GO:0065007",
"GO:0050789",
"GO:0051234",
"GO:0051641",
"GO:0071840",
"GO:0032879",
"GO:0050794",
"GO:0051649",
"GO:0016043",
"GO:0060627",
"GO:0051049",
"GO:0046907",
"GO:0051128",
"GO:0006810",
"GO:0030100",
"GO:0016192",
"GO:0016197",
"GO:0006996",
"GO:0010256",
"GO:1903421",
"GO:1900242",
"GO:0016050",
"GO:0048284",
"GO:0099532",
"GO:0007032",
"GO:0016189"
] | null | null |
[
"IPR042887"
] |
af_db/AF-A0A096MK21-F1-model_v4.cif.gz
| null | null | null |
A0A096MK86
|
Pappalysin
| null |
Rattus norvegicus (Rat)
| 1,623
| null |
MRLWSWVLRLGLLSAALGCGLAERPRRARRDPRAVRPPRPAAGPATCATRAARGRRASPPPPPGGAWEAVRVPRRRQQRAARGAEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQKSPAVITGLYDKCSYTSRDRGWVMGIHTISDQGNRDPRYFFSLKTDRARKVTTIDAHRSYLPGQWVHLAATYDGRLMKLYMNGAQVATSAEQVGGIFSPLTQKCKVLMLGGSALNHNFRGHIEHFSLWKVARTQREILSDMETRGLHTPLPQLLLQENWDNVKRTWSPMKDGHSPQVEFSNAHGFLLDTNLEPPLCGQTLCDNTEVISSYNQLPSFRQSKVVRYRVVNIYDDHHENPTVSWQQIDFQHQQLAEAFQHYNISWELDVLDINSSSLRHRLILANCDISKIGDEKCDPECNHTLTGHDGGDCRQLRYPAFMKKQQNGACDMDCNYERFNFDGGECCDPDITDVTKTCFDPDSPHRAYLDVNELKNILKLDGSTHLNIFFANSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGIPGHTHTMIHEIGHSLGLYHIFRGISEIQSCSDPCMETEPSFETGDLCNDTNPAPKHKFCGDPGPGNDTCGFHGFFDTPYNNFMSYADDDCTDSFTPNQVSRMHCYLDLVYQSWQPSRKPAPVALAPQIVGHTTDSVMLEWFPPIDGHFFERELGSACDLCLEGRILVQYAFNASSPMPCGPSGHWSPREAEGHPDVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQGCYLELEFRYPLVPESLTIWVTFVSSDWDSSGAVNDIKLLTVSGKNISLGPQNVFCDIPLTIRLRDVSEEVYGIQIYTLDEHLEIDAAMLTSAVDSPLCLQCKPLQYKVLRDPPLLDDVGSLLHLNRRFMDMDLKLGNVYQYRIITISGNEESEPSPAAIYTHGSGYCGDGVIQKDQGEECDDMNKVNGDGCSLFCKQEVSFNCIDEPSRCYFHDGDGMCEEFEQKTSIKDCGVYTPQGFLDQWASNASVSHQDQQCPGWVVIGQPAASQVCRTKVIDLSEGISQHAWYPCTINYPYYQLPQTTFWLQTYFSQPMVAAAVIIHLVTDGTYYGDQKQETISVQLLDTKDQSHDLGLHVLSCRNNPLIIPVVHDLSQPFYHSQAVHVSFSSPLVAISGVALRSFDNFDPVTLSSCQRGETYSPAEQSCVHFACEATDCPELTVENASLNCSSSHRYHGAQCTVSCQTGYVLQIQRDDELIKSQVGPSVTVTCTEGKWNKQVACEPVDCGIPDHHHVYAASFSCPEGTTFGRRCSFQCRHPAQLKGNNSFLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSLCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGTCVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGRGSNTIHCRKDGTWSGSFHVCREMQGQCSAPNQLNSHLKLQCPDGYAIGSECATSCLDHNSESIILPVNLTVRDIPHWMNPTRVQRIVCTAGLQWYPHPARIHCVKGCESERKKDRKKGRKKAKEEEEEEEEEEEEEEEEEEEEKREREHCFNFHTTANKIYFSASSYSSKEKYGT
|
[
"GO:0008152",
"GO:0032354",
"GO:0048545",
"GO:0031960",
"GO:0009057",
"GO:1901700",
"GO:0044706",
"GO:0044238",
"GO:0008150",
"GO:0042221",
"GO:0007565",
"GO:0051384",
"GO:0071548",
"GO:0014070",
"GO:1901654",
"GO:1901575",
"GO:0071704",
"GO:0019538",
"GO:1901564",
"GO:0050896",
"GO:0034698",
"GO:1901565",
"GO:0043170",
"GO:0010033",
"GO:0009725",
"GO:0033993",
"GO:0009056",
"GO:0000003",
"GO:0009719",
"GO:0032501",
"GO:0030163",
"GO:0006807",
"GO:0044703",
"GO:0022414",
"GO:0110165",
"GO:0005575",
"GO:0005576",
"GO:0005615"
] |
[
"GO:0008150",
"GO:0008152",
"GO:0050896",
"GO:0000003",
"GO:0032501",
"GO:0022414",
"GO:0044706",
"GO:0044238",
"GO:0042221",
"GO:0071704",
"GO:0009056",
"GO:0009719",
"GO:0006807",
"GO:0044703",
"GO:1901700",
"GO:0007565",
"GO:1901575",
"GO:0019538",
"GO:1901564",
"GO:0043170",
"GO:0010033",
"GO:0009725",
"GO:0048545",
"GO:0009057",
"GO:0014070",
"GO:1901654",
"GO:0034698",
"GO:1901565",
"GO:0033993",
"GO:0030163",
"GO:0032354",
"GO:0031960",
"GO:0071548",
"GO:0051384"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005576",
"GO:0005615"
] |
[
"IPR013320",
"IPR006558",
"IPR024079",
"IPR011936",
"IPR000800",
"IPR043543",
"IPR008754",
"IPR035976",
"IPR000436"
] | null | null | null | null |
A0A0A6YW14
|
Immunoglobulin heavy constant delta
| null |
Mus musculus (Mouse)
| 291
| null |
XNEKGPDMFLLSECKAPEENEKINLGCLVIGSQPLKISWEPKKSSIVEHVFPSEMRNGNYTMVLQVTVLASELNLNHTCTINKPKRKEKPFKFPESWDSQSSKRVTPTLQAKNHSTEATKAITTKKDIEGAMAPSNLTVNILTTSTHPEMSSWLLCEVSGFFPENIHLMWLSVHSKMKSTNFVTANPTPQPGGTFQTWSVLRLPVALSSSLDTYTCVVEHEASKTKLNASKSLAISGIVNTIQHSCIMDEQSDSYMDLEEENGLWPTMCTFVALFLLTLLYSGFVTFIKVK
|
[
"GO:0008152",
"GO:0042100",
"GO:0002449",
"GO:0032946",
"GO:0019724",
"GO:0048856",
"GO:0065007",
"GO:0002696",
"GO:0001775",
"GO:0007275",
"GO:0002250",
"GO:0050670",
"GO:0048518",
"GO:0050776",
"GO:0008150",
"GO:0046651",
"GO:0051251",
"GO:0042127",
"GO:0002440",
"GO:0016445",
"GO:0070661",
"GO:0045321",
"GO:0002200",
"GO:0050896",
"GO:0002520",
"GO:0050789",
"GO:0032944",
"GO:0008283",
"GO:0002566",
"GO:0006955",
"GO:0051240",
"GO:0048731",
"GO:0002684",
"GO:0050794",
"GO:0030888",
"GO:0002460",
"GO:0048583",
"GO:0032502",
"GO:0002376",
"GO:0002682",
"GO:0009987",
"GO:0002443",
"GO:0002694",
"GO:0002252",
"GO:0051239",
"GO:0070665",
"GO:0050864",
"GO:0016064",
"GO:0071704",
"GO:0030890",
"GO:0050871",
"GO:0070663",
"GO:0050865",
"GO:0043170",
"GO:0016446",
"GO:0032943",
"GO:0050867",
"GO:0046649",
"GO:0010467",
"GO:0050671",
"GO:0008284",
"GO:0032501",
"GO:0042113",
"GO:0051249",
"GO:0002377",
"GO:0048522",
"GO:0009897",
"GO:0098552",
"GO:0098797",
"GO:0005575",
"GO:0016020",
"GO:0019814",
"GO:0032991",
"GO:0098802",
"GO:0043235",
"GO:0019815",
"GO:0110165",
"GO:0009986",
"GO:0071944",
"GO:0098796",
"GO:0005886",
"GO:0003823",
"GO:0003674",
"GO:0005488"
] |
[
"GO:0008150",
"GO:0008152",
"GO:0065007",
"GO:0048518",
"GO:0050896",
"GO:0050789",
"GO:0032502",
"GO:0002376",
"GO:0009987",
"GO:0032501",
"GO:0048856",
"GO:0001775",
"GO:0007275",
"GO:0002440",
"GO:0045321",
"GO:0002200",
"GO:0002520",
"GO:0008283",
"GO:0006955",
"GO:0051240",
"GO:0002684",
"GO:0050794",
"GO:0048583",
"GO:0002682",
"GO:0002252",
"GO:0051239",
"GO:0071704",
"GO:0048522",
"GO:0002696",
"GO:0002250",
"GO:0050776",
"GO:0042127",
"GO:0016445",
"GO:0070661",
"GO:0002566",
"GO:0048731",
"GO:0002443",
"GO:0002694",
"GO:0050865",
"GO:0043170",
"GO:0050867",
"GO:0046649",
"GO:0008284",
"GO:0002377",
"GO:0002449",
"GO:0046651",
"GO:0051251",
"GO:0002460",
"GO:0070665",
"GO:0070663",
"GO:0016446",
"GO:0032943",
"GO:0010467",
"GO:0042113",
"GO:0051249",
"GO:0042100",
"GO:0032946",
"GO:0019724",
"GO:0050670",
"GO:0032944",
"GO:0050864",
"GO:0050871",
"GO:0050671",
"GO:0030888",
"GO:0016064",
"GO:0030890"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0003823"
] |
[
"GO:0005575",
"GO:0032991",
"GO:0110165",
"GO:0098552",
"GO:0016020",
"GO:0019814",
"GO:0043235",
"GO:0009986",
"GO:0071944",
"GO:0098796",
"GO:0009897",
"GO:0098797",
"GO:0098802",
"GO:0019815",
"GO:0005886"
] |
[
"IPR007110",
"IPR036179",
"IPR013783",
"IPR003006",
"IPR003597",
"IPR050380"
] | null | null | null | null |
A0A0B4JCT2
|
Uncharacterized protein, isoform B
| null |
Drosophila melanogaster (Fruit fly)
| 298
|
Secreted {ECO:0000256|ARBA:ARBA00004613}.
|
MLDTKWPPLLLLLMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVNAPVYQSGDRPATECRSGRNPVFINLCSVNEIYDSSNLAGLF
|
[
"GO:0046692",
"GO:0019953",
"GO:0070727",
"GO:0051641",
"GO:0009987",
"GO:0065008",
"GO:0060180",
"GO:0019098",
"GO:0065007",
"GO:0045924",
"GO:0051179",
"GO:0044706",
"GO:0007610",
"GO:0008150",
"GO:0008104",
"GO:0007320",
"GO:0032504",
"GO:0007620",
"GO:0007617",
"GO:0048609",
"GO:0046008",
"GO:0000003",
"GO:0032501",
"GO:0033036",
"GO:0044703",
"GO:0022414",
"GO:0110165",
"GO:0005575",
"GO:0005576",
"GO:0005615"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0051179",
"GO:0000003",
"GO:0032501",
"GO:0022414",
"GO:0019953",
"GO:0051641",
"GO:0065008",
"GO:0019098",
"GO:0044706",
"GO:0007610",
"GO:0032504",
"GO:0048609",
"GO:0033036",
"GO:0044703",
"GO:0046692",
"GO:0070727",
"GO:0045924",
"GO:0007320",
"GO:0007617",
"GO:0060180",
"GO:0008104",
"GO:0007620",
"GO:0046008"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005576",
"GO:0005615"
] |
[
"IPR014044",
"IPR035940",
"IPR034763"
] |
af_db/AF-A0A0B4JCT2-F1-model_v4.cif.gz
|
7227.FBpp0292065
|
[
"7227.FBpp0087981",
"7227.FBpp0311920",
"7227.FBpp0080094",
"7227.FBpp0073360",
"7227.FBpp0079747",
"7227.FBpp0307765",
"7227.FBpp0077865",
"7227.FBpp0075075",
"7227.FBpp0084682",
"7227.FBpp0078186",
"7227.FBpp0289812",
"7227.FBpp0082132",
"7227.FBpp0111336",
"7227.FBpp0310285",
"7227.FBpp0074676",
"7227.FBpp0290920",
"7227.FBpp0082175",
"7227.FBpp0311436",
"7227.FBpp0071627",
"7227.FBpp0079094",
"7227.FBpp0082964",
"7227.FBpp0084648",
"7227.FBpp0084296",
"7227.FBpp0309553",
"7227.FBpp0081145",
"7227.FBpp0296953",
"7227.FBpp0077990",
"7227.FBpp0309670",
"7227.FBpp0071719",
"7227.FBpp0309468",
"7227.FBpp0110067",
"7227.FBpp0072820",
"7227.FBpp0080316",
"7227.FBpp0079321",
"7227.FBpp0080342",
"7227.FBpp0079493",
"7227.FBpp0081936",
"7227.FBpp0080979",
"7227.FBpp0072204",
"7227.FBpp0087560",
"7227.FBpp0311918",
"7227.FBpp0311741",
"7227.FBpp0310033",
"7227.FBpp0079692",
"7227.FBpp0293434",
"7227.FBpp0084107",
"7227.FBpp0075572",
"7227.FBpp0084612",
"7227.FBpp0078786",
"7227.FBpp0293427",
"7227.FBpp0079243",
"7227.FBpp0079787",
"7227.FBpp0307721",
"7227.FBpp0298277",
"7227.FBpp0077991",
"7227.FBpp0076270"
] |
[
{
"protein2": "7227.FBpp0087981",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 895,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 895
},
{
"protein2": "7227.FBpp0311920",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 856,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 856
},
{
"protein2": "7227.FBpp0080094",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 839,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 839
},
{
"protein2": "7227.FBpp0073360",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 703,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 703
},
{
"protein2": "7227.FBpp0079747",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 458,
"experimental": 0,
"database": 0,
"textmining": 491,
"combined_score": 712
},
{
"protein2": "7227.FBpp0307765",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 314,
"experimental": 0,
"database": 0,
"textmining": 917,
"combined_score": 940
},
{
"protein2": "7227.FBpp0077865",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 856,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 856
},
{
"protein2": "7227.FBpp0075075",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 836,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 836
},
{
"protein2": "7227.FBpp0084682",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 348,
"experimental": 0,
"database": 0,
"textmining": 834,
"combined_score": 887
},
{
"protein2": "7227.FBpp0078186",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 801,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 801
},
{
"protein2": "7227.FBpp0289812",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 886,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 886
},
{
"protein2": "7227.FBpp0082132",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 913,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 913
},
{
"protein2": "7227.FBpp0111336",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 837,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 837
},
{
"protein2": "7227.FBpp0310285",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 886,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 886
},
{
"protein2": "7227.FBpp0074676",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 850,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 850
},
{
"protein2": "7227.FBpp0290920",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 0,
"textmining": 917,
"combined_score": 930
},
{
"protein2": "7227.FBpp0082175",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 836,
"experimental": 0,
"database": 0,
"textmining": 51,
"combined_score": 837
},
{
"protein2": "7227.FBpp0311436",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 848,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 848
},
{
"protein2": "7227.FBpp0071627",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 744,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 744
},
{
"protein2": "7227.FBpp0079094",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 712,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 712
},
{
"protein2": "7227.FBpp0082964",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 849,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 848
},
{
"protein2": "7227.FBpp0084648",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 706,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 706
},
{
"protein2": "7227.FBpp0084296",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 843,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 843
},
{
"protein2": "7227.FBpp0309553",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 379,
"experimental": 0,
"database": 0,
"textmining": 626,
"combined_score": 757
},
{
"protein2": "7227.FBpp0081145",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 843,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 843
},
{
"protein2": "7227.FBpp0296953",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 929,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 929
},
{
"protein2": "7227.FBpp0077990",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 413,
"experimental": 0,
"database": 0,
"textmining": 658,
"combined_score": 790
},
{
"protein2": "7227.FBpp0309670",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 821,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 820
},
{
"protein2": "7227.FBpp0071719",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 700,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 700
},
{
"protein2": "7227.FBpp0309468",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 340,
"experimental": 0,
"database": 0,
"textmining": 900,
"combined_score": 931
},
{
"protein2": "7227.FBpp0110067",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 175,
"experimental": 0,
"database": 0,
"textmining": 668,
"combined_score": 714
},
{
"protein2": "7227.FBpp0072820",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 237,
"experimental": 0,
"database": 0,
"textmining": 791,
"combined_score": 833
},
{
"protein2": "7227.FBpp0080316",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 726,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 726
},
{
"protein2": "7227.FBpp0079321",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 271,
"experimental": 0,
"database": 0,
"textmining": 669,
"combined_score": 748
},
{
"protein2": "7227.FBpp0080342",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 0,
"textmining": 828,
"combined_score": 843
},
{
"protein2": "7227.FBpp0079493",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 833,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 833
},
{
"protein2": "7227.FBpp0081936",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 709,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 709
},
{
"protein2": "7227.FBpp0080979",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 567,
"experimental": 0,
"database": 0,
"textmining": 430,
"combined_score": 742
},
{
"protein2": "7227.FBpp0072204",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 853,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 853
},
{
"protein2": "7227.FBpp0087560",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 201,
"experimental": 0,
"database": 0,
"textmining": 916,
"combined_score": 930
},
{
"protein2": "7227.FBpp0311918",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 851,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 851
},
{
"protein2": "7227.FBpp0311741",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 589,
"experimental": 0,
"database": 0,
"textmining": 433,
"combined_score": 757
},
{
"protein2": "7227.FBpp0310033",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 859,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 859
},
{
"protein2": "7227.FBpp0079692",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 855,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 855
},
{
"protein2": "7227.FBpp0293434",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 709,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 709
},
{
"protein2": "7227.FBpp0084107",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 718,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 718
},
{
"protein2": "7227.FBpp0075572",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 267,
"experimental": 0,
"database": 0,
"textmining": 834,
"combined_score": 873
},
{
"protein2": "7227.FBpp0084612",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 848,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 848
},
{
"protein2": "7227.FBpp0078786",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 497,
"experimental": 0,
"database": 0,
"textmining": 660,
"combined_score": 821
},
{
"protein2": "7227.FBpp0293427",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 868,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 868
},
{
"protein2": "7227.FBpp0079243",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 479,
"experimental": 0,
"database": 0,
"textmining": 603,
"combined_score": 784
},
{
"protein2": "7227.FBpp0079787",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 750,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 750
},
{
"protein2": "7227.FBpp0307721",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 850,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 850
},
{
"protein2": "7227.FBpp0298277",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 855,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 855
},
{
"protein2": "7227.FBpp0077991",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 257,
"experimental": 0,
"database": 0,
"textmining": 893,
"combined_score": 917
},
{
"protein2": "7227.FBpp0076270",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 753,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 753
}
] |
A0A0B4JDB9
|
Eukaryotic translation initiation factor 4E homologous protein, isoform D
| null |
Drosophila melanogaster (Fruit fly)
| 242
| null |
MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQHTYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQFLVGDEICGVVLQTKYPEDSLSVWHRTATDMTSTTRIRDTLRRILNIPLTTALEYKIHCDSLKYVSMPRRQNHKLGNLFYRNRYGFNSRYGKS
|
[
"GO:0062013",
"GO:0065008",
"GO:0017148",
"GO:0019218",
"GO:0065007",
"GO:0051172",
"GO:0032352",
"GO:0010565",
"GO:0048518",
"GO:0045966",
"GO:0046886",
"GO:0050810",
"GO:0045940",
"GO:0008150",
"GO:0034248",
"GO:0010556",
"GO:0032350",
"GO:0050789",
"GO:0031325",
"GO:0019222",
"GO:0051246",
"GO:0090031",
"GO:0010605",
"GO:0090030",
"GO:0046885",
"GO:2000112",
"GO:0009889",
"GO:0050794",
"GO:0051248",
"GO:0062012",
"GO:0031326",
"GO:0051171",
"GO:0009893",
"GO:0007554",
"GO:0010893",
"GO:0046889",
"GO:0060255",
"GO:0007553",
"GO:0031323",
"GO:0009890",
"GO:0006417",
"GO:0046890",
"GO:0010558",
"GO:0080090",
"GO:0031327",
"GO:0010817",
"GO:2000113",
"GO:0031324",
"GO:0045834",
"GO:0019216",
"GO:0048523",
"GO:0048519",
"GO:0010566",
"GO:0009891",
"GO:0031328",
"GO:0010629",
"GO:0010468",
"GO:0034249",
"GO:0045998",
"GO:0009892",
"GO:0048522",
"GO:0010608",
"GO:0045182",
"GO:0003676",
"GO:0005488",
"GO:0003723",
"GO:0030371",
"GO:0000340",
"GO:0000339",
"GO:0097159",
"GO:0003674",
"GO:1901363",
"GO:0005515"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0048518",
"GO:0050789",
"GO:0048519",
"GO:0065008",
"GO:0019222",
"GO:0050794",
"GO:0009893",
"GO:0048523",
"GO:0009892",
"GO:0048522",
"GO:0062013",
"GO:0051172",
"GO:0032352",
"GO:0032350",
"GO:0031325",
"GO:0010605",
"GO:0009889",
"GO:0062012",
"GO:0051171",
"GO:0060255",
"GO:0031323",
"GO:0009890",
"GO:0080090",
"GO:0010817",
"GO:0031324",
"GO:0045834",
"GO:0009891",
"GO:0010565",
"GO:0045966",
"GO:0046886",
"GO:0045940",
"GO:0034248",
"GO:0010556",
"GO:0051246",
"GO:0046885",
"GO:0051248",
"GO:0031326",
"GO:0046889",
"GO:0007553",
"GO:0046890",
"GO:0010558",
"GO:0031327",
"GO:0019216",
"GO:0031328",
"GO:0010629",
"GO:0010468",
"GO:0034249",
"GO:0017148",
"GO:0019218",
"GO:0050810",
"GO:0090031",
"GO:0090030",
"GO:2000112",
"GO:0007554",
"GO:0010893",
"GO:0006417",
"GO:2000113",
"GO:0010566",
"GO:0045998",
"GO:0010608"
] |
[
"GO:0003674",
"GO:0045182",
"GO:0005488",
"GO:0030371",
"GO:0097159",
"GO:1901363",
"GO:0005515",
"GO:0003676",
"GO:0003723",
"GO:0000339",
"GO:0000340"
] | null |
[
"IPR023398",
"IPR001040"
] |
af_db/AF-A0A0B4JDB9-F1-model_v4.cif.gz
| null | null | null |
A0A0B4K621
|
Rfx, isoform G
| null |
Drosophila melanogaster (Fruit fly)
| 860
| null |
MHSRYGFDCQTRHYQQHQQTHHQHHHHHHPNPPCSIPLESPPTPPVISPSAAAAVAYSNLLEKCRCKQSVAANPVPAPPAQLQLQLHHHHHHHHHQTFVASASATSYSNCSALGLGSRTGSGSGSGSGTGSTPSTSSLANSSCAAATNISGGSSNATMYHHHHRRHNNLSYCGVSGQEQNYQVQYVDSELYHSNSSQTQMTYPFCPVGDYQGNGQTAYYSTTGQYGTTSSAGGSSNGAHSTTLPYLVPVEEGILLNGSAHSLSQSQSQSHGRDSPHSLTEVAYIQEAQSTPQTPTSTTTTHSASGGSLGTGGGGASPDSDQSALGSSNKIASATIKWLSRNYETADGVSLPRSTLYNHYMQHCSEHKLEPVNAASFGKLIRSVFSGLRTRRLGTRGNSKYHYYGIRIKPGSLLNSQAMDDKQMLAAGYGPSSDGTGGPGSGPMVSVTSSTAGQLTGSNGLGGGHGQRHSNGTKKHTFKPETYEACIQYIGDGTSALPSFPPIELNHSFNSELTLEDVDTFRGLYREHCESFLDAVLNLEFNTVEFLLRDFWRASDNNNLDECEEEKYLSKTKLYLLCHCAEVQKFVREVDYQFYQNTVDVIIPDVLRSIPNALTQAIRNFAKNLEIWLCESMLGVPEQLAQIKTSAVSAFCQTLRRYTSLNHLAQAARAVLQNGAQISQMLSDLNRVDFHNVQEQAAWVSQCAPAVVQRLESDFKAALQQQSSLEQWASWLQLVVESAMEEYNGKPTYARAARQFLLKWSFYSSMIIRDLTLRSASSFGSFHLIRLLFDEYMFYLVEHKIAEAQDKTAIAVICERMKKDMDFEFECQFAYITSDTEHQTTPSSASSGGDVGNEAKRLKQE
|
[
"GO:0032989",
"GO:0000902",
"GO:0048667",
"GO:0048869",
"GO:0048856",
"GO:0065007",
"GO:0022008",
"GO:0007275",
"GO:0007605",
"GO:0009653",
"GO:0000904",
"GO:0030030",
"GO:0008150",
"GO:0007399",
"GO:0010556",
"GO:0050789",
"GO:0048468",
"GO:0019222",
"GO:0030154",
"GO:0016358",
"GO:0031175",
"GO:0032990",
"GO:0048731",
"GO:0009889",
"GO:0050794",
"GO:0051171",
"GO:0031326",
"GO:0048812",
"GO:0048699",
"GO:1903506",
"GO:0032502",
"GO:0060255",
"GO:0009987",
"GO:0031323",
"GO:0016043",
"GO:0019219",
"GO:0071840",
"GO:0050877",
"GO:0048813",
"GO:2001141",
"GO:0080090",
"GO:0120039",
"GO:0051252",
"GO:0120036",
"GO:0050954",
"GO:0048858",
"GO:0006355",
"GO:0030182",
"GO:0003008",
"GO:0007600",
"GO:0010468",
"GO:0032501",
"GO:0048666",
"GO:0003676",
"GO:0003677",
"GO:0097159",
"GO:0005488",
"GO:1901363",
"GO:0003674",
"GO:0043565"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050789",
"GO:0032502",
"GO:0009987",
"GO:0032501",
"GO:0048869",
"GO:0048856",
"GO:0007275",
"GO:0009653",
"GO:0019222",
"GO:0050794",
"GO:0071840",
"GO:0003008",
"GO:0032989",
"GO:0000902",
"GO:0048468",
"GO:0030154",
"GO:0016358",
"GO:0048731",
"GO:0009889",
"GO:0051171",
"GO:0060255",
"GO:0031323",
"GO:0016043",
"GO:0050877",
"GO:0080090",
"GO:0022008",
"GO:0000904",
"GO:0030030",
"GO:0007399",
"GO:0010556",
"GO:0032990",
"GO:0031326",
"GO:0019219",
"GO:0048813",
"GO:0051252",
"GO:0048858",
"GO:0030182",
"GO:0007600",
"GO:0010468",
"GO:0048666",
"GO:0048667",
"GO:0031175",
"GO:0048699",
"GO:2001141",
"GO:0120039",
"GO:0120036",
"GO:0050954",
"GO:0006355",
"GO:0007605",
"GO:0048812",
"GO:1903506"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0097159",
"GO:1901363",
"GO:0003676",
"GO:0003677",
"GO:0043565"
] | null |
[
"IPR003150",
"IPR039779",
"IPR036388",
"IPR036390"
] |
af_db/AF-A0A0B4K621-F1-model_v4.cif.gz
| null | null | null |
A0A0B4K6N2
|
Forkhead box P, isoform C
| null |
Drosophila melanogaster (Fruit fly)
| 520
|
Nucleus {ECO:0000256|ARBA:ARBA00004123, ECO:0000256|PROSITE-ProRule:PRU00089}.
|
MHRIHDDEYSEDAKESDFKSSIQKEISVKSRHQISIPDICSDAVKNNCFPPTGFLNNSITFASHVVKCSSPASSIDESSTAAQQHESNPHMHIQGQHMMAPVPDLGFYNVPEFISEQEKLMFSDAERFLRSKDNEVCNNDFSYMHDEFAMRKYYHPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQAMMHHLYLSKQLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQTNSPSPLNLPMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVPTDKNPCDNCTQHCTSLPPGADNPLDSNNPNDLGRIGCLPYCGSDGLSKASKDYSNMDSGMIESNSHLTIDEYSTNMYESSANEHNR
|
[
"GO:0035106",
"GO:0008049",
"GO:0016545",
"GO:0040011",
"GO:0019098",
"GO:0050890",
"GO:0048065",
"GO:0050877",
"GO:0007612",
"GO:0008150",
"GO:0007619",
"GO:0032504",
"GO:0007617",
"GO:0060179",
"GO:0007611",
"GO:0003008",
"GO:0000003",
"GO:0032501",
"GO:0007610",
"GO:0045433",
"GO:0022414",
"GO:0042803",
"GO:0042802",
"GO:0005488",
"GO:0003674",
"GO:0005515",
"GO:0046983"
] |
[
"GO:0008150",
"GO:0040011",
"GO:0000003",
"GO:0032501",
"GO:0022414",
"GO:0019098",
"GO:0032504",
"GO:0003008",
"GO:0007610",
"GO:0050877",
"GO:0007617",
"GO:0007611",
"GO:0050890",
"GO:0007612",
"GO:0007619",
"GO:0060179",
"GO:0035106",
"GO:0008049",
"GO:0048065",
"GO:0045433",
"GO:0016545"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0005515",
"GO:0042802",
"GO:0046983",
"GO:0042803"
] | null |
[
"IPR001766",
"IPR050998",
"IPR032354",
"IPR036388",
"IPR036390"
] |
af_db/AF-A0A0B4K6N2-F1-model_v4.cif.gz
|
7227.FBpp0293409
| null | null |
A0A0B4K711
|
N-acetylgalactosaminide beta-1,3-galactosyltransferase (EC 2.4.1.122)
| null |
Drosophila melanogaster (Fruit fly)
| 444
|
Membrane {ECO:0000256|ARBA:ARBA00004606}; Single-pass type II membrane protein {ECO:0000256|ARBA:ARBA00004606}.
|
MSETIYCLAPRSKNRSVFTLIAGLVVGYCLAQIFSSIAPHESLYPYLSRRFSDSQVATGGQLAPEQSGLKHDHRNDNVSVAEQLKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSGADEELPTVKLDVGEGRENLWAKVKEAFKYVYHHHYNDADFFYKADDDTYAVIENMRYMLYPYNPETPVHFGFKFKPFVKQGYMSGGAGYILSREALRRFVVEGIPNPKMCLPGTVVNEDIEIGRCMENLNVTAGDSRDEIGRGRMFPFIPEHHLIPAKADKNFWYWNYLYYKTDDGLDCCSDLAISFHYVAPNSFYVLDYLIYHLKPYGLLRSLEPLPAKLKVGQFLPPPVEARGRLASNEDSADDYDRIYTTTTEKPKEPDAREMDSKEVEKEDAKYREKLSKEDEEREDSRKTDNDSEYTEEETEKRSKSKETSKEN
|
[
"GO:0008152",
"GO:0036211",
"GO:1901566",
"GO:0044249",
"GO:0009987",
"GO:0009059",
"GO:0006486",
"GO:0009058",
"GO:0044238",
"GO:0009101",
"GO:0044237",
"GO:0043412",
"GO:0008150",
"GO:1901564",
"GO:1901576",
"GO:0034645",
"GO:0071704",
"GO:1901137",
"GO:0009100",
"GO:0044260",
"GO:0043170",
"GO:0043413",
"GO:1901135",
"GO:0019538",
"GO:0006807",
"GO:0070085",
"GO:0005794",
"GO:0043229",
"GO:0043226",
"GO:0005622",
"GO:0110165",
"GO:0005797",
"GO:0031985",
"GO:0005737",
"GO:0005575",
"GO:0043227",
"GO:0012505",
"GO:0031984",
"GO:0043231",
"GO:0098791",
"GO:0005795",
"GO:0008378",
"GO:0016740",
"GO:0048531",
"GO:0003674",
"GO:0003824",
"GO:0016757",
"GO:0016758"
] |
[
"GO:0008150",
"GO:0008152",
"GO:0009987",
"GO:0009058",
"GO:0044238",
"GO:0044237",
"GO:0071704",
"GO:0006807",
"GO:0070085",
"GO:0044249",
"GO:1901564",
"GO:1901576",
"GO:0044260",
"GO:0043170",
"GO:0043413",
"GO:1901135",
"GO:0019538",
"GO:0036211",
"GO:1901566",
"GO:0009059",
"GO:0006486",
"GO:0043412",
"GO:0034645",
"GO:1901137",
"GO:0009100",
"GO:0009101"
] |
[
"GO:0003674",
"GO:0003824",
"GO:0016740",
"GO:0016757",
"GO:0016758",
"GO:0008378",
"GO:0048531"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0043226",
"GO:0005622",
"GO:0005737",
"GO:0012505",
"GO:0031984",
"GO:0005794",
"GO:0043229",
"GO:0043227",
"GO:0098791",
"GO:0031985",
"GO:0043231",
"GO:0005795",
"GO:0005797"
] |
[
"IPR026050",
"IPR003378"
] |
af_db/AF-A0A0B4K711-F1-model_v4.cif.gz
| null | null | null |
A0A0B4K7I2
|
Smooth, isoform T
| null |
Drosophila melanogaster (Fruit fly)
| 552
| null |
MPYNGASNGSGASGAGGGGATIVVTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLYVATLSTPQQHVSHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHHQQQLVAPAQSHNLYQFKEPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN
|
[
"GO:0032989",
"GO:0009605",
"GO:0040011",
"GO:0000902",
"GO:0048667",
"GO:0048869",
"GO:0048856",
"GO:0022008",
"GO:0008343",
"GO:0007275",
"GO:0009653",
"GO:0008340",
"GO:0000904",
"GO:0007411",
"GO:0008150",
"GO:0030030",
"GO:0042221",
"GO:0007399",
"GO:0050896",
"GO:0048468",
"GO:0042330",
"GO:0030154",
"GO:0031175",
"GO:0097485",
"GO:0032990",
"GO:0048731",
"GO:0048812",
"GO:0048699",
"GO:0007631",
"GO:0032502",
"GO:0009987",
"GO:0016043",
"GO:0071840",
"GO:0030534",
"GO:0120039",
"GO:0120036",
"GO:0061564",
"GO:0006935",
"GO:0048858",
"GO:0007409",
"GO:0030182",
"GO:0032501",
"GO:0048666",
"GO:0007610",
"GO:0005622",
"GO:0031981",
"GO:0043229",
"GO:0043226",
"GO:0110165",
"GO:0043231",
"GO:0070013",
"GO:0043233",
"GO:0005575",
"GO:0043227",
"GO:0031974",
"GO:0005634",
"GO:0005654"
] |
[
"GO:0008150",
"GO:0040011",
"GO:0050896",
"GO:0032502",
"GO:0009987",
"GO:0032501",
"GO:0009605",
"GO:0048869",
"GO:0048856",
"GO:0007275",
"GO:0009653",
"GO:0008340",
"GO:0042221",
"GO:0042330",
"GO:0071840",
"GO:0007610",
"GO:0032989",
"GO:0000902",
"GO:0048468",
"GO:0030154",
"GO:0048731",
"GO:0007631",
"GO:0016043",
"GO:0030534",
"GO:0006935",
"GO:0022008",
"GO:0008343",
"GO:0000904",
"GO:0030030",
"GO:0007399",
"GO:0097485",
"GO:0032990",
"GO:0048858",
"GO:0030182",
"GO:0048666",
"GO:0048667",
"GO:0007411",
"GO:0031175",
"GO:0048699",
"GO:0120039",
"GO:0120036",
"GO:0048812",
"GO:0061564",
"GO:0007409"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0031974",
"GO:0005654",
"GO:0043229",
"GO:0043233",
"GO:0043227",
"GO:0043231",
"GO:0070013",
"GO:0031981",
"GO:0005634"
] |
[
"IPR055204",
"IPR012677",
"IPR021790",
"IPR035979",
"IPR000504"
] |
af_db/AF-A0A0B4K7I2-F1-model_v4.cif.gz
|
7227.FBpp0300947
|
[
"7227.FBpp0300969",
"7227.FBpp0297632",
"7227.FBpp0075684",
"7227.FBpp0089363",
"7227.FBpp0290145",
"7227.FBpp0303793",
"7227.FBpp0301731",
"7227.FBpp0073610"
] |
[
{
"protein2": "7227.FBpp0300969",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 994,
"database": 0,
"textmining": 0,
"combined_score": 994
},
{
"protein2": "7227.FBpp0297632",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 118,
"coexpression": 147,
"experimental": 534,
"database": 400,
"textmining": 346,
"combined_score": 837
},
{
"protein2": "7227.FBpp0075684",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 263,
"experimental": 103,
"database": 540,
"textmining": 143,
"combined_score": 704
},
{
"protein2": "7227.FBpp0089363",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 320,
"experimental": 475,
"database": 400,
"textmining": 262,
"combined_score": 820
},
{
"protein2": "7227.FBpp0290145",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 133,
"experimental": 268,
"database": 400,
"textmining": 407,
"combined_score": 743
},
{
"protein2": "7227.FBpp0303793",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 295,
"experimental": 48,
"database": 540,
"textmining": 148,
"combined_score": 701
},
{
"protein2": "7227.FBpp0301731",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 994,
"database": 0,
"textmining": 0,
"combined_score": 994
},
{
"protein2": "7227.FBpp0073610",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 731,
"database": 0,
"textmining": 0,
"combined_score": 731
}
] |
A0A0B4K7M0
|
Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform H (EC 2.7.1.68)
| null |
Drosophila melanogaster (Fruit fly)
| 756
| null |
MASGDGDTINTIDMDSSSASQAKLAEPSNASTDHVGNSSPDLGNRPNRASSKADKERKIGHRRVGEGGEITYKKIQTSQIMGSIQLGIQHTVGSLASKPKRDLLMMDFWEIESITFPPEGSSLTPAHHYSEFRYKIYAPIAFRYFRDLFGIQPDDFMMSMCTSPLRELSNPGASGSIFYLTTDDEFIIKTVQHKEGEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCLQTSNAKNIRLVVMNNLLPSSVKMHLKYDLKGSTFKRKANKAERAKKSPTYKDLDFMEQHPNGIFLEAETYAALIKTIQRDCTVLESFKIMDYSLLLGVHNLDVALKEKQSEQRKPLRAPLAEDSDVDADDPLDGDAATGISRNKSVNRQRLVAHSTAMESIQAESEPIDDEEDVPPGGIPARSEKGERLLLYIGIIDILQSYRLKKKLEHTFKSIIHDGETVSVCRPSFYAQRFQNFMAKTVFRKIPSPLKHSPSKRKSLSKAIQRSIDSDNEVASRPVHASHSHSSGKIHQPAKPPTTEPTPAGAAGGAERGATALGPATTSGASERAPPPVKQRTPAASNLKTRVPPPVPPRGSPRRKDAQDRTTPGTTPSCSSTPPPAFDDISEDSSNKNSSSSIGRRSHHHHHHHQQSQQHQQSYYLDRKMNIGPAYRGSYKEDIVSVSEVHLDTLLAVDTSSSSQYGSRGGLAWTPPASGEGSTPTWTEGTPSFTDSSSSGDLDNFSPINSSKIDRHKPTVEEAINSLSAGMIN
|
[
"GO:0009581",
"GO:0009605",
"GO:0071478",
"GO:0009628",
"GO:0050793",
"GO:0065008",
"GO:0065007",
"GO:0009416",
"GO:0051963",
"GO:1903725",
"GO:0007603",
"GO:0048518",
"GO:0104004",
"GO:0008150",
"GO:0010562",
"GO:0019220",
"GO:0050807",
"GO:0050896",
"GO:0050789",
"GO:0010511",
"GO:0031325",
"GO:0019222",
"GO:0009314",
"GO:1901888",
"GO:0071214",
"GO:0009889",
"GO:0050794",
"GO:0009584",
"GO:0031326",
"GO:0009893",
"GO:0051716",
"GO:0046889",
"GO:0009987",
"GO:0009582",
"GO:0010513",
"GO:0023052",
"GO:0050803",
"GO:0031323",
"GO:0045937",
"GO:0046890",
"GO:0071073",
"GO:0051606",
"GO:0080090",
"GO:0008582",
"GO:0051128",
"GO:0071071",
"GO:0045834",
"GO:0019216",
"GO:0007602",
"GO:0009891",
"GO:0031328",
"GO:1903727",
"GO:0007154",
"GO:0007165",
"GO:0040008",
"GO:0048638",
"GO:0051174",
"GO:0044087",
"GO:1904396",
"GO:0071482",
"GO:0048522",
"GO:0009583",
"GO:0098858",
"GO:0033583",
"GO:0098590",
"GO:0042995",
"GO:0005575",
"GO:0031253",
"GO:0016020",
"GO:0120025",
"GO:0016028",
"GO:0035997",
"GO:0110165",
"GO:0005902",
"GO:0031528",
"GO:0071944",
"GO:0035996",
"GO:0005886"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0048518",
"GO:0050896",
"GO:0050789",
"GO:0009987",
"GO:0023052",
"GO:0009605",
"GO:0009628",
"GO:0050793",
"GO:0065008",
"GO:0019222",
"GO:0050794",
"GO:0009893",
"GO:0051716",
"GO:0051606",
"GO:0007154",
"GO:0007165",
"GO:0040008",
"GO:0048522",
"GO:0009581",
"GO:0104004",
"GO:0031325",
"GO:0009314",
"GO:0071214",
"GO:0009889",
"GO:0009582",
"GO:0050803",
"GO:0031323",
"GO:0080090",
"GO:0051128",
"GO:0045834",
"GO:0007602",
"GO:0009891",
"GO:0048638",
"GO:0044087",
"GO:0071478",
"GO:0009416",
"GO:0007603",
"GO:0010562",
"GO:0050807",
"GO:1901888",
"GO:0031326",
"GO:0046889",
"GO:0046890",
"GO:0008582",
"GO:0019216",
"GO:0031328",
"GO:1903727",
"GO:0051174",
"GO:0009583",
"GO:0051963",
"GO:1903725",
"GO:0019220",
"GO:0010511",
"GO:0009584",
"GO:0010513",
"GO:0045937",
"GO:0071073",
"GO:0071071",
"GO:1904396",
"GO:0071482"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0042995",
"GO:0016020",
"GO:0071944",
"GO:0098590",
"GO:0120025",
"GO:0005886",
"GO:0098858",
"GO:0031253",
"GO:0016028",
"GO:0033583",
"GO:0005902",
"GO:0031528",
"GO:0035996",
"GO:0035997"
] |
[
"IPR027483",
"IPR002498",
"IPR027484",
"IPR023610"
] |
af_db/AF-A0A0B4K7M0-F1-model_v4.cif.gz
| null | null | null |
A0A0B4K7W6
|
Without children, isoform C
| null |
Drosophila melanogaster (Fruit fly)
| 712
| null |
MSTKMGINTGKGGVGGKKSGSGTMLPVISTVQSLASGETEARIGNLTVRRKRGRPRESGTSSPPLSMPGVHPPAQRGRPRKHAVDYSARSPSPTMSGGSSHMGIPVRRNTTTTMDFGPATVTETKIITVPPYPKAVRNVNISCKPLTVTQGEQCSPDVRDCATQTEKDYSNKVLIPVPVPIFVPQPMYMYSAPFPVPVPIPLPIPVPIFIPTTRNTAQGILKEIKKIQDKMPEDPLEAELLMMAEMVAEEKHESDSDSDNEIKPDPGLVALQYQNSLESVAQQQQQQQVVDVSGAGHNPYGDDMLQIALKMATGDYDNHHQTSTVDLETSMTANTISSQSPMGHDGMGQMGVHHLDQQHHMLDATQRTARGRKRGVGVVMDPPNRNSRSPVKRQRGGEMDHSALQQQSQQAQQPQEKPDAQMFLKYTFGVNAWKQWVMTKNADIEKSSMRRRPFKTELLQMTADELNYSLCLFVKEVRKPNGTEYAPDTIYYLVLGIQQYLYVNGRIDNIFYDPYYERFTECLDEVARKFSVLYNDSQYIVTRVEEEHLWECKQLGAHSPHVLLSTLMFFNTKHFNLTTVEEHMQLSFSHIMKHWKRSSQNSKVPGSRNVLLRFYPPQAGLDANPRKKKVYEQQENEENPLRCPVRLYEFYLSKCPESVKTRNDVFYLQPERSCVPDSPVWYSTQALGQDALQRMLHRVKMVKEINIALLTT
|
[
"GO:0008152",
"GO:0042180",
"GO:0006357",
"GO:1901615",
"GO:0048856",
"GO:0002165",
"GO:0007275",
"GO:1901362",
"GO:0009058",
"GO:0008205",
"GO:1901576",
"GO:0010556",
"GO:0050789",
"GO:0019222",
"GO:0008202",
"GO:0006694",
"GO:0016126",
"GO:1901617",
"GO:0060255",
"GO:0042445",
"GO:0006066",
"GO:0044249",
"GO:2001141",
"GO:0071704",
"GO:0010817",
"GO:1902653",
"GO:0006355",
"GO:0046165",
"GO:0042446",
"GO:0010468",
"GO:0032501",
"GO:0009791",
"GO:0016125",
"GO:1902652",
"GO:0065008",
"GO:0065007",
"GO:0044237",
"GO:1901360",
"GO:0008150",
"GO:0006629",
"GO:0044283",
"GO:0044281",
"GO:0006697",
"GO:0009889",
"GO:0050794",
"GO:0051171",
"GO:0031326",
"GO:1903506",
"GO:0032502",
"GO:0045455",
"GO:0009987",
"GO:0031323",
"GO:0019219",
"GO:0042181",
"GO:0080090",
"GO:0051252",
"GO:0045456",
"GO:0008610",
"GO:0044238",
"GO:0005622",
"GO:0043226",
"GO:0098687",
"GO:0005700",
"GO:0000791",
"GO:0005575",
"GO:0000785",
"GO:0043231",
"GO:0032991",
"GO:0005694",
"GO:0043229",
"GO:0110165",
"GO:0043232",
"GO:0043227",
"GO:0005634",
"GO:0005705",
"GO:0043228",
"GO:0003682",
"GO:0003674",
"GO:0005488",
"GO:0005515"
] |
[
"GO:0008150",
"GO:0008152",
"GO:0050789",
"GO:0032501",
"GO:0065007",
"GO:0032502",
"GO:0009987",
"GO:0048856",
"GO:0007275",
"GO:0009058",
"GO:0019222",
"GO:0042445",
"GO:0071704",
"GO:0009791",
"GO:0065008",
"GO:0044237",
"GO:0044281",
"GO:0050794",
"GO:0044238",
"GO:0042180",
"GO:1901615",
"GO:0002165",
"GO:1901576",
"GO:0060255",
"GO:0006066",
"GO:0044249",
"GO:0010817",
"GO:0042446",
"GO:1901360",
"GO:0006629",
"GO:0044283",
"GO:0009889",
"GO:0051171",
"GO:0045455",
"GO:0031323",
"GO:0080090",
"GO:1901362",
"GO:0008205",
"GO:0010556",
"GO:0008202",
"GO:1901617",
"GO:0046165",
"GO:0010468",
"GO:0016125",
"GO:1902652",
"GO:0031326",
"GO:0019219",
"GO:0042181",
"GO:0051252",
"GO:0045456",
"GO:0008610",
"GO:0006694",
"GO:0016126",
"GO:2001141",
"GO:1902653",
"GO:0006355",
"GO:0006697",
"GO:0006357",
"GO:1903506"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0003682",
"GO:0005515"
] |
[
"GO:0005575",
"GO:0032991",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0098687",
"GO:0000785",
"GO:0000791",
"GO:0043229",
"GO:0043227",
"GO:0005705",
"GO:0043228",
"GO:0043231",
"GO:0043232",
"GO:0005694",
"GO:0005634",
"GO:0005700"
] |
[
"IPR021893",
"IPR051284"
] |
af_db/AF-A0A0B4K7W6-F1-model_v4.cif.gz
| null | null | null |
A0A0B4K852
|
Smooth, isoform M
| null |
Drosophila melanogaster (Fruit fly)
| 497
| null |
MPYNGASNGSGASGAGGGGATIVVTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPIKEIGNGRSPLLQEPLYEPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN
|
[
"GO:0032989",
"GO:0009605",
"GO:0040011",
"GO:0000902",
"GO:0048667",
"GO:0048869",
"GO:0048856",
"GO:0022008",
"GO:0008343",
"GO:0007275",
"GO:0009653",
"GO:0008340",
"GO:0000904",
"GO:0007411",
"GO:0008150",
"GO:0030030",
"GO:0042221",
"GO:0007399",
"GO:0050896",
"GO:0048468",
"GO:0042330",
"GO:0030154",
"GO:0031175",
"GO:0097485",
"GO:0032990",
"GO:0048731",
"GO:0048812",
"GO:0048699",
"GO:0007631",
"GO:0032502",
"GO:0009987",
"GO:0016043",
"GO:0071840",
"GO:0030534",
"GO:0120039",
"GO:0120036",
"GO:0061564",
"GO:0006935",
"GO:0048858",
"GO:0007409",
"GO:0030182",
"GO:0032501",
"GO:0048666",
"GO:0007610",
"GO:0005622",
"GO:0031981",
"GO:0043229",
"GO:0043226",
"GO:0110165",
"GO:0043231",
"GO:0070013",
"GO:0043233",
"GO:0005575",
"GO:0043227",
"GO:0031974",
"GO:0005634",
"GO:0005654"
] |
[
"GO:0008150",
"GO:0040011",
"GO:0050896",
"GO:0032502",
"GO:0009987",
"GO:0032501",
"GO:0009605",
"GO:0048869",
"GO:0048856",
"GO:0007275",
"GO:0009653",
"GO:0008340",
"GO:0042221",
"GO:0042330",
"GO:0071840",
"GO:0007610",
"GO:0032989",
"GO:0000902",
"GO:0048468",
"GO:0030154",
"GO:0048731",
"GO:0007631",
"GO:0016043",
"GO:0030534",
"GO:0006935",
"GO:0022008",
"GO:0008343",
"GO:0000904",
"GO:0030030",
"GO:0007399",
"GO:0097485",
"GO:0032990",
"GO:0048858",
"GO:0030182",
"GO:0048666",
"GO:0048667",
"GO:0007411",
"GO:0031175",
"GO:0048699",
"GO:0120039",
"GO:0120036",
"GO:0048812",
"GO:0061564",
"GO:0007409"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0031974",
"GO:0005654",
"GO:0043229",
"GO:0043233",
"GO:0043227",
"GO:0043231",
"GO:0070013",
"GO:0031981",
"GO:0005634"
] |
[
"IPR006536",
"IPR055204",
"IPR012677",
"IPR021790",
"IPR035979",
"IPR000504"
] |
af_db/AF-A0A0B4K852-F1-model_v4.cif.gz
| null | null | null |
A0A0B4KER3
|
Stac-like, isoform O
| null |
Drosophila melanogaster (Fruit fly)
| 1,156
|
Cell membrane, sarcolemma {ECO:0000256|ARBA:ARBA00004278}; Peripheral membrane protein {ECO:0000256|ARBA:ARBA00004278}; Cytoplasmic side {ECO:0000256|ARBA:ARBA00004278}. Cytoplasm {ECO:0000256|ARBA:ARBA00004496}.
|
MGISAHAAPASFWNHPRRIRRTPTSDRDGVDQCRPWICRRKDRRPAHPAANRPPESRVCGPSSTFRWDDWAAPAPRTRERATDCARMCMCTSRIPYSVARICARTTSMHSSRPASRSSSFIRRPLTRRQRMAVGGVTRRLWRTMRVYTIHQGRGVRRARAAQAVAAYLRDRRARIGKGWPAQGHGVRISATEQWADKPVVRRPGDPTRRVAAGAVPVLAERLPKVTGSSVKSSSGRRSRRRRIFGWRGPRGGSLSPQGGSMASYNGVLKDYSHSSLNEAFKSQNNVNFKLIKTVSDFSETLSRLYEEHATALQVAVSNYRKKNAELRKERPACHLAIFQAWETFLQEVETDSQACNDVASVLSRQVSRPMLDKSFHRKVQSRKIFTHRESFETIIAKTEEKLSKCRVDYKQCHLAHRQNPSQHSLTEYIDAHNAYVQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQGAEVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQPSQAQKIPRRLFASPQAEVGEEAGDHNEMTPCLRNELVFDRHSTLSQRSALESLKREAIELELQIRQLQDSIEALNRTQTRGIEGQLYNKVNELQEDLSMKKFDLRAKQIHLAAIRAQKDLFVSKVEPTSPRNERKFSAATAPSMKTKWLKAFKSLKPAGSGSAQQADRRNGASSTASEPLRPNLDGSHHLQEYTYKKITACDVCSQILRGHTRQGLRCRICKLNAHGDCAPNLPRCQPKQKLLRRQKSTSELENRVDIEEETGADKSVQAKQMDGSVAGGSALPVPVLSERELGRAPPPDIPIVSVSELALQEQQQQQQQQQQQHQQQQRSLASVAQAAAVRAGRGVRPPPVAMPILGVQLQQQELQQQRGGLPVPSQDISSSSAPHSPRRQKLNLRMKSLSLDSPESSELHGQFRRRTQLPGTGASTSAGSGYYHGGSGGHLEHSTPPSNNSRLHWTNASKTITAPSSPSHPGRKLLYATRGMRGGSVDLPDEMEKSQSSASTSPCLSPKTHRLLPTNLYVIIYNFKARHADELDLKAGYKVTVIDNSDPDWWKGKVLGRVGYFPSKYCVRLNANEKPLQVTHNLQVSDSERGENLTLLRDQIVIQTGDEVNGMVMIRAAEHGQGYCPIKYLQEV
|
[
"GO:0032535",
"GO:0090066",
"GO:0016043",
"GO:0065008",
"GO:0071840",
"GO:0008361",
"GO:0009987",
"GO:0065007",
"GO:0008150",
"GO:0045793"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0065008",
"GO:0071840",
"GO:0090066",
"GO:0016043",
"GO:0032535",
"GO:0008361",
"GO:0045793"
] | null | null |
[
"IPR027267",
"IPR046349",
"IPR002219",
"IPR036028",
"IPR001452",
"IPR039688"
] |
af_db/AF-A0A0B4KER3-F1-model_v4.cif.gz
| null | null | null |
A0A060VTM4
|
Peptidoglycan recognition protein 6
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 491
| null |
MSGAQGVEDSMISPMEPHWKWCLTLLVVLVSAHTDTKVTSSQHMDDFIRVLEQVEYRNPGLQPVNACAGQLVSDEFMQHFLGTIREDSTSEAPVMDSNLSDFIGRAVRHQVTERGREEGVVLTADGTTVAMSPVLLGIEAGLVSKTRCQVRGLYPLTLARNLGLSFQRFHSSLLSHRLGPDGCWDDVTSPQVFTLSDKPSLATDALVNGGMDGVILGMEVSAQSQRPLKLSSLLRTYYCHHLEVEGLDTAPRLISRLRRENFRELARPPLLQRQVVRSLVLQRRLIDHSTMLSQEKEELTAVVREGIKEFVHKYMDCPAIIPRCQWGAAPYRGTPTPLSLPLSFMYIHHTYQPGQPCLTFQQCSADMRSMQRFHQDDRGWDDIGYSFVAGSDGYLYEGRGWHWQGAHTKGYNSKGYGVSFIGDYTSRLPSQQTMELVKDRLASCAVGGGRLVGNFTLYGHRQLVKTSCPGDALYSEITGWEHFGCVQYVQM
|
[
"GO:0031347",
"GO:0009968",
"GO:0065007",
"GO:0010648",
"GO:0050687",
"GO:0023057",
"GO:0002831",
"GO:0031348",
"GO:0048518",
"GO:0050776",
"GO:0008150",
"GO:0045088",
"GO:0039531",
"GO:0010604",
"GO:0050789",
"GO:0019222",
"GO:0010646",
"GO:0002683",
"GO:0010605",
"GO:0080134",
"GO:0050688",
"GO:0050794",
"GO:0009966",
"GO:0048583",
"GO:0009893",
"GO:0070424",
"GO:0060255",
"GO:0039532",
"GO:0002682",
"GO:0023051",
"GO:0001818",
"GO:0032101",
"GO:0051241",
"GO:1900015",
"GO:0062207",
"GO:0010628",
"GO:0051239",
"GO:1902532",
"GO:0001817",
"GO:0002832",
"GO:1900016",
"GO:0070425",
"GO:0048523",
"GO:0048519",
"GO:0048585",
"GO:0010629",
"GO:1902531",
"GO:0010468",
"GO:0009892",
"GO:0032102",
"GO:0110165",
"GO:0005575",
"GO:0005576",
"GO:0005615"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0048518",
"GO:0050789",
"GO:0048519",
"GO:0023057",
"GO:0019222",
"GO:0002683",
"GO:0050794",
"GO:0048583",
"GO:0009893",
"GO:0002682",
"GO:0023051",
"GO:0051241",
"GO:0051239",
"GO:0048523",
"GO:0048585",
"GO:0009892",
"GO:0009968",
"GO:0010648",
"GO:0002831",
"GO:0031348",
"GO:0050776",
"GO:0010604",
"GO:0010646",
"GO:0010605",
"GO:0080134",
"GO:0009966",
"GO:0060255",
"GO:0039532",
"GO:0001818",
"GO:0032101",
"GO:0001817",
"GO:0002832",
"GO:0032102",
"GO:0031347",
"GO:0050687",
"GO:0045088",
"GO:0050688",
"GO:1900015",
"GO:0062207",
"GO:0010628",
"GO:1902532",
"GO:1900016",
"GO:0070425",
"GO:0010629",
"GO:1902531",
"GO:0010468",
"GO:0039531",
"GO:0070424"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005576",
"GO:0005615"
] |
[
"IPR036505",
"IPR002502",
"IPR015510",
"IPR006619"
] |
af_db/AF-A0A060VTM4-F1-model_v4.cif.gz
|
8022.A0A060VTM4
|
[
"8022.A0A060YX49",
"8022.A0A060VYI4",
"8022.A0A060WC23",
"8022.A0A060WCW2",
"8022.A0A060YA80",
"8022.A0A060XRN8",
"8022.A0A060WHV6",
"8022.A0A060W772",
"8022.A0A060WNW5",
"8022.A0A060WNJ5",
"8022.A0A060XLV6",
"8022.A0A060VSX6",
"8022.A0A060YQG1",
"8022.A0A060XBP3",
"8022.A0A060WBY2",
"8022.A0A060WGC6",
"8022.A0A060WAQ6",
"8022.A0A060W791"
] |
[
{
"protein2": "8022.A0A060YX49",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 164,
"database": 760,
"textmining": 86,
"combined_score": 806
},
{
"protein2": "8022.A0A060VYI4",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 0,
"combined_score": 752
},
{
"protein2": "8022.A0A060WC23",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 176,
"combined_score": 841
},
{
"protein2": "8022.A0A060WCW2",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 0,
"combined_score": 752
},
{
"protein2": "8022.A0A060YA80",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 176,
"combined_score": 841
},
{
"protein2": "8022.A0A060XRN8",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 0,
"combined_score": 752
},
{
"protein2": "8022.A0A060WHV6",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 61,
"combined_score": 757
},
{
"protein2": "8022.A0A060W772",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 164,
"database": 760,
"textmining": 86,
"combined_score": 806
},
{
"protein2": "8022.A0A060WNW5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 164,
"database": 760,
"textmining": 86,
"combined_score": 806
},
{
"protein2": "8022.A0A060WNJ5",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 61,
"combined_score": 757
},
{
"protein2": "8022.A0A060XLV6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 142,
"coexpression": 55,
"experimental": 0,
"database": 827,
"textmining": 269,
"combined_score": 883
},
{
"protein2": "8022.A0A060VSX6",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 61,
"combined_score": 757
},
{
"protein2": "8022.A0A060YQG1",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 61,
"combined_score": 757
},
{
"protein2": "8022.A0A060XBP3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 164,
"database": 760,
"textmining": 86,
"combined_score": 806
},
{
"protein2": "8022.A0A060WBY2",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 0,
"combined_score": 752
},
{
"protein2": "8022.A0A060WGC6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 164,
"database": 760,
"textmining": 86,
"combined_score": 806
},
{
"protein2": "8022.A0A060WAQ6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 69,
"coexpression": 56,
"experimental": 0,
"database": 832,
"textmining": 364,
"combined_score": 893
},
{
"protein2": "8022.A0A060W791",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 164,
"database": 760,
"textmining": 86,
"combined_score": 806
}
] |
A0A060X5E8
|
Phospholipid/glycerol acyltransferase domain-containing protein
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 398
|
Membrane {ECO:0000256|ARBA:ARBA00004370}.
|
MKLPNKQHHSSENEDGSDLPPPFRNPFVHELRFTPLEKIRIGVMTVTVFPVRLFFAVLLMLLAWPFAFAASLGRSELAVETETWWRRICDIALRGIMRAMWFCGGFHWVTVKGEPAPPSQAPILTLAPHSSYFDAIPVTMTMASIVMKTESKNIPVWGTLIKFIRPVFVSRSDQDSRKKTVEEIKRRAHAGGEWPQIMIFPEGTCTNRSCLITFKPGAFIPAVPVQPVVLRYPNRMDTITWTWQGPGAFEILWLTLCQFHNPIEIEYLPLYTPSEEEKNNPALFANNVRSIMAKALELPITDLSFDDCQLSLAKGPMRVPSNSSLLQFNRLARRLGLRAGTTDTVLEQQASKARKLWGYTLGLGDFAHYLDLPVTDMLTELHSLFNQWELWKHTYSVY
|
[
"GO:0008152",
"GO:1901566",
"GO:0006650",
"GO:0006662",
"GO:1901503",
"GO:0009058",
"GO:0008654",
"GO:0044237",
"GO:0008150",
"GO:1901576",
"GO:1901564",
"GO:0046486",
"GO:0006629",
"GO:0006663",
"GO:0044281",
"GO:0046504",
"GO:0006644",
"GO:0097384",
"GO:0008611",
"GO:0046485",
"GO:0019637",
"GO:0006807",
"GO:0090407",
"GO:0044255",
"GO:0044249",
"GO:0009987",
"GO:0006796",
"GO:0046474",
"GO:0018904",
"GO:0071704",
"GO:0046469",
"GO:0008610",
"GO:0045017",
"GO:0044238",
"GO:0006793",
"GO:0042175",
"GO:0005622",
"GO:0031090",
"GO:0043226",
"GO:0005783",
"GO:0005575",
"GO:0016020",
"GO:0043231",
"GO:0005789",
"GO:0031984",
"GO:0043229",
"GO:0110165",
"GO:0071944",
"GO:0005737",
"GO:0043227",
"GO:0012505",
"GO:0005886",
"GO:0098827",
"GO:0016747",
"GO:0016740",
"GO:0003674",
"GO:0016407",
"GO:0016746",
"GO:0003824",
"GO:0047179"
] |
[
"GO:0008150",
"GO:0008152",
"GO:0009987",
"GO:0009058",
"GO:0044237",
"GO:0044281",
"GO:0006807",
"GO:0071704",
"GO:0044238",
"GO:1901576",
"GO:1901564",
"GO:0006629",
"GO:0019637",
"GO:0044255",
"GO:0044249",
"GO:0018904",
"GO:0006793",
"GO:1901566",
"GO:0006662",
"GO:1901503",
"GO:0046486",
"GO:0046504",
"GO:0006644",
"GO:0097384",
"GO:0046485",
"GO:0090407",
"GO:0006796",
"GO:0046469",
"GO:0008610",
"GO:0045017",
"GO:0006650",
"GO:0008654",
"GO:0006663",
"GO:0008611",
"GO:0046474"
] |
[
"GO:0003674",
"GO:0003824",
"GO:0016740",
"GO:0016746",
"GO:0016747",
"GO:0016407",
"GO:0047179"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0016020",
"GO:0031984",
"GO:0071944",
"GO:0005737",
"GO:0012505",
"GO:0042175",
"GO:0031090",
"GO:0005783",
"GO:0043229",
"GO:0043227",
"GO:0005886",
"GO:0098827",
"GO:0043231",
"GO:0005789"
] |
[
"IPR045252",
"IPR002123"
] |
af_db/AF-A0A060X5E8-F1-model_v4.cif.gz
|
8022.A0A060X5E8
|
[
"8022.A0A060XZG5",
"8022.A0A060WMA0",
"8022.A0A060YP76",
"8022.A0A060Y209",
"8022.A0A060YNP0",
"8022.A0A060WXJ9",
"8022.A0A060XBF4",
"8022.A0A060Z178",
"8022.A0A060XJE3",
"8022.A0A060Y525",
"8022.A0A060ZEA0",
"8022.A0A060WKI9",
"8022.A0A060WAM9",
"8022.A0A060Y3S3",
"8022.A0A060YPN4",
"8022.A0A060WAH0",
"8022.A0A060VYJ7",
"8022.A0A060VY33",
"8022.A0A060WWB8",
"8022.A0A060W780",
"8022.A0A060ZF19",
"8022.A0A060VWE7",
"8022.A0A060VWG7",
"8022.A0A060X8I3",
"8022.A0A060X1Q1",
"8022.A0A060W2M5",
"8022.A0A060X8F2",
"8022.A0A060W5A1",
"8022.A0A060WGS1",
"8022.A0A060Y022",
"8022.A0A060YG60",
"8022.A0A060YR49",
"8022.A0A060XJF5",
"8022.A0A060VML4",
"8022.A0A060XCL6",
"8022.A0A060Z8E6",
"8022.A0A060YWG6",
"8022.A0A060YPX7",
"8022.A0A060Z769",
"8022.A0A060WCZ0",
"8022.A0A060X836",
"8022.A0A060XI24",
"8022.A0A060VYB1",
"8022.A0A060X1J7",
"8022.A0A060Y7U0",
"8022.A0A060XN56",
"8022.A0A060W3M6",
"8022.A0A060YLF9",
"8022.A0A060X659",
"8022.A0A060VWY0",
"8022.A0A060XQT7",
"8022.A0A060YCR0",
"8022.A0A060XZ81",
"8022.A0A060ZCK2",
"8022.A0A060XEP9",
"8022.A0A060X5K2",
"8022.A0A060WTF2",
"8022.A0A060XR98",
"8022.A0A060XEI7",
"8022.A0A060YZH2",
"8022.A0A060YKM8",
"8022.A0A060XM30",
"8022.A0A060Y4G9",
"8022.A0A060WXB6",
"8022.A0A060Z5I3",
"8022.A0A060Y2K1",
"8022.A0A060Y2H4",
"8022.A0A060XFT6",
"8022.A0A060W3V3",
"8022.A0A060Y6G2",
"8022.A0A060W8Z2",
"8022.A0A060XKJ6",
"8022.A0A060X4H7",
"8022.A0A060Z370",
"8022.A0A060VZH3",
"8022.A0A060YQM4",
"8022.A0A060WDA7",
"8022.A0A060YAJ2",
"8022.A0A060XLF8",
"8022.A0A060X5H9",
"8022.A0A060YK16",
"8022.A0A060X754",
"8022.A0A060W3X0",
"8022.A0A060XN93",
"8022.A0A060YCG4",
"8022.A0A060X9R9",
"8022.A0A060Y5Z4",
"8022.A0A060XTV7",
"8022.A0A060VXV4",
"8022.A0A060XE36",
"8022.A0A060WE92",
"8022.A0A060Z2V6",
"8022.A0A060WG53",
"8022.A0A060Z3A6",
"8022.A0A060Z1S9",
"8022.A0A060ZFN7",
"8022.A0A060XNK8",
"8022.A0A060WK44",
"8022.A0A060WAZ2",
"8022.A0A060X101",
"8022.A0A060Z9W8",
"8022.A0A060WCJ4",
"8022.A0A060W6W8",
"8022.A0A060WDQ0",
"8022.A0A060VU79",
"8022.A0A060XI36",
"8022.A0A060XT39"
] |
[
{
"protein2": "8022.A0A060XZG5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 135,
"combined_score": 843
},
{
"protein2": "8022.A0A060WMA0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 44,
"combined_score": 825
},
{
"protein2": "8022.A0A060YP76",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 752
},
{
"protein2": "8022.A0A060Y209",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 80,
"coexpression": 0,
"experimental": 0,
"database": 831,
"textmining": 0,
"combined_score": 838
},
{
"protein2": "8022.A0A060YNP0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 357,
"database": 602,
"textmining": 235,
"combined_score": 792
},
{
"protein2": "8022.A0A060WXJ9",
"neighborhood": 101,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 148,
"combined_score": 846
},
{
"protein2": "8022.A0A060XBF4",
"neighborhood": 101,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 148,
"combined_score": 846
},
{
"protein2": "8022.A0A060Z178",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 44,
"combined_score": 825
},
{
"protein2": "8022.A0A060XJE3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 834,
"textmining": 89,
"combined_score": 842
},
{
"protein2": "8022.A0A060Y525",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 748
},
{
"protein2": "8022.A0A060ZEA0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 782,
"textmining": 112,
"combined_score": 798
},
{
"protein2": "8022.A0A060WKI9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 834,
"textmining": 89,
"combined_score": 842
},
{
"protein2": "8022.A0A060WAM9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 835
},
{
"protein2": "8022.A0A060Y3S3",
"neighborhood": 101,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 125,
"combined_score": 856
},
{
"protein2": "8022.A0A060YPN4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 43,
"combined_score": 832
},
{
"protein2": "8022.A0A060WAH0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 96,
"coexpression": 0,
"experimental": 158,
"database": 844,
"textmining": 137,
"combined_score": 883
},
{
"protein2": "8022.A0A060VYJ7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 782,
"textmining": 112,
"combined_score": 798
},
{
"protein2": "8022.A0A060VY33",
"neighborhood": 42,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 212,
"combined_score": 856
},
{
"protein2": "8022.A0A060WWB8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 47,
"combined_score": 828
},
{
"protein2": "8022.A0A060W780",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 151,
"combined_score": 861
},
{
"protein2": "8022.A0A060ZF19",
"neighborhood": 63,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 165,
"database": 824,
"textmining": 115,
"combined_score": 864
},
{
"protein2": "8022.A0A060VWE7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 835
},
{
"protein2": "8022.A0A060VWG7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 357,
"database": 602,
"textmining": 235,
"combined_score": 792
},
{
"protein2": "8022.A0A060X8I3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 357,
"database": 602,
"textmining": 235,
"combined_score": 792
},
{
"protein2": "8022.A0A060X1Q1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 224,
"combined_score": 864
},
{
"protein2": "8022.A0A060W2M5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 118,
"database": 654,
"textmining": 143,
"combined_score": 715
},
{
"protein2": "8022.A0A060X8F2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 118,
"database": 827,
"textmining": 143,
"combined_score": 857
},
{
"protein2": "8022.A0A060W5A1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 839,
"textmining": 151,
"combined_score": 857
},
{
"protein2": "8022.A0A060WGS1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 748
},
{
"protein2": "8022.A0A060Y022",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 86,
"combined_score": 833
},
{
"protein2": "8022.A0A060YG60",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060YR49",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 115,
"combined_score": 838
},
{
"protein2": "8022.A0A060XJF5",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 157,
"combined_score": 848
},
{
"protein2": "8022.A0A060VML4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 164,
"combined_score": 864
},
{
"protein2": "8022.A0A060XCL6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 834,
"textmining": 86,
"combined_score": 841
},
{
"protein2": "8022.A0A060Z8E6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 86,
"combined_score": 833
},
{
"protein2": "8022.A0A060YWG6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 135,
"combined_score": 843
},
{
"protein2": "8022.A0A060YPX7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060Z769",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060WCZ0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 276,
"combined_score": 869
},
{
"protein2": "8022.A0A060X836",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 167,
"combined_score": 847
},
{
"protein2": "8022.A0A060XI24",
"neighborhood": 101,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 148,
"combined_score": 846
},
{
"protein2": "8022.A0A060VYB1",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060X1J7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 835
},
{
"protein2": "8022.A0A060Y7U0",
"neighborhood": 139,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 232,
"database": 534,
"textmining": 180,
"combined_score": 717
},
{
"protein2": "8022.A0A060XN56",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 779,
"textmining": 86,
"combined_score": 789
},
{
"protein2": "8022.A0A060W3M6",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060YLF9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 44,
"combined_score": 825
},
{
"protein2": "8022.A0A060X659",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 357,
"database": 602,
"textmining": 235,
"combined_score": 792
},
{
"protein2": "8022.A0A060VWY0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 118,
"database": 827,
"textmining": 143,
"combined_score": 857
},
{
"protein2": "8022.A0A060XQT7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 834,
"textmining": 86,
"combined_score": 841
},
{
"protein2": "8022.A0A060YCR0",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060XZ81",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 151,
"combined_score": 861
},
{
"protein2": "8022.A0A060ZCK2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 829,
"textmining": 47,
"combined_score": 830
},
{
"protein2": "8022.A0A060XEP9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 167,
"combined_score": 847
},
{
"protein2": "8022.A0A060X5K2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 772,
"textmining": 112,
"combined_score": 789
},
{
"protein2": "8022.A0A060WTF2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 44,
"combined_score": 825
},
{
"protein2": "8022.A0A060XR98",
"neighborhood": 147,
"fusion": 0,
"cooccurence": 0,
"coexpression": 127,
"experimental": 100,
"database": 534,
"textmining": 211,
"combined_score": 708
},
{
"protein2": "8022.A0A060XEI7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 135,
"combined_score": 843
},
{
"protein2": "8022.A0A060YZH2",
"neighborhood": 147,
"fusion": 0,
"cooccurence": 0,
"coexpression": 127,
"experimental": 100,
"database": 832,
"textmining": 211,
"combined_score": 894
},
{
"protein2": "8022.A0A060YKM8",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 831,
"textmining": 0,
"combined_score": 833
},
{
"protein2": "8022.A0A060XM30",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060Y4G9",
"neighborhood": 139,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 232,
"database": 534,
"textmining": 180,
"combined_score": 717
},
{
"protein2": "8022.A0A060WXB6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 81,
"combined_score": 839
},
{
"protein2": "8022.A0A060Z5I3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 115,
"combined_score": 838
},
{
"protein2": "8022.A0A060Y2K1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 88,
"coexpression": 0,
"experimental": 0,
"database": 831,
"textmining": 0,
"combined_score": 839
},
{
"protein2": "8022.A0A060Y2H4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 97,
"coexpression": 0,
"experimental": 158,
"database": 827,
"textmining": 137,
"combined_score": 871
},
{
"protein2": "8022.A0A060XFT6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 835
},
{
"protein2": "8022.A0A060W3V3",
"neighborhood": 42,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 212,
"combined_score": 856
},
{
"protein2": "8022.A0A060Y6G2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 128,
"combined_score": 840
},
{
"protein2": "8022.A0A060W8Z2",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 157,
"combined_score": 854
},
{
"protein2": "8022.A0A060XKJ6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 834,
"textmining": 89,
"combined_score": 842
},
{
"protein2": "8022.A0A060X4H7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 782,
"textmining": 112,
"combined_score": 798
},
{
"protein2": "8022.A0A060Z370",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 782,
"textmining": 112,
"combined_score": 798
},
{
"protein2": "8022.A0A060VZH3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 839,
"textmining": 151,
"combined_score": 857
},
{
"protein2": "8022.A0A060YQM4",
"neighborhood": 154,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 649,
"textmining": 205,
"combined_score": 743
},
{
"protein2": "8022.A0A060WDA7",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 157,
"combined_score": 848
},
{
"protein2": "8022.A0A060YAJ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 151,
"combined_score": 861
},
{
"protein2": "8022.A0A060XLF8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 323,
"combined_score": 889
},
{
"protein2": "8022.A0A060X5H9",
"neighborhood": 101,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 148,
"combined_score": 846
},
{
"protein2": "8022.A0A060YK16",
"neighborhood": 63,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 165,
"database": 824,
"textmining": 115,
"combined_score": 864
},
{
"protein2": "8022.A0A060X754",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 357,
"database": 602,
"textmining": 235,
"combined_score": 792
},
{
"protein2": "8022.A0A060W3X0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 118,
"database": 654,
"textmining": 143,
"combined_score": 715
},
{
"protein2": "8022.A0A060XN93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 86,
"combined_score": 833
},
{
"protein2": "8022.A0A060YCG4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 748
},
{
"protein2": "8022.A0A060X9R9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 118,
"database": 654,
"textmining": 143,
"combined_score": 715
},
{
"protein2": "8022.A0A060Y5Z4",
"neighborhood": 114,
"fusion": 0,
"cooccurence": 0,
"coexpression": 98,
"experimental": 0,
"database": 592,
"textmining": 230,
"combined_score": 715
},
{
"protein2": "8022.A0A060XTV7",
"neighborhood": 42,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 212,
"combined_score": 856
},
{
"protein2": "8022.A0A060VXV4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060XE36",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 748
},
{
"protein2": "8022.A0A060WE92",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 835
},
{
"protein2": "8022.A0A060Z2V6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 44,
"combined_score": 832
},
{
"protein2": "8022.A0A060WG53",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 84,
"database": 827,
"textmining": 132,
"combined_score": 852
},
{
"protein2": "8022.A0A060Z3A6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 80,
"coexpression": 0,
"experimental": 0,
"database": 831,
"textmining": 0,
"combined_score": 838
},
{
"protein2": "8022.A0A060Z1S9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 115,
"combined_score": 838
},
{
"protein2": "8022.A0A060ZFN7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 782,
"textmining": 112,
"combined_score": 798
},
{
"protein2": "8022.A0A060XNK8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 135,
"combined_score": 843
},
{
"protein2": "8022.A0A060WK44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 835
},
{
"protein2": "8022.A0A060WAZ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 276,
"combined_score": 869
},
{
"protein2": "8022.A0A060X101",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060Z9W8",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 84,
"database": 827,
"textmining": 132,
"combined_score": 852
},
{
"protein2": "8022.A0A060WCJ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 167,
"combined_score": 864
},
{
"protein2": "8022.A0A060W6W8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 834,
"textmining": 89,
"combined_score": 842
},
{
"protein2": "8022.A0A060WDQ0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 44,
"combined_score": 825
},
{
"protein2": "8022.A0A060VU79",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 323,
"combined_score": 889
},
{
"protein2": "8022.A0A060XI36",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 357,
"database": 602,
"textmining": 235,
"combined_score": 792
},
{
"protein2": "8022.A0A060XT39",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
}
] |
A0A060X747
|
Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)
|
The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. {ECO:0000256|ARBA:ARBA00003830, ECO:0000256|PIRNR:PIRNR002527}.
|
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 577
|
Nucleus {ECO:0000256|ARBA:ARBA00004123, ECO:0000256|PIRNR:PIRNR002527}.
|
MYPEETRGGGGAAAFNYLDGGYDYTAPAQGPAPLYYSTTPQDAHGPPSDGSMQSLGSSPTGPLVFVSSSPQLSPQLSPFLHPPSHHGLPSQSYYLETSSTPLYRSSVVTNQLSASEEKLCIASDRQQSYSAAGSGVRVFEMANETRYCAVCSDFASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTMDRNRRKSCQACRLRKCYEVGMVKGGLRKDRGGRVLRKDKRYCGPAGDREKPYGDLEHRTAPPQDGGRNSSSSLNGGGGWRGPRITMPPEQVLFLLQGAEPPALCSRQKVARPYTEVTMMTLLTSMADKELVHMIAWAKKITCFQELSLHDQVQLLESSWLEVLMIGLIWRSIHCPGKLIFAQDLILDRSEGDCVEGMAEIFDMLLATVSRFRMLKLKPEEFVCLKAIILLNSGAFSFCSNSVESLHNSSAVESMLDNITDALIHHISHSGASVQQQPRRQAQLLLLLSHIRHMSNKGMEHLYSIKCKNKVPLYDLLLEMLDGHRLQSPGKVAQAGEQTEGPSTTTTTSTGSSIGPMRGSQDTHIRSPGSGVLQYGSPSSDQMPIP
|
[
"GO:0050896",
"GO:0032355",
"GO:0010033",
"GO:0033993",
"GO:1901700",
"GO:0008150",
"GO:0042221",
"GO:0014070",
"GO:0005622",
"GO:0043229",
"GO:0043226",
"GO:0110165",
"GO:0005575",
"GO:0043227",
"GO:0005634",
"GO:0043231",
"GO:1903924",
"GO:0005488",
"GO:0003707",
"GO:0005496",
"GO:0030284",
"GO:0038023",
"GO:0097159",
"GO:0003674",
"GO:0008289",
"GO:0060089"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0042221",
"GO:0010033",
"GO:1901700",
"GO:0032355",
"GO:0033993",
"GO:0014070"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0060089",
"GO:0038023",
"GO:0097159",
"GO:0008289",
"GO:0003707",
"GO:0005496",
"GO:1903924",
"GO:0030284"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0043229",
"GO:0043227",
"GO:0043231",
"GO:0005634"
] |
[
"IPR024178",
"IPR001292",
"IPR046944",
"IPR035500",
"IPR000536",
"IPR050200",
"IPR001723",
"IPR001628",
"IPR013088"
] |
af_db/AF-A0A060X747-F1-model_v4.cif.gz
|
8022.A0A060X747
|
[
"8022.A0A060W3W8",
"8022.A0A060Y5T0",
"8022.A0A060WXG7",
"8022.A0A060WML1",
"8022.A0A060ZGP1",
"8022.A0A060VW47",
"8022.A0A060W6B9",
"8022.A0A060X5T8",
"8022.A0A060XYX3",
"8022.A0A060XUQ5",
"8022.A0A060YTG7",
"8022.A0A060WIA9",
"8022.A0A060YVU8",
"8022.A0A060Z3T5",
"8022.A0A060WTN3",
"8022.A0A060YX93",
"8022.A0A060W6V4",
"8022.A0A060ZAN2",
"8022.A0A060WAQ1",
"8022.A0A060WHW4",
"8022.A0A060YFT3",
"8022.A0A060Z1V8",
"8022.A0A060VND2",
"8022.A0A060VN52",
"8022.A0A060YEV1",
"8022.A0A060YEN1",
"8022.A0A060WLW5",
"8022.A0A060VX03",
"8022.A0A060YKE5",
"8022.A0A060WN55",
"8022.A0A060XAV4",
"8022.A0A060Z793",
"8022.A0A060WN95",
"8022.A0A060VVC5",
"8022.A0A060Y0V2",
"8022.A0A060W5Y1",
"8022.A0A060YGL1",
"8022.A0A060YKW8",
"8022.A0A060W2Y7",
"8022.A0A060X907",
"8022.A0A060X6A4",
"8022.A0A060WGA5",
"8022.A0A060WAQ4",
"8022.A0A060XVJ2",
"8022.A0A060WMH5",
"8022.A0A060WQR5",
"8022.A0A060XAL0",
"8022.A0A060XXR4",
"8022.A0A060WX37",
"8022.A0A060Z011",
"8022.A0A060WMW9",
"8022.A0A060XCU4",
"8022.A0A060YAV2",
"8022.A0A060YRR8",
"8022.A0A060Z4W6",
"8022.A0A060W0K6",
"8022.A0A060WHX7",
"8022.A0A060X5R5",
"8022.A0A060WA02",
"8022.A0A060Y5J3",
"8022.A0A060XY33",
"8022.A0A060YPZ8",
"8022.A0A060WF44",
"8022.A0A060X6T5",
"8022.A0A060X709",
"8022.A0A060ZZ16",
"8022.A0A060Z753",
"8022.A0A060X566",
"8022.A0A060XFW6",
"8022.A0A060Y8P3",
"8022.A0A060XMQ8",
"8022.A0A060YL79",
"8022.A0A060WEQ5",
"8022.A0A060Y1N2",
"8022.A0A060Y1F8",
"8022.A0A060XIU8",
"8022.A0A060XMF7",
"8022.A0A060VZ13",
"8022.A0A060YV52",
"8022.A0A061AFB7",
"8022.A0A060YLT6",
"8022.A0A060XZP8",
"8022.A0A060VNE1",
"8022.A0A060W5D0",
"8022.A0A060X0J1",
"8022.A0A060VMS2",
"8022.A0A060WHY1",
"8022.A0A060Y668",
"8022.A0A060VX88",
"8022.C1BGM4",
"8022.A0A060WB70",
"8022.A0A060XCG6",
"8022.A0A060WU05",
"8022.A0A060XBD1",
"8022.A0A060YGE2",
"8022.A0A060XX32",
"8022.A0A060YLU1",
"8022.A0A060YGN3",
"8022.A0A060VX39",
"8022.A0A060YP66",
"8022.A0A060XPW0",
"8022.A0A060YHY9",
"8022.A0A060VU47",
"8022.A0A060YFL4",
"8022.A0A060WAD1",
"8022.A0A060Z1K4",
"8022.A0A060YI40",
"8022.A0A060Y3L0",
"8022.A0A060Z9X0",
"8022.A0A060WM29",
"8022.A0A060VVS7",
"8022.A0A060VTW5",
"8022.A0A060X643",
"8022.A0A060WI77",
"8022.A0A060VX43",
"8022.A0A060Z886",
"8022.A0A060X3V7",
"8022.A0A060WBV0",
"8022.A0A060ZEG1",
"8022.A0A060Y9W2",
"8022.A0A060YBL3",
"8022.A0A060W9K2",
"8022.A0A060WF58",
"8022.A0A060YHM7",
"8022.A0A060WUS8",
"8022.A0A060WPL6",
"8022.A0A060ZG95",
"8022.A0A060Z9P8",
"8022.A0A060WIM0",
"8022.A0A060YLL3",
"8022.A0A060Y6Y8",
"8022.A0A060XRX2",
"8022.A0A060Y4X6",
"8022.A0A060WSF1",
"8022.A0A060YBG9",
"8022.A0A060VQ10",
"8022.A0A060X706",
"8022.A0A060Y1G5",
"8022.A0A060VV08",
"8022.A0A060YDR5",
"8022.A0A060YVS2",
"8022.A0A060XC56",
"8022.A0A060XF24",
"8022.A0A060WJ27"
] |
[
{
"protein2": "8022.A0A060W3W8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 538,
"database": 434,
"textmining": 186,
"combined_score": 768
},
{
"protein2": "8022.A0A060Y5T0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 301,
"database": 433,
"textmining": 308,
"combined_score": 701
},
{
"protein2": "8022.A0A060WXG7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 331,
"database": 654,
"textmining": 199,
"combined_score": 798
},
{
"protein2": "8022.A0A060WML1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 386,
"database": 510,
"textmining": 86,
"combined_score": 700
},
{
"protein2": "8022.A0A060ZGP1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 670,
"database": 462,
"textmining": 207,
"combined_score": 846
},
{
"protein2": "8022.A0A060VW47",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 538,
"database": 434,
"textmining": 186,
"combined_score": 768
},
{
"protein2": "8022.A0A060W6B9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 120,
"combined_score": 805
},
{
"protein2": "8022.A0A060X5T8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 772,
"database": 0,
"textmining": 207,
"combined_score": 811
},
{
"protein2": "8022.A0A060XYX3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 207,
"database": 599,
"textmining": 163,
"combined_score": 710
},
{
"protein2": "8022.A0A060XUQ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 670,
"database": 462,
"textmining": 207,
"combined_score": 846
},
{
"protein2": "8022.A0A060YTG7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 361,
"database": 824,
"textmining": 366,
"combined_score": 922
},
{
"protein2": "8022.A0A060WIA9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 120,
"combined_score": 805
},
{
"protein2": "8022.A0A060YVU8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 501,
"textmining": 157,
"combined_score": 712
},
{
"protein2": "8022.A0A060Z3T5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 568,
"textmining": 230,
"combined_score": 782
},
{
"protein2": "8022.A0A060WTN3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 271,
"textmining": 487,
"combined_score": 739
},
{
"protein2": "8022.A0A060YX93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 351,
"database": 760,
"textmining": 143,
"combined_score": 854
},
{
"protein2": "8022.A0A060W6V4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 321,
"database": 760,
"textmining": 108,
"combined_score": 841
},
{
"protein2": "8022.A0A060ZAN2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 321,
"database": 760,
"textmining": 108,
"combined_score": 841
},
{
"protein2": "8022.A0A060WAQ1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 386,
"database": 510,
"textmining": 86,
"combined_score": 705
},
{
"protein2": "8022.A0A060WHW4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 331,
"database": 654,
"textmining": 199,
"combined_score": 798
},
{
"protein2": "8022.A0A060YFT3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 766,
"database": 829,
"textmining": 510,
"combined_score": 978
},
{
"protein2": "8022.A0A060Z1V8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 370,
"database": 547,
"textmining": 141,
"combined_score": 733
},
{
"protein2": "8022.A0A060VND2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 568,
"textmining": 230,
"combined_score": 782
},
{
"protein2": "8022.A0A060VN52",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 568,
"textmining": 230,
"combined_score": 782
},
{
"protein2": "8022.A0A060YEV1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 436,
"textmining": 223,
"combined_score": 814
},
{
"protein2": "8022.A0A060YEN1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 568,
"textmining": 230,
"combined_score": 782
},
{
"protein2": "8022.A0A060WLW5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 752,
"database": 0,
"textmining": 369,
"combined_score": 836
},
{
"protein2": "8022.A0A060VX03",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 120,
"combined_score": 805
},
{
"protein2": "8022.A0A060YKE5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 568,
"textmining": 339,
"combined_score": 813
},
{
"protein2": "8022.A0A060WN55",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 54,
"experimental": 366,
"database": 610,
"textmining": 84,
"combined_score": 757
},
{
"protein2": "8022.A0A060XAV4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 43,
"experimental": 573,
"database": 275,
"textmining": 113,
"combined_score": 702
},
{
"protein2": "8022.A0A060Z793",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 388,
"database": 425,
"textmining": 308,
"combined_score": 735
},
{
"protein2": "8022.A0A060WN95",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 752,
"database": 0,
"textmining": 369,
"combined_score": 836
},
{
"protein2": "8022.A0A060VVC5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 596,
"database": 275,
"textmining": 89,
"combined_score": 709
},
{
"protein2": "8022.A0A060Y0V2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 110,
"combined_score": 747
},
{
"protein2": "8022.A0A060W5Y1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 538,
"database": 434,
"textmining": 186,
"combined_score": 768
},
{
"protein2": "8022.A0A060YGL1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 301,
"database": 433,
"textmining": 308,
"combined_score": 701
},
{
"protein2": "8022.A0A060YKW8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 43,
"experimental": 573,
"database": 275,
"textmining": 113,
"combined_score": 702
},
{
"protein2": "8022.A0A060W2Y7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 175,
"database": 674,
"textmining": 216,
"combined_score": 770
},
{
"protein2": "8022.A0A060X907",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 501,
"textmining": 157,
"combined_score": 712
},
{
"protein2": "8022.A0A060X6A4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 216,
"combined_score": 826
},
{
"protein2": "8022.A0A060WGA5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 388,
"database": 425,
"textmining": 308,
"combined_score": 735
},
{
"protein2": "8022.A0A060WAQ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 386,
"database": 510,
"textmining": 86,
"combined_score": 700
},
{
"protein2": "8022.A0A060XVJ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 721,
"textmining": 113,
"combined_score": 741
},
{
"protein2": "8022.A0A060WMH5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 351,
"database": 436,
"textmining": 247,
"combined_score": 700
},
{
"protein2": "8022.A0A060WQR5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 370,
"database": 547,
"textmining": 141,
"combined_score": 733
},
{
"protein2": "8022.A0A060XAL0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 110,
"combined_score": 747
},
{
"protein2": "8022.A0A060XXR4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 321,
"database": 760,
"textmining": 108,
"combined_score": 841
},
{
"protein2": "8022.A0A060WX37",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 110,
"combined_score": 747
},
{
"protein2": "8022.A0A060Z011",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 118,
"experimental": 581,
"database": 676,
"textmining": 272,
"combined_score": 901
},
{
"protein2": "8022.A0A060WMW9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 680,
"database": 599,
"textmining": 358,
"combined_score": 910
},
{
"protein2": "8022.A0A060XCU4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 110,
"combined_score": 747
},
{
"protein2": "8022.A0A060YAV2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 596,
"database": 275,
"textmining": 89,
"combined_score": 709
},
{
"protein2": "8022.A0A060YRR8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 110,
"combined_score": 747
},
{
"protein2": "8022.A0A060Z4W6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 120,
"combined_score": 805
},
{
"protein2": "8022.A0A060W0K6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 230,
"combined_score": 781
},
{
"protein2": "8022.A0A060WHX7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 216,
"combined_score": 826
},
{
"protein2": "8022.A0A060X5R5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 824,
"textmining": 308,
"combined_score": 957
},
{
"protein2": "8022.A0A060WA02",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 721,
"textmining": 135,
"combined_score": 748
},
{
"protein2": "8022.A0A060Y5J3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 86,
"combined_score": 795
},
{
"protein2": "8022.A0A060XY33",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 139,
"database": 690,
"textmining": 88,
"combined_score": 735
},
{
"protein2": "8022.A0A060YPZ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 596,
"database": 275,
"textmining": 89,
"combined_score": 709
},
{
"protein2": "8022.A0A060WF44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 568,
"textmining": 230,
"combined_score": 782
},
{
"protein2": "8022.A0A060X6T5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 824,
"textmining": 308,
"combined_score": 957
},
{
"protein2": "8022.A0A060X709",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 331,
"database": 654,
"textmining": 199,
"combined_score": 798
},
{
"protein2": "8022.A0A060ZZ16",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 120,
"combined_score": 805
},
{
"protein2": "8022.A0A060Z753",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 118,
"experimental": 581,
"database": 676,
"textmining": 272,
"combined_score": 901
},
{
"protein2": "8022.A0A060X566",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 110,
"combined_score": 747
},
{
"protein2": "8022.A0A060XFW6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 538,
"database": 434,
"textmining": 186,
"combined_score": 768
},
{
"protein2": "8022.A0A060Y8P3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 86,
"combined_score": 795
},
{
"protein2": "8022.A0A060XMQ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 54,
"experimental": 366,
"database": 610,
"textmining": 84,
"combined_score": 757
},
{
"protein2": "8022.A0A060YL79",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 436,
"textmining": 223,
"combined_score": 814
},
{
"protein2": "8022.A0A060WEQ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 568,
"textmining": 230,
"combined_score": 782
},
{
"protein2": "8022.A0A060Y1N2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 361,
"database": 824,
"textmining": 366,
"combined_score": 922
},
{
"protein2": "8022.A0A060Y1F8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 721,
"textmining": 135,
"combined_score": 748
},
{
"protein2": "8022.A0A060XIU8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 351,
"database": 760,
"textmining": 143,
"combined_score": 854
},
{
"protein2": "8022.A0A060XMF7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 670,
"database": 462,
"textmining": 207,
"combined_score": 846
},
{
"protein2": "8022.A0A060VZ13",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 423,
"database": 824,
"textmining": 369,
"combined_score": 930
},
{
"protein2": "8022.A0A060YV52",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 110,
"combined_score": 747
},
{
"protein2": "8022.A0A061AFB7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 230,
"combined_score": 781
},
{
"protein2": "8022.A0A060YLT6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 568,
"textmining": 230,
"combined_score": 782
},
{
"protein2": "8022.A0A060XZP8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 670,
"database": 462,
"textmining": 207,
"combined_score": 846
},
{
"protein2": "8022.A0A060VNE1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 120,
"combined_score": 805
},
{
"protein2": "8022.A0A060W5D0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 201,
"database": 599,
"textmining": 233,
"combined_score": 732
},
{
"protein2": "8022.A0A060X0J1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 501,
"textmining": 255,
"combined_score": 746
},
{
"protein2": "8022.A0A060VMS2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 85,
"coexpression": 71,
"experimental": 0,
"database": 676,
"textmining": 112,
"combined_score": 722
},
{
"protein2": "8022.A0A060WHY1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 54,
"experimental": 366,
"database": 610,
"textmining": 84,
"combined_score": 757
},
{
"protein2": "8022.A0A060Y668",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 388,
"database": 425,
"textmining": 308,
"combined_score": 735
},
{
"protein2": "8022.A0A060VX88",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 175,
"database": 674,
"textmining": 216,
"combined_score": 770
},
{
"protein2": "8022.C1BGM4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 156,
"database": 690,
"textmining": 0,
"combined_score": 727
},
{
"protein2": "8022.A0A060WB70",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 110,
"combined_score": 747
},
{
"protein2": "8022.A0A060XCG6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 321,
"database": 760,
"textmining": 108,
"combined_score": 841
},
{
"protein2": "8022.A0A060WU05",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 568,
"textmining": 339,
"combined_score": 813
},
{
"protein2": "8022.A0A060XBD1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 230,
"combined_score": 781
},
{
"protein2": "8022.A0A060YGE2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 568,
"textmining": 339,
"combined_score": 813
},
{
"protein2": "8022.A0A060XX32",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 538,
"database": 434,
"textmining": 186,
"combined_score": 768
},
{
"protein2": "8022.A0A060YLU1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 43,
"experimental": 573,
"database": 275,
"textmining": 113,
"combined_score": 702
},
{
"protein2": "8022.A0A060YGN3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 120,
"combined_score": 805
},
{
"protein2": "8022.A0A060VX39",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 110,
"combined_score": 747
},
{
"protein2": "8022.A0A060YP66",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 271,
"textmining": 487,
"combined_score": 739
},
{
"protein2": "8022.A0A060XPW0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 538,
"database": 434,
"textmining": 186,
"combined_score": 768
},
{
"protein2": "8022.A0A060YHY9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 596,
"database": 275,
"textmining": 89,
"combined_score": 709
},
{
"protein2": "8022.A0A060VU47",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 271,
"textmining": 487,
"combined_score": 739
},
{
"protein2": "8022.A0A060YFL4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 436,
"textmining": 223,
"combined_score": 814
},
{
"protein2": "8022.A0A060WAD1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 216,
"combined_score": 826
},
{
"protein2": "8022.A0A060Z1K4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 436,
"textmining": 223,
"combined_score": 814
},
{
"protein2": "8022.A0A060YI40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 721,
"textmining": 135,
"combined_score": 748
},
{
"protein2": "8022.A0A060Y3L0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 370,
"database": 547,
"textmining": 141,
"combined_score": 733
},
{
"protein2": "8022.A0A060Z9X0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 120,
"combined_score": 805
},
{
"protein2": "8022.A0A060WM29",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 568,
"textmining": 230,
"combined_score": 782
},
{
"protein2": "8022.A0A060VVS7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 120,
"combined_score": 805
},
{
"protein2": "8022.A0A060VTW5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 120,
"combined_score": 805
},
{
"protein2": "8022.A0A060X643",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 670,
"database": 462,
"textmining": 207,
"combined_score": 846
},
{
"protein2": "8022.A0A060WI77",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 386,
"database": 510,
"textmining": 86,
"combined_score": 700
},
{
"protein2": "8022.A0A060VX43",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 230,
"combined_score": 781
},
{
"protein2": "8022.A0A060Z886",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 110,
"combined_score": 747
},
{
"protein2": "8022.A0A060X3V7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 230,
"combined_score": 781
},
{
"protein2": "8022.A0A060WBV0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 351,
"database": 436,
"textmining": 247,
"combined_score": 700
},
{
"protein2": "8022.A0A060ZEG1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 436,
"textmining": 223,
"combined_score": 814
},
{
"protein2": "8022.A0A060Y9W2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 680,
"database": 599,
"textmining": 358,
"combined_score": 910
},
{
"protein2": "8022.A0A060YBL3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 670,
"database": 462,
"textmining": 207,
"combined_score": 846
},
{
"protein2": "8022.A0A060W9K2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 201,
"database": 599,
"textmining": 233,
"combined_score": 732
},
{
"protein2": "8022.A0A060WF58",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 568,
"textmining": 339,
"combined_score": 813
},
{
"protein2": "8022.A0A060YHM7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 216,
"combined_score": 826
},
{
"protein2": "8022.A0A060WUS8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 351,
"database": 760,
"textmining": 143,
"combined_score": 854
},
{
"protein2": "8022.A0A060WPL6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 386,
"database": 510,
"textmining": 86,
"combined_score": 700
},
{
"protein2": "8022.A0A060ZG95",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 118,
"experimental": 581,
"database": 676,
"textmining": 272,
"combined_score": 901
},
{
"protein2": "8022.A0A060Z9P8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 547,
"textmining": 120,
"combined_score": 805
},
{
"protein2": "8022.A0A060WIM0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 81,
"coexpression": 58,
"experimental": 0,
"database": 676,
"textmining": 87,
"combined_score": 709
},
{
"protein2": "8022.A0A060YLL3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 386,
"database": 510,
"textmining": 86,
"combined_score": 705
},
{
"protein2": "8022.A0A060Y6Y8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 670,
"database": 462,
"textmining": 207,
"combined_score": 846
},
{
"protein2": "8022.A0A060XRX2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 139,
"database": 690,
"textmining": 0,
"combined_score": 721
},
{
"protein2": "8022.A0A060Y4X6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 86,
"combined_score": 795
},
{
"protein2": "8022.A0A060WSF1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 331,
"database": 654,
"textmining": 199,
"combined_score": 798
},
{
"protein2": "8022.A0A060YBG9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 423,
"database": 824,
"textmining": 369,
"combined_score": 930
},
{
"protein2": "8022.A0A060VQ10",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 540,
"textmining": 110,
"combined_score": 747
},
{
"protein2": "8022.A0A060X706",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 386,
"database": 510,
"textmining": 86,
"combined_score": 700
},
{
"protein2": "8022.A0A060Y1G5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 54,
"experimental": 366,
"database": 610,
"textmining": 84,
"combined_score": 757
},
{
"protein2": "8022.A0A060VV08",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 721,
"textmining": 113,
"combined_score": 741
},
{
"protein2": "8022.A0A060YDR5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 207,
"database": 599,
"textmining": 163,
"combined_score": 710
},
{
"protein2": "8022.A0A060YVS2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 501,
"textmining": 157,
"combined_score": 712
},
{
"protein2": "8022.A0A060XC56",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 43,
"experimental": 573,
"database": 275,
"textmining": 113,
"combined_score": 702
},
{
"protein2": "8022.A0A060XF24",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 351,
"database": 760,
"textmining": 135,
"combined_score": 853
},
{
"protein2": "8022.A0A060WJ27",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 386,
"database": 510,
"textmining": 86,
"combined_score": 705
}
] |
A0A060X9D7
|
Alpha-2B adrenergic receptor (Alpha-2B adrenoreceptor)
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 484
|
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
|
MASPLNSACSVGLGDTNGSTSGLSLPCNQSVSSLQLAPYSPESTALFATAITLMVVFTIVGNILVIIAVLTSHALRGPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFKSLWCEIYLALDVLFCTSSIVHLCAISLDRYLSISRVTYSRQRTPMRIKASIVVVWLISAIISFPPLLSLNKSEPGGEGSERGPQCQLNDERWYILYSTVGSFFAPCLIMILVYMRIYQIAKQRTQNPPGEPRKDGVGSMPHKTTSVRPPTLAVTPSPSPDQANETPSPHIPTTQNLLHAPVLSLAPTPTTTSPPTSPLDPSPSLKKYNNNMDSSNSSDSDMENEEGGRTGVNNPSMAGSAGIHSPATIQKYRDIIATSKGARLVAGRRSKPESTPGAARRKAMVNREKRFTFVLAVVIGVFVVCWFPFFFSYSLQAICPETCSLPDPLFKFFFWIGYCNSCLNPVIYTIFNQDFRKAFKKILCKNTKGTFF
|
[
"GO:0051716",
"GO:0051602",
"GO:0009628",
"GO:0009987",
"GO:0051952",
"GO:0065007",
"GO:0023052",
"GO:1903530",
"GO:0032811",
"GO:0033604",
"GO:0051046",
"GO:0051049",
"GO:0051051",
"GO:0008150",
"GO:0071875",
"GO:0050896",
"GO:0050789",
"GO:0014060",
"GO:0051953",
"GO:0050433",
"GO:0048523",
"GO:0048519",
"GO:0007186",
"GO:0051048",
"GO:0032879",
"GO:1903531",
"GO:0007154",
"GO:0007165",
"GO:0050794"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0023052",
"GO:0050896",
"GO:0050789",
"GO:0048519",
"GO:0051716",
"GO:0009628",
"GO:0051051",
"GO:0048523",
"GO:0032879",
"GO:0007154",
"GO:0007165",
"GO:0050794",
"GO:0051602",
"GO:1903530",
"GO:0051049",
"GO:0051953",
"GO:0007186",
"GO:0051048",
"GO:1903531",
"GO:0051952",
"GO:0033604",
"GO:0051046",
"GO:0071875",
"GO:0050433",
"GO:0032811",
"GO:0014060"
] | null | null |
[
"IPR002233",
"IPR000276",
"IPR017452"
] |
af_db/AF-A0A060X9D7-F1-model_v4.cif.gz
|
8022.A0A060X9D7
|
[
"8022.A0A060WGC3",
"8022.A0A060WHA4",
"8022.A0A060Y8H5",
"8022.A0A060Y2Z0",
"8022.Q7SZV5",
"8022.A0A060XSB8",
"8022.A0A060YR57",
"8022.A0A060XN60",
"8022.A0A060Y1H7",
"8022.A0A060Z6I0",
"8022.C1BH40",
"8022.A0A060Z6E2",
"8022.A0A060Z1D1",
"8022.A0A060XPS3",
"8022.A0A060WEW9",
"8022.A0A060WMN1",
"8022.A0A060VPZ9",
"8022.A0A060WL89",
"8022.A0A060WVZ9",
"8022.A0A060YP44",
"8022.A0A060W8V2",
"8022.A0A060XRQ9",
"8022.A0A060X2G9",
"8022.A0A060ZAK0",
"8022.A0A060WXC1",
"8022.A0A060XVD9",
"8022.A0A060XC17"
] |
[
{
"protein2": "8022.A0A060WGC3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060WHA4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 155,
"experimental": 267,
"database": 571,
"textmining": 86,
"combined_score": 724
},
{
"protein2": "8022.A0A060Y8H5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 608,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060Y2Z0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.Q7SZV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 387,
"database": 568,
"textmining": 86,
"combined_score": 736
},
{
"protein2": "8022.A0A060XSB8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060YR57",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060XN60",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 572,
"textmining": 0,
"combined_score": 709
},
{
"protein2": "8022.A0A060Y1H7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060Z6I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 523,
"textmining": 88,
"combined_score": 716
},
{
"protein2": "8022.C1BH40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 626,
"database": 567,
"textmining": 0,
"combined_score": 833
},
{
"protein2": "8022.A0A060Z6E2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060Z1D1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 626,
"database": 567,
"textmining": 0,
"combined_score": 833
},
{
"protein2": "8022.A0A060XPS3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060WEW9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060WMN1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060VPZ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 572,
"textmining": 0,
"combined_score": 709
},
{
"protein2": "8022.A0A060WL89",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060WVZ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060YP44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 523,
"textmining": 88,
"combined_score": 716
},
{
"protein2": "8022.A0A060W8V2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 608,
"textmining": 0,
"combined_score": 736
},
{
"protein2": "8022.A0A060XRQ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060X2G9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060ZAK0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 89,
"combined_score": 751
},
{
"protein2": "8022.A0A060WXC1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060XVD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 291,
"database": 783,
"textmining": 0,
"combined_score": 839
},
{
"protein2": "8022.A0A060XC17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 571,
"textmining": 0,
"combined_score": 708
}
] |
A0A060XC03
|
Beta-2 adrenergic receptor (Beta-2 adrenoreceptor)
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 401
|
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}. Early endosome {ECO:0000256|ARBA:ARBA00004412}. Golgi apparatus {ECO:0000256|ARBA:ARBA00004555}.
|
MESVSTPAVFNLSDLSVEMNSSSRQWSYSEYSEAVAVLLGILMALLVMCIVFGNVLVITAIVRFQRLQTVTNMFITSLACADLVMGLLVVPFGACYILLNTWHFGSFLCEFWTAADVLCVTASIETLCVIALDRYLAITSPLRYPSLLTKRKACVVVVTVWGVAALISFLPIHMKWWVSDEPEALSCLEDAHCCDFNTNAAYAVASSVVSFYIPLAVMAFVYGRVFQEARKQLEKIRGSEGRFHAQMIDNNQGQDGGNGKRPKFCLKEHKALKTLGIIMGTFTLCWLPFFVLNVVVTIWKVDNIKMPFRILNWIGYANSAFNPLIYCRSPEFRYAFQEILCLRGAAFPTNGYIYRGHSLRLSPKDKPGSLSNNVGTVELGSLSSVTNINGYCNNPPLASIV
|
[
"GO:0043434",
"GO:1901652",
"GO:0051952",
"GO:0065007",
"GO:1903530",
"GO:0032811",
"GO:0033604",
"GO:0051049",
"GO:0051051",
"GO:0008150",
"GO:0042221",
"GO:0010243",
"GO:0050896",
"GO:1901698",
"GO:0050789",
"GO:0050433",
"GO:0009719",
"GO:0032879",
"GO:0007186",
"GO:0050794",
"GO:0051716",
"GO:0009987",
"GO:0023052",
"GO:1901700",
"GO:0051046",
"GO:0071875",
"GO:0014060",
"GO:0051953",
"GO:0048523",
"GO:0048519",
"GO:0010033",
"GO:0009725",
"GO:0051048",
"GO:0007154",
"GO:1903531",
"GO:0007165"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050896",
"GO:0050789",
"GO:0009987",
"GO:0023052",
"GO:0048519",
"GO:0051051",
"GO:0042221",
"GO:0009719",
"GO:0032879",
"GO:0050794",
"GO:0051716",
"GO:0048523",
"GO:0007154",
"GO:0007165",
"GO:1903530",
"GO:0051049",
"GO:1901698",
"GO:0007186",
"GO:1901700",
"GO:0051953",
"GO:0010033",
"GO:0009725",
"GO:0051048",
"GO:1903531",
"GO:0043434",
"GO:1901652",
"GO:0051952",
"GO:0033604",
"GO:0010243",
"GO:0050433",
"GO:0051046",
"GO:0071875",
"GO:0032811",
"GO:0014060"
] | null | null |
[
"IPR002233",
"IPR000332",
"IPR000276",
"IPR017452"
] |
af_db/AF-A0A060XC03-F1-model_v4.cif.gz
|
8022.A0A060XC03
|
[
"8022.A0A060Z6G3",
"8022.A0A060YHK9",
"8022.A0A060WVI0",
"8022.A0A060VX07",
"8022.A0A060XFJ9",
"8022.A0A060XJ06",
"8022.A0A060YPP2",
"8022.A0A060ZE50",
"8022.A0A060XAN6",
"8022.A0A060XB81",
"8022.A0A060WLD6",
"8022.A0A060XBN9",
"8022.A0A060WSN3",
"8022.A0A060Y3R9",
"8022.A0A060XBV2",
"8022.A0A060W476",
"8022.A0A060ZAK0",
"8022.A0A060YJ99",
"8022.A0A060WHG5",
"8022.A0A060XRA0",
"8022.A0A060YC25",
"8022.A0A061A7Q4",
"8022.A0A060WRL9",
"8022.A0A060YV89",
"8022.A0A060W8T4",
"8022.A0A060W6W6",
"8022.A0A060X5U6",
"8022.A0A060W0Q4",
"8022.A0A060VXS0",
"8022.A0A060XLX4",
"8022.A0A060WF25",
"8022.A0A060XVD9",
"8022.A0A060XC17",
"8022.A0A060WVH7",
"8022.A0A060YK59",
"8022.A0A060X2B4",
"8022.A0A060WXK5",
"8022.A0A060Y433",
"8022.A0A060VWI9",
"8022.A0A060WHT5",
"8022.A0A060XIC8",
"8022.A0A060XLH0",
"8022.A0A060XH49",
"8022.A0A060WCN9",
"8022.A0A060YR93",
"8022.A0A060XLR8",
"8022.A0A060W808",
"8022.B2KL82",
"8022.A0A060WJ93",
"8022.A0A060Z480",
"8022.A0A060Z8T5",
"8022.A0A060YP44",
"8022.A0A060Y3C6",
"8022.A0A060YAW4",
"8022.A0A060ZG63",
"8022.A0A060XUD4",
"8022.A0A060WVD9",
"8022.A0A060XCL5",
"8022.A0A060XA34",
"8022.A0A060YL43",
"8022.A0A060ZEF4",
"8022.A0A060VWA0",
"8022.A0A060YEE1",
"8022.A0A060Z6I0",
"8022.C1BH40",
"8022.A0A060Z1I0",
"8022.A0A060WIZ5",
"8022.A0A060Z6T3",
"8022.A0A060VPW7",
"8022.A0A060W0D6",
"8022.A0A060XB37",
"8022.A0A060Z1D1",
"8022.A0A060WE78",
"8022.A0A060VXM2",
"8022.A0A060VZ80",
"8022.A0A060XGM0",
"8022.A0A060YWJ1",
"8022.A0A060WSX0",
"8022.A0A060XTK7",
"8022.A0A060Z2C2",
"8022.A0A060WDT4",
"8022.A0A060YU11",
"8022.A0A060WHA4",
"8022.Q7T2I7",
"8022.A0A060XJN8",
"8022.A0A060Y8H5",
"8022.A0A060XG51",
"8022.A0A060W066",
"8022.A0A060Y3I4",
"8022.A0A060VW67",
"8022.A0A060Y8R0",
"8022.A0A060WP41",
"8022.A0A060Z2S8",
"8022.A0A060VY52",
"8022.Q7SZV5",
"8022.A0A060Z4B9",
"8022.A0A060Y7L4",
"8022.A0A060W081"
] |
[
{
"protein2": "8022.A0A060Z6G3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060YHK9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060WVI0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060VX07",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060XFJ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 63,
"combined_score": 829
},
{
"protein2": "8022.A0A060XJ06",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060YPP2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060ZE50",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060XAN6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 225,
"database": 832,
"textmining": 130,
"combined_score": 876
},
{
"protein2": "8022.A0A060XB81",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060WLD6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 46,
"experimental": 0,
"database": 825,
"textmining": 62,
"combined_score": 829
},
{
"protein2": "8022.A0A060XBN9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 59,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 838
},
{
"protein2": "8022.A0A060WSN3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 241,
"database": 827,
"textmining": 86,
"combined_score": 869
},
{
"protein2": "8022.A0A060Y3R9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 779,
"textmining": 86,
"combined_score": 789
},
{
"protein2": "8022.A0A060XBV2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060W476",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060ZAK0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 832,
"textmining": 89,
"combined_score": 902
},
{
"protein2": "8022.A0A060YJ99",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 829,
"textmining": 62,
"combined_score": 891
},
{
"protein2": "8022.A0A060WHG5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060XRA0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060YC25",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A061A7Q4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060WRL9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 844,
"textmining": 162,
"combined_score": 961
},
{
"protein2": "8022.A0A060YV89",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 241,
"database": 827,
"textmining": 86,
"combined_score": 869
},
{
"protein2": "8022.A0A060W8T4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060W6W6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 829,
"textmining": 62,
"combined_score": 891
},
{
"protein2": "8022.A0A060X5U6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 46,
"experimental": 0,
"database": 825,
"textmining": 62,
"combined_score": 829
},
{
"protein2": "8022.A0A060W0Q4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060VXS0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060XLX4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060WF25",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060XVD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 291,
"database": 783,
"textmining": 0,
"combined_score": 839
},
{
"protein2": "8022.A0A060XC17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 571,
"textmining": 0,
"combined_score": 708
},
{
"protein2": "8022.A0A060WVH7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 825,
"textmining": 62,
"combined_score": 889
},
{
"protein2": "8022.A0A060YK59",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060X2B4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060WXK5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060Y433",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060VWI9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 83,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 89,
"combined_score": 843
},
{
"protein2": "8022.A0A060WHT5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060XIC8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060XLH0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060XH49",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 89,
"combined_score": 835
},
{
"protein2": "8022.A0A060WCN9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 110,
"combined_score": 839
},
{
"protein2": "8022.A0A060YR93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060XLR8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060W808",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.B2KL82",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 844,
"textmining": 162,
"combined_score": 961
},
{
"protein2": "8022.A0A060WJ93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060Z480",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060Z8T5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060YP44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 827,
"textmining": 89,
"combined_score": 897
},
{
"protein2": "8022.A0A060Y3C6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060YAW4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060ZG63",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060XUD4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060WVD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 829,
"textmining": 62,
"combined_score": 891
},
{
"protein2": "8022.A0A060XCL5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 250,
"database": 827,
"textmining": 109,
"combined_score": 874
},
{
"protein2": "8022.A0A060XA34",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060YL43",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 825,
"textmining": 62,
"combined_score": 889
},
{
"protein2": "8022.A0A060ZEF4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060VWA0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060YEE1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060Z6I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 827,
"textmining": 89,
"combined_score": 897
},
{
"protein2": "8022.C1BH40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 751,
"database": 523,
"textmining": 0,
"combined_score": 876
},
{
"protein2": "8022.A0A060Z1I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060WIZ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060Z6T3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060VPW7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 250,
"database": 827,
"textmining": 109,
"combined_score": 874
},
{
"protein2": "8022.A0A060W0D6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 46,
"experimental": 0,
"database": 825,
"textmining": 62,
"combined_score": 829
},
{
"protein2": "8022.A0A060XB37",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 167,
"combined_score": 849
},
{
"protein2": "8022.A0A060Z1D1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 751,
"database": 523,
"textmining": 0,
"combined_score": 876
},
{
"protein2": "8022.A0A060WE78",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060VXM2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 59,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 838
},
{
"protein2": "8022.A0A060VZ80",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 825,
"textmining": 62,
"combined_score": 889
},
{
"protein2": "8022.A0A060XGM0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 110,
"combined_score": 839
},
{
"protein2": "8022.A0A060YWJ1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 593,
"textmining": 162,
"combined_score": 898
},
{
"protein2": "8022.A0A060WSX0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 829,
"textmining": 62,
"combined_score": 891
},
{
"protein2": "8022.A0A060XTK7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060Z2C2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 844,
"textmining": 162,
"combined_score": 961
},
{
"protein2": "8022.A0A060WDT4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060YU11",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060WHA4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 267,
"database": 832,
"textmining": 87,
"combined_score": 881
},
{
"protein2": "8022.Q7T2I7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 167,
"combined_score": 849
},
{
"protein2": "8022.A0A060XJN8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060Y8H5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 571,
"textmining": 0,
"combined_score": 708
},
{
"protein2": "8022.A0A060XG51",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 748,
"database": 419,
"textmining": 86,
"combined_score": 854
},
{
"protein2": "8022.A0A060W066",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 779,
"textmining": 86,
"combined_score": 789
},
{
"protein2": "8022.A0A060Y3I4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060VW67",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 81,
"combined_score": 832
},
{
"protein2": "8022.A0A060Y8R0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060WP41",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060Z2S8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060VY52",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.Q7SZV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 387,
"database": 831,
"textmining": 124,
"combined_score": 901
},
{
"protein2": "8022.A0A060Z4B9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060Y7L4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060W081",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
}
] |
A0A060XV00
|
Alpha-2B adrenergic receptor (Alpha-2B adrenoreceptor)
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 489
|
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
|
MASPLDSACSVELGNTNSSTSGSSLPCNQSVSSLQLAPYSPEATALFATAITLMIVFTIVGNIFVIIAVLTSRALRGPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFKSLWCEIYLALDVLFCTSSIAHLCAISLDRYLSISRVTYSRQRTPMRIKASIVVVWLISAIISFPPLLSLNKSEPGGEGSERGPQCQLNDERWYILYSTVGSFFAPCLIMILVYMRIYQIAKQRTQNPPGEPRKDGVGSIPHKTSSIRPPTLAITPSLSPDQANETPPSSPTPNNLLHPPDPSLAPTPTTTSPPTSPMGPSHSSAKPKDGEKKGKKGKKGKNSDSDMEHEGGGRRGVNTPSMAGSPGIHSPATIQKYRDMIATSKGARLVAGRRSKPDTTPGAARRKAMVNREKRFTFVLAVVIGVFVVCWFPFFFSYSLQAICPETCALPDPLFKFFFWIGYCNSCLNPVIYTIFNQDFRKAFKKILCKNTKGTFF
|
[
"GO:0051716",
"GO:0051602",
"GO:0009628",
"GO:0009987",
"GO:0051952",
"GO:0065007",
"GO:0023052",
"GO:1903530",
"GO:0032811",
"GO:0033604",
"GO:0051046",
"GO:0051049",
"GO:0051051",
"GO:0008150",
"GO:0071875",
"GO:0050896",
"GO:0050789",
"GO:0014060",
"GO:0051953",
"GO:0050433",
"GO:0048523",
"GO:0048519",
"GO:0007186",
"GO:0051048",
"GO:0032879",
"GO:1903531",
"GO:0007154",
"GO:0007165",
"GO:0050794"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0023052",
"GO:0050896",
"GO:0050789",
"GO:0048519",
"GO:0051716",
"GO:0009628",
"GO:0051051",
"GO:0048523",
"GO:0032879",
"GO:0007154",
"GO:0007165",
"GO:0050794",
"GO:0051602",
"GO:1903530",
"GO:0051049",
"GO:0051953",
"GO:0007186",
"GO:0051048",
"GO:1903531",
"GO:0051952",
"GO:0033604",
"GO:0051046",
"GO:0071875",
"GO:0050433",
"GO:0032811",
"GO:0014060"
] | null | null |
[
"IPR002233",
"IPR000276",
"IPR017452"
] |
af_db/AF-A0A060XV00-F1-model_v4.cif.gz
|
8022.A0A060XV00
|
[
"8022.A0A060XSB8",
"8022.A0A060YR57",
"8022.Q7SZV5",
"8022.A0A060Y2Z0",
"8022.A0A060Y8H5",
"8022.A0A060WHA4",
"8022.A0A060WGC3",
"8022.A0A060WMN1",
"8022.A0A060XPS3",
"8022.A0A060WEW9",
"8022.A0A060Z1D1",
"8022.A0A060Z6E2",
"8022.A0A060Y1H7",
"8022.C1BH40",
"8022.A0A060Z6I0",
"8022.A0A060XN60",
"8022.A0A060YP44",
"8022.A0A060WVZ9",
"8022.A0A060VPZ9",
"8022.A0A060WL89",
"8022.A0A060XC17",
"8022.A0A060XVD9",
"8022.A0A060WXC1",
"8022.A0A060ZAK0",
"8022.A0A060X2G9",
"8022.A0A060XRQ9",
"8022.A0A060W8V2"
] |
[
{
"protein2": "8022.A0A060XSB8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060YR57",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.Q7SZV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 387,
"database": 568,
"textmining": 86,
"combined_score": 736
},
{
"protein2": "8022.A0A060Y2Z0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060Y8H5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 608,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060WHA4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 155,
"experimental": 267,
"database": 571,
"textmining": 86,
"combined_score": 724
},
{
"protein2": "8022.A0A060WGC3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060WMN1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060XPS3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060WEW9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060Z1D1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 626,
"database": 567,
"textmining": 0,
"combined_score": 833
},
{
"protein2": "8022.A0A060Z6E2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060Y1H7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.C1BH40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 626,
"database": 567,
"textmining": 0,
"combined_score": 833
},
{
"protein2": "8022.A0A060Z6I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 523,
"textmining": 88,
"combined_score": 716
},
{
"protein2": "8022.A0A060XN60",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 572,
"textmining": 0,
"combined_score": 709
},
{
"protein2": "8022.A0A060YP44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 523,
"textmining": 88,
"combined_score": 716
},
{
"protein2": "8022.A0A060WVZ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060VPZ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 572,
"textmining": 0,
"combined_score": 709
},
{
"protein2": "8022.A0A060WL89",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060XC17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 571,
"textmining": 0,
"combined_score": 708
},
{
"protein2": "8022.A0A060XVD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 291,
"database": 783,
"textmining": 0,
"combined_score": 839
},
{
"protein2": "8022.A0A060WXC1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060ZAK0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 89,
"combined_score": 751
},
{
"protein2": "8022.A0A060X2G9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060XRQ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060W8V2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 608,
"textmining": 0,
"combined_score": 736
}
] |
A0A060Y1K9
|
Peptidoglycan recognition protein 6
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 478
| null |
MEPHWKWCLTLLVILVSAHTDTKVTSSQHMDDFIRVLEQVEDSNPGLEPVNVLRGLRRAAGLRDEFMQHFLGTIREDSTSEAPVMDSNLSDFIVRAMRHKVTERGREEGVVLTADGTTVAMSPVLLGIEAGLVSKTRCRVRGLYPLTLARNLGLSFQRFHSSLLSQRLGPDGCWDDVTSPQVFTLSDKPSLATDALVNGGMDGVILGIEVSAQSQRPLKLSSLLRRYYCHRLEGEGLDAAPRLISHLRRENFRELARPPLLQRQVVRSLVLQRRLIDHSTMLSQEKEELTAVVREGIKEFVHRYMDCPAIIPRCQWGAAPYRGTPTPLSLPLSFMYIHHTYQPGQPCLTFQQCSADMRSMQRFHQDDRGWDDIGYSFVAGSDGYLYEGRGWHWQGAHTKGYNSKGYGVSFIGDYTSSLPSEQTMELVRDRLASCAVGGGRLVGNFTLYGHRQLVKTSCPGDAFYSEITGWEHFGEVQN
|
[
"GO:0031347",
"GO:0009968",
"GO:0065007",
"GO:0010648",
"GO:0050687",
"GO:0023057",
"GO:0002831",
"GO:0031348",
"GO:0048518",
"GO:0050776",
"GO:0008150",
"GO:0045088",
"GO:0039531",
"GO:0010604",
"GO:0050789",
"GO:0019222",
"GO:0010646",
"GO:0002683",
"GO:0010605",
"GO:0080134",
"GO:0050688",
"GO:0050794",
"GO:0009966",
"GO:0048583",
"GO:0009893",
"GO:0070424",
"GO:0060255",
"GO:0039532",
"GO:0002682",
"GO:0023051",
"GO:0001818",
"GO:0032101",
"GO:0051241",
"GO:1900015",
"GO:0062207",
"GO:0010628",
"GO:0051239",
"GO:1902532",
"GO:0001817",
"GO:0002832",
"GO:1900016",
"GO:0070425",
"GO:0048523",
"GO:0048519",
"GO:0048585",
"GO:0010629",
"GO:1902531",
"GO:0010468",
"GO:0009892",
"GO:0032102",
"GO:0110165",
"GO:0005575",
"GO:0005576",
"GO:0005615"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0048518",
"GO:0050789",
"GO:0048519",
"GO:0023057",
"GO:0019222",
"GO:0002683",
"GO:0050794",
"GO:0048583",
"GO:0009893",
"GO:0002682",
"GO:0023051",
"GO:0051241",
"GO:0051239",
"GO:0048523",
"GO:0048585",
"GO:0009892",
"GO:0009968",
"GO:0010648",
"GO:0002831",
"GO:0031348",
"GO:0050776",
"GO:0010604",
"GO:0010646",
"GO:0010605",
"GO:0080134",
"GO:0009966",
"GO:0060255",
"GO:0039532",
"GO:0001818",
"GO:0032101",
"GO:0001817",
"GO:0002832",
"GO:0032102",
"GO:0031347",
"GO:0050687",
"GO:0045088",
"GO:0050688",
"GO:1900015",
"GO:0062207",
"GO:0010628",
"GO:1902532",
"GO:1900016",
"GO:0070425",
"GO:0010629",
"GO:1902531",
"GO:0010468",
"GO:0039531",
"GO:0070424"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005576",
"GO:0005615"
] |
[
"IPR036505",
"IPR002502",
"IPR015510",
"IPR006619"
] |
af_db/AF-A0A060Y1K9-F1-model_v4.cif.gz
|
8022.A0A060Y1K9
|
[
"8022.A0A060W772",
"8022.A0A060WNW5",
"8022.A0A060WNJ5",
"8022.A0A060VSX6",
"8022.A0A060XLV6",
"8022.A0A060YQG1",
"8022.A0A060XBP3",
"8022.A0A060WBY2",
"8022.A0A060WAQ6",
"8022.A0A060WGC6",
"8022.A0A060W791",
"8022.A0A060YX49",
"8022.A0A060VYI4",
"8022.A0A060WC23",
"8022.A0A060WCW2",
"8022.A0A060YA80",
"8022.A0A060XRN8",
"8022.A0A060WHV6"
] |
[
{
"protein2": "8022.A0A060W772",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 164,
"database": 760,
"textmining": 86,
"combined_score": 806
},
{
"protein2": "8022.A0A060WNW5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 164,
"database": 760,
"textmining": 86,
"combined_score": 806
},
{
"protein2": "8022.A0A060WNJ5",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 61,
"combined_score": 757
},
{
"protein2": "8022.A0A060VSX6",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 61,
"combined_score": 757
},
{
"protein2": "8022.A0A060XLV6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 144,
"coexpression": 55,
"experimental": 0,
"database": 827,
"textmining": 269,
"combined_score": 884
},
{
"protein2": "8022.A0A060YQG1",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 61,
"combined_score": 757
},
{
"protein2": "8022.A0A060XBP3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 164,
"database": 760,
"textmining": 86,
"combined_score": 806
},
{
"protein2": "8022.A0A060WBY2",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 0,
"combined_score": 752
},
{
"protein2": "8022.A0A060WAQ6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 65,
"coexpression": 56,
"experimental": 0,
"database": 832,
"textmining": 364,
"combined_score": 893
},
{
"protein2": "8022.A0A060WGC6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 164,
"database": 760,
"textmining": 86,
"combined_score": 806
},
{
"protein2": "8022.A0A060W791",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 164,
"database": 760,
"textmining": 86,
"combined_score": 806
},
{
"protein2": "8022.A0A060YX49",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 164,
"database": 760,
"textmining": 86,
"combined_score": 806
},
{
"protein2": "8022.A0A060VYI4",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 0,
"combined_score": 752
},
{
"protein2": "8022.A0A060WC23",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 176,
"combined_score": 841
},
{
"protein2": "8022.A0A060WCW2",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 0,
"combined_score": 752
},
{
"protein2": "8022.A0A060YA80",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 176,
"combined_score": 841
},
{
"protein2": "8022.A0A060XRN8",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 0,
"combined_score": 752
},
{
"protein2": "8022.A0A060WHV6",
"neighborhood": 102,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 61,
"combined_score": 757
}
] |
A0A060Y3B2
|
RNA helicase (EC 3.6.4.13)
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 678
|
Cytoplasm {ECO:0000256|ARBA:ARBA00004496}.
|
MADFGLYEYQEEVVQRALRGENIIIWLPTGGGKTRAAVYVAKKHLENNPGAKVAVLVNKVHLVDQHYNNEFNPYLGSDYSLVSISGDCDQKDFFGCEVKNSDLVICTAQILENALTNQEEGKHVELSQFTLLIIDECHHTHKEGVYNKIMARYVAQKLKGERRLPQILGLTASPGTGGAKSIKGAVEHVLQICANLDSVIVSSKVYAPELKKKVPRPRKRFDIVDRRPQDPFGDHLKFMMQFIHDFMALGPEFPVREFGTQEYEADVVILEKKGVTDRNRLLAQCALHLRQYNDALLINDTVRMVDAFRVLESYYSTKSSTAMDGTDFFLLGLYQENEVELRKLSGDARFENPKMGKLQNTLLEQFVQGGHSRGILFSKTRKSICCLYDWVSNNPALQRAGIRAAILTGAGNGINYMTQNEQKDTIRNFRLGSLNLLISTSVAEEGLDIPECNLVVRYGLLTNEIAQQQASGRARASDSVYSVVAQAGGREVRRELLNECLEDLTGRAIGEVQRMEPRDFQMKITDLQTEALLTRQLAEQLKLKKRSRFNAATVQLSCRGCFLPVALGHDIKVIENAHHVNINPDFERYYKTGGQPALKTFEDWEPGRVISCAACGRQWGMEMIYKNIALLPILAIENFAMETPEGRKLAKKWKNVEFTVEEFNFSTYCHNKFPNMLD
|
[
"GO:0006952",
"GO:0009605",
"GO:0043331",
"GO:0002376",
"GO:0006950",
"GO:0008150",
"GO:0042221",
"GO:0014070",
"GO:0043207",
"GO:0043330",
"GO:0050896",
"GO:1901698",
"GO:0010033",
"GO:0051707",
"GO:0045087",
"GO:0006955",
"GO:0009607",
"GO:0098542",
"GO:1902615",
"GO:0044419",
"GO:0005737",
"GO:0005575",
"GO:0005622",
"GO:0110165",
"GO:0048471",
"GO:0003676",
"GO:0097159",
"GO:1901363",
"GO:0005488",
"GO:0003674",
"GO:0003723",
"GO:0003725"
] |
[
"GO:0008150",
"GO:0002376",
"GO:0050896",
"GO:0044419",
"GO:0009605",
"GO:0006950",
"GO:0042221",
"GO:0051707",
"GO:0006955",
"GO:0009607",
"GO:0006952",
"GO:0043207",
"GO:1901698",
"GO:0010033",
"GO:0045087",
"GO:0098542",
"GO:1902615",
"GO:0043331",
"GO:0014070",
"GO:0043330"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0097159",
"GO:1901363",
"GO:0003676",
"GO:0003723",
"GO:0003725"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0005737",
"GO:0005622",
"GO:0048471"
] |
[
"IPR006935",
"IPR014001",
"IPR001650",
"IPR027417",
"IPR041204",
"IPR038557",
"IPR021673",
"IPR051363"
] |
af_db/AF-A0A060Y3B2-F1-model_v4.cif.gz
|
8022.A0A060Y3B2
|
[
"8022.A0A060WKG7",
"8022.A0A060YP86",
"8022.A0A060Y891",
"8022.A0A060XMA3",
"8022.A0A060X8M8",
"8022.A0A060XJI1",
"8022.A0A060XJ85",
"8022.A0A060YZ26",
"8022.A0A060YJZ6",
"8022.A0A060XZL1",
"8022.A0A060YNY0",
"8022.A0A060YGR3",
"8022.A0A060YZ88",
"8022.A0A060XLY4",
"8022.A0A060XL84",
"8022.A0A060WQG6",
"8022.A0A060WEB4",
"8022.A0A060YK39",
"8022.A0A060XY19",
"8022.A0A060WH56",
"8022.A0A060WW34",
"8022.A0A060YC09",
"8022.A0A060ZBM2",
"8022.A0A060YLC4",
"8022.A0A060WAB8",
"8022.A0A060W266",
"8022.A0A060Z1S1",
"8022.A0A060XWW5",
"8022.A0A060WP82",
"8022.A0A060VWJ9",
"8022.A0A060YRP9",
"8022.A0A060WKE3",
"8022.A0A060WZ23",
"8022.A0A060WAI5",
"8022.A0A060XUZ1",
"8022.A0A060VRW6",
"8022.A0A060Z5H7",
"8022.A0A060XTY3",
"8022.C1BFG2",
"8022.A0A060ZHX0",
"8022.A0A060XK45",
"8022.A0A060XRR2",
"8022.A0A060Z6F4",
"8022.A0A060WD36",
"8022.A0A060YNG8",
"8022.A0A060WT92",
"8022.A0A060Z655",
"8022.A0A060XI12",
"8022.A0A060Z4W8",
"8022.A0A060X6S5",
"8022.A0A060Y1N8",
"8022.A0A060W5A5",
"8022.A0A060WA73",
"8022.A0A060WAL5",
"8022.C1BG62",
"8022.A0A060WKE6",
"8022.A0A060W7K8",
"8022.A0A060XDQ4",
"8022.A0A060WS77",
"8022.A0A060YEJ5",
"8022.A0A060X2B7",
"8022.A0A060WK21",
"8022.A0A060WZW0",
"8022.A0A060Y4K2",
"8022.A0A060VPV4",
"8022.A0A060Y6S6",
"8022.A0A060WGE5",
"8022.A0A060YX92",
"8022.A0A060WVN0",
"8022.A0A060XER0",
"8022.A0A060Y135",
"8022.A0A060WP39",
"8022.A0A060XDM2",
"8022.A0A060Z000",
"8022.A0A060X1X7",
"8022.A0A061AEY4",
"8022.A0A060X5I3",
"8022.A0A060YMR9",
"8022.A0A060XW94",
"8022.A0A060W6R9",
"8022.A0A060Y5Y0",
"8022.A0A060XTX7",
"8022.A0A060YGN0",
"8022.A0A060W8A7",
"8022.A0A060X3S8",
"8022.A0A060WG92",
"8022.A0A060XXI9",
"8022.A0A060Z173",
"8022.A0A060Z0R5",
"8022.A0A060XV19",
"8022.A0A060W7E9",
"8022.A0A060WAH7",
"8022.A0A060X4P6",
"8022.A0A060X656",
"8022.A0A060W9X0",
"8022.A0A060W9W8",
"8022.A0A060WW06",
"8022.A0A060ZDZ5",
"8022.A0A060X2M8",
"8022.A0A060XVQ5",
"8022.A0A060ZEW9",
"8022.A0A060XYH4",
"8022.A0A060WHG0",
"8022.A0A060XZH1",
"8022.A0A060XVP1",
"8022.A0A060XU58",
"8022.A0A060Z320",
"8022.A0A060ZXZ7",
"8022.A0A060YFT4",
"8022.A0A060YQV1",
"8022.A0A060Y9V2",
"8022.A0A060XX03",
"8022.A0A060Y1E2",
"8022.C1BI16",
"8022.A0A060Y7H3",
"8022.A0A060XNR8",
"8022.A0A060XGN6",
"8022.A0A060XXJ1",
"8022.A0A060WAD4",
"8022.A0A060X729",
"8022.A0A060XBU0",
"8022.A0A060YIJ3",
"8022.A0A060WKD2",
"8022.A0A060X0A0",
"8022.A0A060Z6E8",
"8022.A0A060YDW3",
"8022.A0A060XYU5",
"8022.A0A060XB77",
"8022.A0A060W716",
"8022.A0A060YE39",
"8022.A0A060X0Z8",
"8022.A0A060YW05",
"8022.A0A060XUU8",
"8022.A0A060XSK5",
"8022.A0A060VU69",
"8022.A0A060WRH2",
"8022.A0A060YW55",
"8022.A0A060WFX5",
"8022.A0A060ZAM3",
"8022.A0A060Y0H6",
"8022.A0A060WE07",
"8022.A0A060XPT1",
"8022.A0A060XNV6",
"8022.A0A060YST3",
"8022.A0A060YQF1",
"8022.A0A060XFH7",
"8022.A0A060YHX9",
"8022.A0A060WGY3",
"8022.A0A060YI26",
"8022.A0A060WM17",
"8022.A0A060Z3S0",
"8022.A0A060W5V1",
"8022.A0A060VZM9",
"8022.A0A060ZEB5",
"8022.A0A060WF04",
"8022.A0A060YT06",
"8022.A0A060YHA2",
"8022.C1BHI8",
"8022.A0A060WAH4",
"8022.A0A060XC88",
"8022.A0A060WLM0",
"8022.Q9PT09",
"8022.A0A060YCF8",
"8022.A0A060XWU6",
"8022.A0A060WMT5",
"8022.A0A060XTB8",
"8022.A0A060VZX4",
"8022.A0A060YR45",
"8022.A0A060W1U5",
"8022.A0A060XPN1",
"8022.A0A060Y4Q1",
"8022.A0A060Z819",
"8022.A0A060YNT6",
"8022.A0A060XCS7",
"8022.A0A060WJD4",
"8022.A0A060Z3Y6",
"8022.A0A060ZQU3",
"8022.A0A060WZ94",
"8022.A0A060X8S8",
"8022.A0A060WC46",
"8022.A0A060XX02"
] |
[
{
"protein2": "8022.A0A060WKG7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 673,
"database": 754,
"textmining": 52,
"combined_score": 917
},
{
"protein2": "8022.A0A060YP86",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060Y891",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 180,
"database": 772,
"textmining": 218,
"combined_score": 841
},
{
"protein2": "8022.A0A060XMA3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060X8M8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 48,
"experimental": 346,
"database": 433,
"textmining": 400,
"combined_score": 759
},
{
"protein2": "8022.A0A060XJI1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 675,
"database": 785,
"textmining": 230,
"combined_score": 941
},
{
"protein2": "8022.A0A060XJ85",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 690,
"database": 547,
"textmining": 238,
"combined_score": 895
},
{
"protein2": "8022.A0A060YZ26",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 86,
"combined_score": 741
},
{
"protein2": "8022.A0A060YJZ6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 758
},
{
"protein2": "8022.A0A060XZL1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 180,
"database": 772,
"textmining": 218,
"combined_score": 841
},
{
"protein2": "8022.A0A060YNY0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060YGR3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 0,
"textmining": 373,
"combined_score": 706
},
{
"protein2": "8022.A0A060YZ88",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060XLY4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 812,
"database": 829,
"textmining": 337,
"combined_score": 976
},
{
"protein2": "8022.A0A060XL84",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 673,
"database": 754,
"textmining": 52,
"combined_score": 917
},
{
"protein2": "8022.A0A060WQG6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 758
},
{
"protein2": "8022.A0A060WEB4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 669,
"database": 774,
"textmining": 388,
"combined_score": 950
},
{
"protein2": "8022.A0A060YK39",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 616,
"database": 721,
"textmining": 208,
"combined_score": 907
},
{
"protein2": "8022.A0A060XY19",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 669,
"database": 774,
"textmining": 388,
"combined_score": 950
},
{
"protein2": "8022.A0A060WH56",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 747,
"database": 824,
"textmining": 420,
"combined_score": 971
},
{
"protein2": "8022.A0A060WW34",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
},
{
"protein2": "8022.A0A060YC09",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 148,
"experimental": 184,
"database": 583,
"textmining": 110,
"combined_score": 707
},
{
"protein2": "8022.A0A060ZBM2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 178,
"database": 785,
"textmining": 387,
"combined_score": 884
},
{
"protein2": "8022.A0A060YLC4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 450,
"combined_score": 937
},
{
"protein2": "8022.A0A060WAB8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 180,
"database": 772,
"textmining": 218,
"combined_score": 841
},
{
"protein2": "8022.A0A060W266",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 219,
"database": 593,
"textmining": 330,
"combined_score": 768
},
{
"protein2": "8022.A0A060Z1S1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 188,
"database": 816,
"textmining": 276,
"combined_score": 882
},
{
"protein2": "8022.A0A060XWW5",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
},
{
"protein2": "8022.A0A060WP82",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060VWJ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 86,
"combined_score": 741
},
{
"protein2": "8022.A0A060YRP9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 690,
"database": 547,
"textmining": 238,
"combined_score": 895
},
{
"protein2": "8022.A0A060WKE3",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 679,
"database": 0,
"textmining": 279,
"combined_score": 763
},
{
"protein2": "8022.A0A060WZ23",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 775,
"database": 489,
"textmining": 90,
"combined_score": 887
},
{
"protein2": "8022.A0A060WAI5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 207,
"database": 736,
"textmining": 121,
"combined_score": 799
},
{
"protein2": "8022.A0A060XUZ1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 299,
"database": 824,
"textmining": 0,
"combined_score": 871
},
{
"protein2": "8022.A0A060VRW6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 219,
"database": 593,
"textmining": 330,
"combined_score": 768
},
{
"protein2": "8022.A0A060Z5H7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 683,
"database": 0,
"textmining": 309,
"combined_score": 771
},
{
"protein2": "8022.A0A060XTY3",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 199,
"experimental": 694,
"database": 0,
"textmining": 384,
"combined_score": 836
},
{
"protein2": "8022.C1BFG2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 86,
"combined_score": 741
},
{
"protein2": "8022.A0A060ZHX0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 386,
"database": 568,
"textmining": 396,
"combined_score": 841
},
{
"protein2": "8022.A0A060XK45",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 207,
"database": 736,
"textmining": 121,
"combined_score": 799
},
{
"protein2": "8022.A0A060XRR2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 76,
"experimental": 745,
"database": 0,
"textmining": 498,
"combined_score": 871
},
{
"protein2": "8022.A0A060Z6F4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 131,
"experimental": 0,
"database": 685,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060WD36",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 219,
"database": 593,
"textmining": 330,
"combined_score": 768
},
{
"protein2": "8022.A0A060YNG8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 450,
"combined_score": 937
},
{
"protein2": "8022.A0A060WT92",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 131,
"experimental": 0,
"database": 685,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060Z655",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 749,
"database": 0,
"textmining": 441,
"combined_score": 853
},
{
"protein2": "8022.A0A060XI12",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 690,
"database": 547,
"textmining": 238,
"combined_score": 895
},
{
"protein2": "8022.A0A060Z4W8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 690,
"database": 547,
"textmining": 238,
"combined_score": 895
},
{
"protein2": "8022.A0A060X6S5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 774,
"experimental": 0,
"database": 0,
"textmining": 504,
"combined_score": 883
},
{
"protein2": "8022.A0A060Y1N8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060W5A5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 694,
"textmining": 273,
"combined_score": 768
},
{
"protein2": "8022.A0A060WA73",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 666,
"database": 0,
"textmining": 342,
"combined_score": 774
},
{
"protein2": "8022.A0A060WAL5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 217,
"experimental": 326,
"database": 0,
"textmining": 505,
"combined_score": 715
},
{
"protein2": "8022.C1BG62",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 749,
"database": 435,
"textmining": 0,
"combined_score": 852
},
{
"protein2": "8022.A0A060WKE6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 875,
"experimental": 0,
"database": 431,
"textmining": 504,
"combined_score": 961
},
{
"protein2": "8022.A0A060W7K8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 616,
"database": 721,
"textmining": 208,
"combined_score": 907
},
{
"protein2": "8022.A0A060XDQ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 749,
"database": 0,
"textmining": 441,
"combined_score": 853
},
{
"protein2": "8022.A0A060WS77",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 679,
"database": 0,
"textmining": 279,
"combined_score": 763
},
{
"protein2": "8022.A0A060YEJ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 824,
"textmining": 190,
"combined_score": 851
},
{
"protein2": "8022.A0A060X2B7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 207,
"database": 736,
"textmining": 121,
"combined_score": 799
},
{
"protein2": "8022.A0A060WK21",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060WZW0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 178,
"database": 785,
"textmining": 387,
"combined_score": 884
},
{
"protein2": "8022.A0A060Y4K2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 823,
"experimental": 0,
"database": 0,
"textmining": 277,
"combined_score": 868
},
{
"protein2": "8022.A0A060VPV4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 666,
"database": 0,
"textmining": 342,
"combined_score": 774
},
{
"protein2": "8022.A0A060Y6S6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060WGE5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 875,
"experimental": 0,
"database": 431,
"textmining": 504,
"combined_score": 961
},
{
"protein2": "8022.A0A060YX92",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 747,
"database": 824,
"textmining": 420,
"combined_score": 971
},
{
"protein2": "8022.A0A060WVN0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 219,
"database": 593,
"textmining": 330,
"combined_score": 768
},
{
"protein2": "8022.A0A060XER0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 180,
"database": 772,
"textmining": 218,
"combined_score": 841
},
{
"protein2": "8022.A0A060Y135",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060WP39",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 673,
"database": 754,
"textmining": 52,
"combined_score": 917
},
{
"protein2": "8022.A0A060XDM2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 207,
"database": 736,
"textmining": 121,
"combined_score": 799
},
{
"protein2": "8022.A0A060Z000",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 579,
"database": 721,
"textmining": 216,
"combined_score": 899
},
{
"protein2": "8022.A0A060X1X7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 217,
"experimental": 326,
"database": 0,
"textmining": 505,
"combined_score": 715
},
{
"protein2": "8022.A0A061AEY4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 766,
"database": 824,
"textmining": 447,
"combined_score": 975
},
{
"protein2": "8022.A0A060X5I3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 675,
"database": 785,
"textmining": 268,
"combined_score": 944
},
{
"protein2": "8022.A0A060YMR9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 425,
"experimental": 299,
"database": 409,
"textmining": 451,
"combined_score": 851
},
{
"protein2": "8022.A0A060XW94",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 684,
"database": 824,
"textmining": 340,
"combined_score": 961
},
{
"protein2": "8022.A0A060W6R9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060Y5Y0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 122,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 772
},
{
"protein2": "8022.A0A060XTX7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 87,
"combined_score": 741
},
{
"protein2": "8022.A0A060YGN0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 207,
"database": 736,
"textmining": 121,
"combined_score": 799
},
{
"protein2": "8022.A0A060W8A7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 207,
"database": 736,
"textmining": 121,
"combined_score": 799
},
{
"protein2": "8022.A0A060X3S8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 802,
"database": 829,
"textmining": 504,
"combined_score": 981
},
{
"protein2": "8022.A0A060WG92",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060XXI9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 204,
"database": 827,
"textmining": 362,
"combined_score": 904
},
{
"protein2": "8022.A0A060Z173",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 188,
"database": 816,
"textmining": 276,
"combined_score": 882
},
{
"protein2": "8022.A0A060Z0R5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 706,
"database": 824,
"textmining": 441,
"combined_score": 968
},
{
"protein2": "8022.A0A060XV19",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 87,
"combined_score": 741
},
{
"protein2": "8022.A0A060W7E9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 299,
"database": 829,
"textmining": 0,
"combined_score": 875
},
{
"protein2": "8022.A0A060WAH7",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 199,
"experimental": 694,
"database": 0,
"textmining": 384,
"combined_score": 836
},
{
"protein2": "8022.A0A060X4P6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 0,
"textmining": 373,
"combined_score": 706
},
{
"protein2": "8022.A0A060X656",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 781,
"experimental": 0,
"database": 0,
"textmining": 504,
"combined_score": 887
},
{
"protein2": "8022.A0A060W9X0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060W9W8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 48,
"experimental": 346,
"database": 433,
"textmining": 400,
"combined_score": 759
},
{
"protein2": "8022.A0A060WW06",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 666,
"database": 0,
"textmining": 342,
"combined_score": 774
},
{
"protein2": "8022.A0A060ZDZ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 652,
"database": 435,
"textmining": 0,
"combined_score": 794
},
{
"protein2": "8022.A0A060X2M8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 131,
"experimental": 0,
"database": 685,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060XVQ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 758,
"database": 824,
"textmining": 370,
"combined_score": 970
},
{
"protein2": "8022.A0A060ZEW9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 222,
"database": 832,
"textmining": 150,
"combined_score": 879
},
{
"protein2": "8022.A0A060XYH4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 675,
"database": 785,
"textmining": 268,
"combined_score": 944
},
{
"protein2": "8022.A0A060WHG0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 87,
"combined_score": 741
},
{
"protein2": "8022.A0A060XZH1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060XVP1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 180,
"database": 772,
"textmining": 218,
"combined_score": 841
},
{
"protein2": "8022.A0A060XU58",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 755,
"experimental": 0,
"database": 0,
"textmining": 126,
"combined_score": 776
},
{
"protein2": "8022.A0A060Z320",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 579,
"database": 721,
"textmining": 216,
"combined_score": 899
},
{
"protein2": "8022.A0A060ZXZ7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 288,
"database": 832,
"textmining": 505,
"combined_score": 937
},
{
"protein2": "8022.A0A060YFT4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 775,
"database": 489,
"textmining": 90,
"combined_score": 887
},
{
"protein2": "8022.A0A060YQV1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 240,
"database": 827,
"textmining": 505,
"combined_score": 929
},
{
"protein2": "8022.A0A060Y9V2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 774,
"experimental": 0,
"database": 0,
"textmining": 504,
"combined_score": 883
},
{
"protein2": "8022.A0A060XX03",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 684,
"database": 824,
"textmining": 340,
"combined_score": 961
},
{
"protein2": "8022.A0A060Y1E2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 758
},
{
"protein2": "8022.C1BI16",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 616,
"database": 721,
"textmining": 208,
"combined_score": 907
},
{
"protein2": "8022.A0A060Y7H3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 802,
"database": 0,
"textmining": 222,
"combined_score": 839
},
{
"protein2": "8022.A0A060XNR8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 675,
"database": 785,
"textmining": 230,
"combined_score": 941
},
{
"protein2": "8022.A0A060XGN6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 86,
"combined_score": 741
},
{
"protein2": "8022.A0A060XXJ1",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
},
{
"protein2": "8022.A0A060WAD4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 48,
"experimental": 346,
"database": 433,
"textmining": 400,
"combined_score": 759
},
{
"protein2": "8022.A0A060X729",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 616,
"database": 721,
"textmining": 208,
"combined_score": 907
},
{
"protein2": "8022.A0A060XBU0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 690,
"database": 547,
"textmining": 238,
"combined_score": 895
},
{
"protein2": "8022.A0A060YIJ3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 0,
"textmining": 373,
"combined_score": 706
},
{
"protein2": "8022.A0A060WKD2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060X0A0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 148,
"experimental": 184,
"database": 583,
"textmining": 110,
"combined_score": 707
},
{
"protein2": "8022.A0A060Z6E8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 672,
"database": 0,
"textmining": 396,
"combined_score": 793
},
{
"protein2": "8022.A0A060YDW3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 169,
"experimental": 361,
"database": 306,
"textmining": 509,
"combined_score": 794
},
{
"protein2": "8022.A0A060XYU5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 758
},
{
"protein2": "8022.A0A060XB77",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 679,
"database": 0,
"textmining": 279,
"combined_score": 763
},
{
"protein2": "8022.A0A060W716",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 616,
"database": 721,
"textmining": 208,
"combined_score": 907
},
{
"protein2": "8022.A0A060YE39",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 823,
"experimental": 0,
"database": 0,
"textmining": 277,
"combined_score": 868
},
{
"protein2": "8022.A0A060X0Z8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 207,
"database": 736,
"textmining": 121,
"combined_score": 799
},
{
"protein2": "8022.A0A060YW05",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 366,
"database": 824,
"textmining": 220,
"combined_score": 905
},
{
"protein2": "8022.A0A060XUU8",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
},
{
"protein2": "8022.A0A060XSK5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060VU69",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 122,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 772
},
{
"protein2": "8022.A0A060WRH2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 758
},
{
"protein2": "8022.A0A060YW55",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 425,
"experimental": 299,
"database": 409,
"textmining": 451,
"combined_score": 851
},
{
"protein2": "8022.A0A060WFX5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 131,
"experimental": 0,
"database": 685,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060ZAM3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 815,
"database": 829,
"textmining": 451,
"combined_score": 981
},
{
"protein2": "8022.A0A060Y0H6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060WE07",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 856,
"database": 829,
"textmining": 450,
"combined_score": 985
},
{
"protein2": "8022.A0A060XPT1",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
},
{
"protein2": "8022.A0A060XNV6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 122,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 772
},
{
"protein2": "8022.A0A060YST3",
"neighborhood": 46,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 779,
"textmining": 86,
"combined_score": 790
},
{
"protein2": "8022.A0A060YQF1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 180,
"database": 772,
"textmining": 218,
"combined_score": 841
},
{
"protein2": "8022.A0A060XFH7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060YHX9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 188,
"database": 816,
"textmining": 276,
"combined_score": 882
},
{
"protein2": "8022.A0A060WGY3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 131,
"experimental": 0,
"database": 685,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060YI26",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060WM17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 666,
"database": 0,
"textmining": 342,
"combined_score": 774
},
{
"protein2": "8022.A0A060Z3S0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 766,
"database": 824,
"textmining": 447,
"combined_score": 975
},
{
"protein2": "8022.A0A060W5V1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 53,
"experimental": 802,
"database": 829,
"textmining": 450,
"combined_score": 980
},
{
"protein2": "8022.A0A060VZM9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 69,
"coexpression": 628,
"experimental": 471,
"database": 862,
"textmining": 512,
"combined_score": 985
},
{
"protein2": "8022.A0A060ZEB5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 240,
"database": 827,
"textmining": 505,
"combined_score": 929
},
{
"protein2": "8022.A0A060WF04",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 219,
"database": 593,
"textmining": 330,
"combined_score": 768
},
{
"protein2": "8022.A0A060YT06",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 824,
"textmining": 190,
"combined_score": 851
},
{
"protein2": "8022.A0A060YHA2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 672,
"database": 0,
"textmining": 396,
"combined_score": 793
},
{
"protein2": "8022.C1BHI8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 86,
"combined_score": 741
},
{
"protein2": "8022.A0A060WAH4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 299,
"database": 824,
"textmining": 0,
"combined_score": 871
},
{
"protein2": "8022.A0A060XC88",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 148,
"experimental": 184,
"database": 583,
"textmining": 110,
"combined_score": 707
},
{
"protein2": "8022.A0A060WLM0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 669,
"database": 774,
"textmining": 388,
"combined_score": 950
},
{
"protein2": "8022.Q9PT09",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 749,
"database": 435,
"textmining": 0,
"combined_score": 852
},
{
"protein2": "8022.A0A060YCF8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 847,
"experimental": 471,
"database": 839,
"textmining": 507,
"combined_score": 992
},
{
"protein2": "8022.A0A060XWU6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 758,
"database": 824,
"textmining": 370,
"combined_score": 970
},
{
"protein2": "8022.A0A060WMT5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 386,
"database": 568,
"textmining": 396,
"combined_score": 841
},
{
"protein2": "8022.A0A060XTB8",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 199,
"experimental": 694,
"database": 0,
"textmining": 384,
"combined_score": 836
},
{
"protein2": "8022.A0A060VZX4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 675,
"database": 785,
"textmining": 268,
"combined_score": 944
},
{
"protein2": "8022.A0A060YR45",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 366,
"database": 824,
"textmining": 220,
"combined_score": 905
},
{
"protein2": "8022.A0A060W1U5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 0,
"database": 829,
"textmining": 503,
"combined_score": 913
},
{
"protein2": "8022.A0A060XPN1",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
},
{
"protein2": "8022.A0A060Y4Q1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 204,
"database": 827,
"textmining": 362,
"combined_score": 904
},
{
"protein2": "8022.A0A060Z819",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 188,
"database": 816,
"textmining": 276,
"combined_score": 882
},
{
"protein2": "8022.A0A060YNT6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060XCS7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 207,
"database": 736,
"textmining": 121,
"combined_score": 799
},
{
"protein2": "8022.A0A060WJD4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 706,
"database": 824,
"textmining": 441,
"combined_score": 968
},
{
"protein2": "8022.A0A060Z3Y6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 178,
"database": 785,
"textmining": 387,
"combined_score": 884
},
{
"protein2": "8022.A0A060ZQU3",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 679,
"database": 0,
"textmining": 279,
"combined_score": 763
},
{
"protein2": "8022.A0A060WZ94",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 675,
"database": 785,
"textmining": 230,
"combined_score": 941
},
{
"protein2": "8022.A0A060X8S8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 86,
"combined_score": 741
},
{
"protein2": "8022.A0A060WC46",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 386,
"database": 568,
"textmining": 396,
"combined_score": 841
},
{
"protein2": "8022.A0A060XX02",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
}
] |
A0A060YAV5
|
Beta-2 adrenergic receptor (Beta-2 adrenoreceptor)
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 393
|
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
|
MEREREREREREEGGGGGXGEPGYSEVEMVLLGMLMSLLVVGIVFGNILVIIAIYRFQRLQNITNCFITSLACADLVMGLIVVPFGACYIIFNTWHFGSFWCEFWTATDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTKCKARVVVLLVWVIAGLISFLPIHMKWWISDDAEAKACIQNSNCCDFNTNTAYAITSSIISFYIPLVVMVFVYSRVFQEAKQQLRKIDRSEGRFHAHNNNMAGGGGGGGGGGGGTKFCLREHKALKTLGIIMGIFTLCWLPFFVLNVVVAIWKVGDIGLAFRILNWIGYANSAFNPLIYCRSPEFRYAFKEILCIKKVRFPNIGPTNGYVYSGHSWQTADGCSGRGEAGGCGAADRTDPNGNCSKGLTTVL
|
[
"GO:0043434",
"GO:1901652",
"GO:0051952",
"GO:0065007",
"GO:1903530",
"GO:0032811",
"GO:0033604",
"GO:0051049",
"GO:0051051",
"GO:0008150",
"GO:0042221",
"GO:0010243",
"GO:0050896",
"GO:1901698",
"GO:0050789",
"GO:0050433",
"GO:0009719",
"GO:0032879",
"GO:0007186",
"GO:0050794",
"GO:0051716",
"GO:0009987",
"GO:0023052",
"GO:1901700",
"GO:0051046",
"GO:0071875",
"GO:0014060",
"GO:0051953",
"GO:0048523",
"GO:0048519",
"GO:0010033",
"GO:0009725",
"GO:0051048",
"GO:0007154",
"GO:1903531",
"GO:0007165"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050896",
"GO:0050789",
"GO:0009987",
"GO:0023052",
"GO:0048519",
"GO:0051051",
"GO:0042221",
"GO:0009719",
"GO:0032879",
"GO:0050794",
"GO:0051716",
"GO:0048523",
"GO:0007154",
"GO:0007165",
"GO:1903530",
"GO:0051049",
"GO:1901698",
"GO:0007186",
"GO:1901700",
"GO:0051953",
"GO:0010033",
"GO:0009725",
"GO:0051048",
"GO:1903531",
"GO:0043434",
"GO:1901652",
"GO:0051952",
"GO:0033604",
"GO:0010243",
"GO:0050433",
"GO:0051046",
"GO:0071875",
"GO:0032811",
"GO:0014060"
] | null | null |
[
"IPR002233",
"IPR000276",
"IPR017452"
] | null |
8022.A0A060YAV5
|
[
"8022.A0A060YAW4",
"8022.A0A060Y3C6",
"8022.A0A060Z8T5",
"8022.A0A060YP44",
"8022.A0A060Z480",
"8022.A0A060WJ93",
"8022.A0A060XCL5",
"8022.A0A060XA34",
"8022.A0A060WVD9",
"8022.A0A060ZG63",
"8022.A0A060XUD4",
"8022.A0A060YR93",
"8022.A0A060WCN9",
"8022.B2KL82",
"8022.A0A060XLR8",
"8022.A0A060W808",
"8022.A0A060WHT5",
"8022.A0A060XH49",
"8022.A0A060XLH0",
"8022.A0A060XIC8",
"8022.A0A060YK59",
"8022.A0A060WVH7",
"8022.A0A060Y433",
"8022.A0A060VWI9",
"8022.A0A060WXK5",
"8022.A0A060X2B4",
"8022.A0A060VXS0",
"8022.A0A060XLX4",
"8022.A0A060W0Q4",
"8022.A0A060XC17",
"8022.A0A060XVD9",
"8022.A0A060WF25",
"8022.A0A060XRA0",
"8022.A0A060YC25",
"8022.A0A060WHG5",
"8022.A0A060YJ99",
"8022.A0A060X5U6",
"8022.A0A060W8T4",
"8022.A0A060W6W6",
"8022.A0A061A7Q4",
"8022.A0A060WRL9",
"8022.A0A060YV89",
"8022.A0A060Y3R9",
"8022.A0A060WSN3",
"8022.A0A060XBN9",
"8022.A0A060XAN6",
"8022.A0A060XB81",
"8022.A0A060WLD6",
"8022.A0A060ZE50",
"8022.A0A060YPP2",
"8022.A0A060ZAK0",
"8022.A0A060W476",
"8022.A0A060XBV2",
"8022.A0A060YHK9",
"8022.A0A060Z6G3",
"8022.A0A060XJ06",
"8022.A0A060XFJ9",
"8022.A0A060VX07",
"8022.A0A060WVI0",
"8022.A0A060Z4B9",
"8022.A0A060W081",
"8022.A0A060Y7L4",
"8022.A0A060WP41",
"8022.A0A060Y8R0",
"8022.A0A060Y3I4",
"8022.A0A060VW67",
"8022.A0A060W066",
"8022.A0A060XG51",
"8022.Q7SZV5",
"8022.A0A060VY52",
"8022.A0A060Z2S8",
"8022.Q7T2I7",
"8022.A0A060Y8H5",
"8022.A0A060XJN8",
"8022.A0A060Z2C2",
"8022.A0A060WHA4",
"8022.A0A060YU11",
"8022.A0A060WDT4",
"8022.A0A060VXM2",
"8022.A0A060WE78",
"8022.A0A060WSX0",
"8022.A0A060XTK7",
"8022.A0A060YWJ1",
"8022.A0A060VZ80",
"8022.A0A060XGM0",
"8022.A0A060W0D6",
"8022.A0A060Z1D1",
"8022.A0A060XB37",
"8022.A0A060WIZ5",
"8022.C1BH40",
"8022.A0A060Z1I0",
"8022.A0A060Z6I0",
"8022.A0A060YEE1",
"8022.A0A060VPW7",
"8022.A0A060Z6T3",
"8022.A0A060YL43",
"8022.A0A060VWA0",
"8022.A0A060ZEF4"
] |
[
{
"protein2": "8022.A0A060YAW4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060Y3C6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060Z8T5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060YP44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 827,
"textmining": 89,
"combined_score": 897
},
{
"protein2": "8022.A0A060Z480",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060WJ93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060XCL5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 250,
"database": 827,
"textmining": 109,
"combined_score": 874
},
{
"protein2": "8022.A0A060XA34",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060WVD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 829,
"textmining": 62,
"combined_score": 891
},
{
"protein2": "8022.A0A060ZG63",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060XUD4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060YR93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060WCN9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 110,
"combined_score": 839
},
{
"protein2": "8022.B2KL82",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 844,
"textmining": 162,
"combined_score": 961
},
{
"protein2": "8022.A0A060XLR8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060W808",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060WHT5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060XH49",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 89,
"combined_score": 835
},
{
"protein2": "8022.A0A060XLH0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060XIC8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060YK59",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060WVH7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 825,
"textmining": 62,
"combined_score": 889
},
{
"protein2": "8022.A0A060Y433",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060VWI9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 81,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 89,
"combined_score": 842
},
{
"protein2": "8022.A0A060WXK5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060X2B4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060VXS0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060XLX4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060W0Q4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060XC17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 571,
"textmining": 0,
"combined_score": 708
},
{
"protein2": "8022.A0A060XVD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 291,
"database": 783,
"textmining": 0,
"combined_score": 839
},
{
"protein2": "8022.A0A060WF25",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060XRA0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060YC25",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060WHG5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060YJ99",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 829,
"textmining": 62,
"combined_score": 891
},
{
"protein2": "8022.A0A060X5U6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 46,
"experimental": 0,
"database": 825,
"textmining": 62,
"combined_score": 829
},
{
"protein2": "8022.A0A060W8T4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060W6W6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 829,
"textmining": 62,
"combined_score": 891
},
{
"protein2": "8022.A0A061A7Q4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060WRL9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 844,
"textmining": 162,
"combined_score": 961
},
{
"protein2": "8022.A0A060YV89",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 241,
"database": 827,
"textmining": 86,
"combined_score": 869
},
{
"protein2": "8022.A0A060Y3R9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 779,
"textmining": 86,
"combined_score": 789
},
{
"protein2": "8022.A0A060WSN3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 241,
"database": 827,
"textmining": 86,
"combined_score": 869
},
{
"protein2": "8022.A0A060XBN9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 59,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 838
},
{
"protein2": "8022.A0A060XAN6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 225,
"database": 832,
"textmining": 130,
"combined_score": 876
},
{
"protein2": "8022.A0A060XB81",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060WLD6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 46,
"experimental": 0,
"database": 825,
"textmining": 62,
"combined_score": 829
},
{
"protein2": "8022.A0A060ZE50",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060YPP2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060ZAK0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 832,
"textmining": 89,
"combined_score": 902
},
{
"protein2": "8022.A0A060W476",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060XBV2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060YHK9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060Z6G3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060XJ06",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060XFJ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 63,
"combined_score": 829
},
{
"protein2": "8022.A0A060VX07",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060WVI0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060Z4B9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060W081",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060Y7L4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060WP41",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060Y8R0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060Y3I4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060VW67",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 81,
"combined_score": 832
},
{
"protein2": "8022.A0A060W066",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 779,
"textmining": 86,
"combined_score": 789
},
{
"protein2": "8022.A0A060XG51",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 748,
"database": 419,
"textmining": 86,
"combined_score": 854
},
{
"protein2": "8022.Q7SZV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 387,
"database": 831,
"textmining": 124,
"combined_score": 901
},
{
"protein2": "8022.A0A060VY52",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060Z2S8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.Q7T2I7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 167,
"combined_score": 849
},
{
"protein2": "8022.A0A060Y8H5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 571,
"textmining": 0,
"combined_score": 708
},
{
"protein2": "8022.A0A060XJN8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060Z2C2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 844,
"textmining": 162,
"combined_score": 961
},
{
"protein2": "8022.A0A060WHA4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 267,
"database": 832,
"textmining": 87,
"combined_score": 881
},
{
"protein2": "8022.A0A060YU11",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060WDT4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060VXM2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 59,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 838
},
{
"protein2": "8022.A0A060WE78",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060WSX0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 829,
"textmining": 62,
"combined_score": 891
},
{
"protein2": "8022.A0A060XTK7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060YWJ1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 593,
"textmining": 162,
"combined_score": 898
},
{
"protein2": "8022.A0A060VZ80",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 825,
"textmining": 62,
"combined_score": 889
},
{
"protein2": "8022.A0A060XGM0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 110,
"combined_score": 839
},
{
"protein2": "8022.A0A060W0D6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 46,
"experimental": 0,
"database": 825,
"textmining": 62,
"combined_score": 829
},
{
"protein2": "8022.A0A060Z1D1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 751,
"database": 523,
"textmining": 0,
"combined_score": 876
},
{
"protein2": "8022.A0A060XB37",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 167,
"combined_score": 849
},
{
"protein2": "8022.A0A060WIZ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.C1BH40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 751,
"database": 523,
"textmining": 0,
"combined_score": 876
},
{
"protein2": "8022.A0A060Z1I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060Z6I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 827,
"textmining": 89,
"combined_score": 897
},
{
"protein2": "8022.A0A060YEE1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060VPW7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 250,
"database": 827,
"textmining": 109,
"combined_score": 874
},
{
"protein2": "8022.A0A060Z6T3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060YL43",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 825,
"textmining": 62,
"combined_score": 889
},
{
"protein2": "8022.A0A060VWA0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060ZEF4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
}
] |
A0A060YDW5
|
Alpha-2B adrenergic receptor (Alpha-2B adrenoreceptor)
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 446
|
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
|
MAMIPDITCLSGPRVNLNISFTFGPTPCNQTVLRTAPYSPEATALFATAITLMMILTIVGNILVIIAVLTSRSLRGPQNLFLVSLAAADILVATLIIPFSLANELQGYWAFRSLWCEIYLALDVLFCTSSIAHLCAISLDRYLSISRPVSYGAQRTPARIKAAIVVVWLLSAAISFPPLLSLDKSEGGVEVCELNNERWYILYSTIGSFFAPCLIMIGVYIKIYQIAKQHTRCPPGEKPNLNTTPGNAQLQHNRGEGGKADGQSKNAVPSKSLPVSSPSSPPPQSETQAKTPTGPQIEPQPQTQPSSPTSRQRNTTNDDSFSSGSEAEAEMSGKRKGWEGTGQPGKAQVTPMSRRKAMVNREKRFTFVLAVVIGVFVICWFPFFFSYSLQAICPETCTLPDPLFKFFFWIGYCNSCLNPVIYTIFNQDFRKAFKKILCRDTKGTNF
|
[
"GO:0051716",
"GO:0051602",
"GO:0009628",
"GO:0009987",
"GO:0051952",
"GO:0065007",
"GO:0023052",
"GO:1903530",
"GO:0032811",
"GO:0033604",
"GO:0051046",
"GO:0051049",
"GO:0051051",
"GO:0008150",
"GO:0071875",
"GO:0050896",
"GO:0050789",
"GO:0014060",
"GO:0051953",
"GO:0050433",
"GO:0048523",
"GO:0048519",
"GO:0007186",
"GO:0051048",
"GO:0032879",
"GO:1903531",
"GO:0007154",
"GO:0007165",
"GO:0050794"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0023052",
"GO:0050896",
"GO:0050789",
"GO:0048519",
"GO:0051716",
"GO:0009628",
"GO:0051051",
"GO:0048523",
"GO:0032879",
"GO:0007154",
"GO:0007165",
"GO:0050794",
"GO:0051602",
"GO:1903530",
"GO:0051049",
"GO:0051953",
"GO:0007186",
"GO:0051048",
"GO:1903531",
"GO:0051952",
"GO:0033604",
"GO:0051046",
"GO:0071875",
"GO:0050433",
"GO:0032811",
"GO:0014060"
] | null | null |
[
"IPR002233",
"IPR000276",
"IPR017452"
] |
af_db/AF-A0A060YDW5-F1-model_v4.cif.gz
|
8022.A0A060YDW5
|
[
"8022.A0A060W8V2",
"8022.A0A060XRQ9",
"8022.A0A060ZAK0",
"8022.A0A060X2G9",
"8022.A0A060WXC1",
"8022.A0A060XC17",
"8022.A0A060XVD9",
"8022.A0A060VPZ9",
"8022.A0A060WL89",
"8022.A0A060WVZ9",
"8022.A0A060YP44",
"8022.A0A060XN60",
"8022.A0A060Y1H7",
"8022.C1BH40",
"8022.A0A060Z6I0",
"8022.A0A060Z6E2",
"8022.A0A060Z1D1",
"8022.A0A060XPS3",
"8022.A0A060WEW9",
"8022.A0A060WMN1",
"8022.A0A060WGC3",
"8022.A0A060WHA4",
"8022.A0A060Y8H5",
"8022.Q7SZV5",
"8022.A0A060Y2Z0",
"8022.A0A060XSB8",
"8022.A0A060YR57"
] |
[
{
"protein2": "8022.A0A060W8V2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 608,
"textmining": 0,
"combined_score": 736
},
{
"protein2": "8022.A0A060XRQ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060ZAK0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 89,
"combined_score": 751
},
{
"protein2": "8022.A0A060X2G9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060WXC1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060XC17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 571,
"textmining": 0,
"combined_score": 708
},
{
"protein2": "8022.A0A060XVD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 291,
"database": 783,
"textmining": 0,
"combined_score": 839
},
{
"protein2": "8022.A0A060VPZ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 572,
"textmining": 0,
"combined_score": 709
},
{
"protein2": "8022.A0A060WL89",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060WVZ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060YP44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 523,
"textmining": 88,
"combined_score": 716
},
{
"protein2": "8022.A0A060XN60",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 572,
"textmining": 0,
"combined_score": 709
},
{
"protein2": "8022.A0A060Y1H7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.C1BH40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 626,
"database": 567,
"textmining": 0,
"combined_score": 833
},
{
"protein2": "8022.A0A060Z6I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 523,
"textmining": 88,
"combined_score": 716
},
{
"protein2": "8022.A0A060Z6E2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060Z1D1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 626,
"database": 567,
"textmining": 0,
"combined_score": 833
},
{
"protein2": "8022.A0A060XPS3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060WEW9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060WMN1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060WGC3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060WHA4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 155,
"experimental": 267,
"database": 571,
"textmining": 86,
"combined_score": 724
},
{
"protein2": "8022.A0A060Y8H5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 608,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.Q7SZV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 387,
"database": 568,
"textmining": 86,
"combined_score": 736
},
{
"protein2": "8022.A0A060Y2Z0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060XSB8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060YR57",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
}
] |
A0A060YJC3
|
Sodium/potassium-transporting ATPase subunit alpha
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 992
|
Cell membrane, sarcolemma {ECO:0000256|ARBA:ARBA00004415}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004415}. Cell membrane {ECO:0000256|RuleBase:RU362084}; Multi-pass membrane protein {ECO:0000256|RuleBase:RU362084}.
|
MDELKKEVDLDDHKLTLDELNRKYGTDLSKGLSSAKAAENLARDGPNSLTPPPTTPEWVKFCKQMFGGFSMLLWTGALLCFLAYGIQAAMEDEPANDNLYLGVVLSAVVIVTGCFSYYQEAKSSKIMDSFKNLVPQQALVVRDGEKMNINAQQVVVGDLVEVKGGDRIPADLRIISASGCKVDNSSLTGESEPQTRTPDYSNDNPLETRNIAFFSTNCVEGTARGIVINTGDRTVMGRIATLASGLEVGRTPISIEIEHFIHIITGVAVFLGMSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGTSFDRSSATWAALARVAGLCNRAVFLAEQSGIPILKRDVAGDASESALLKCIELCCGSVQGMRDQYTKVAEIPFNSTNKYQLSVHLNKNEGESKHLLVMKGAPERILDRCSTILIQGKEQPLDDEMKDSFQNAYMELGGLGERVLGFCHFQLPDDQFAEGFQFDCEEVNFPTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNEVDPRDAKACVVHGGDLKDLSAEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSKTDKLVNERLISIAYGQIGMIQALAGFFTYFVILAENGFLPSRLLGIRVDWDNKFCNDLEDSYGQQWTYEQRKIVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMRNKILIFGLFEETALAAFLSYCPGMGIALRMYPLKPSWWFCAFPYSLLIFIYDEIRKLIIRRSPGGWVERETYY
|
[
"GO:0006970",
"GO:0043434",
"GO:1901652",
"GO:0009628",
"GO:1901700",
"GO:0009651",
"GO:0006950",
"GO:0008150",
"GO:0042538",
"GO:0042221",
"GO:0010243",
"GO:0050896",
"GO:1901698",
"GO:0010033",
"GO:0009725",
"GO:0060416",
"GO:0009719",
"GO:0006972",
"GO:0015399",
"GO:0008556",
"GO:0008554",
"GO:0015079",
"GO:0140358",
"GO:0022890",
"GO:0005215",
"GO:0015662",
"GO:1901702",
"GO:0022853",
"GO:0042626",
"GO:0015075",
"GO:0005391",
"GO:0022857",
"GO:0015318",
"GO:0008324",
"GO:0140657",
"GO:0046873",
"GO:0015081",
"GO:0003674",
"GO:0019829",
"GO:0022804"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0009628",
"GO:0006950",
"GO:0042221",
"GO:0009719",
"GO:0006970",
"GO:1901700",
"GO:1901698",
"GO:0010033",
"GO:0009725",
"GO:0043434",
"GO:1901652",
"GO:0009651",
"GO:0010243",
"GO:0006972",
"GO:0042538",
"GO:0060416"
] |
[
"GO:0003674",
"GO:0005215",
"GO:0140657",
"GO:0042626",
"GO:0022857",
"GO:0140358",
"GO:1901702",
"GO:0015075",
"GO:0015318",
"GO:0019829",
"GO:0022804",
"GO:0015399",
"GO:0008556",
"GO:0008554",
"GO:0015079",
"GO:0022890",
"GO:0015662",
"GO:0022853",
"GO:0008324",
"GO:0015081",
"GO:0005391",
"GO:0046873"
] | null |
[
"IPR006068",
"IPR004014",
"IPR023299",
"IPR018303",
"IPR023298",
"IPR008250",
"IPR050510",
"IPR036412",
"IPR023214",
"IPR005775",
"IPR001757",
"IPR044492"
] |
af_db/AF-A0A060YJC3-F1-model_v4.cif.gz
|
8022.A0A060YJC3
|
[
"8022.A0A060XM52",
"8022.A0A060YFB0",
"8022.A0A060YI40",
"8022.A0A060WZD8",
"8022.A0A060VYP9",
"8022.A0A060YEQ6",
"8022.A0A060XCM7",
"8022.A0A060ZIV0",
"8022.A0A060VMX9",
"8022.A0A060VV08",
"8022.A0A060XUR5",
"8022.A0A060W616",
"8022.A0A060YU43",
"8022.A0A060WM21",
"8022.A0A060W5G5",
"8022.A0A060YXW3",
"8022.A0A060Z8B0",
"8022.A0A060XAY3",
"8022.A0A060Y7Y8",
"8022.A0A060XKC6",
"8022.A0A060X014",
"8022.A0A060Z640",
"8022.A0A060ZL40",
"8022.A0A060YM41",
"8022.A0A060Y1F8",
"8022.A0A061AEV5",
"8022.A0A060WA02",
"8022.A0A060XVJ2",
"8022.A0A060YYE6",
"8022.A0A060Z2N8"
] |
[
{
"protein2": "8022.A0A060XM52",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060YFB0",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A060YI40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 750
},
{
"protein2": "8022.A0A060WZD8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 660,
"database": 451,
"textmining": 88,
"combined_score": 814
},
{
"protein2": "8022.A0A060VYP9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 614,
"database": 510,
"textmining": 198,
"combined_score": 835
},
{
"protein2": "8022.A0A060YEQ6",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A060XCM7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 788,
"textmining": 156,
"combined_score": 907
},
{
"protein2": "8022.A0A060ZIV0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 681,
"database": 569,
"textmining": 144,
"combined_score": 876
},
{
"protein2": "8022.A0A060VMX9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 574,
"textmining": 120,
"combined_score": 807
},
{
"protein2": "8022.A0A060VV08",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 783,
"textmining": 86,
"combined_score": 795
},
{
"protein2": "8022.A0A060XUR5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060W616",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 574,
"textmining": 108,
"combined_score": 804
},
{
"protein2": "8022.A0A060YU43",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060WM21",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 574,
"textmining": 108,
"combined_score": 804
},
{
"protein2": "8022.A0A060W5G5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 574,
"textmining": 108,
"combined_score": 804
},
{
"protein2": "8022.A0A060YXW3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060Z8B0",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A060XAY3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 719,
"textmining": 99,
"combined_score": 869
},
{
"protein2": "8022.A0A060Y7Y8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 699,
"database": 671,
"textmining": 178,
"combined_score": 913
},
{
"protein2": "8022.A0A060XKC6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060X014",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 719,
"textmining": 99,
"combined_score": 869
},
{
"protein2": "8022.A0A060Z640",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060ZL40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 681,
"database": 569,
"textmining": 144,
"combined_score": 876
},
{
"protein2": "8022.A0A060YM41",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A060Y1F8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 750
},
{
"protein2": "8022.A0A061AEV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 699,
"database": 671,
"textmining": 178,
"combined_score": 913
},
{
"protein2": "8022.A0A060WA02",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 764,
"textmining": 86,
"combined_score": 777
},
{
"protein2": "8022.A0A060XVJ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 783,
"textmining": 86,
"combined_score": 795
},
{
"protein2": "8022.A0A060YYE6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 699,
"database": 671,
"textmining": 178,
"combined_score": 913
},
{
"protein2": "8022.A0A060Z2N8",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
}
] |
A0A060D9G1
|
Sodium/potassium-transporting ATPase subunit alpha
| null |
Salmo salar (Atlantic salmon)
| 876
|
Cell membrane {ECO:0000256|RuleBase:RU362084}; Multi-pass membrane protein {ECO:0000256|RuleBase:RU362084}. Membrane {ECO:0000256|ARBA:ARBA00004141}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004141}.
|
KQLFGGFCMLLWIGAVLCFMAHIIQVTSEEEPTNANLYLGLVLAVVVIITGCFSYYQEAKSSKIMDSFKNLVPQQALVVRDGEKKNINTEEVVVGDIVEVKGGDRIPADLRIISASGCKVDNSSLTGESEPQTRSPDFSNDNPLETRNIAFFSTNCVEGTARGIVINTGDHTIMGRIAALAMSLESGQTPLGIEIDHFIEIITGVSVFFGLTFLILSVILGYGWLPSIIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHDADTTENQSGTSFDKSSATWAALARVAGLCNRAVFLAEQNNVPILKRDVAGDASETALLKCIELCCGSVKDMREKYNKVVEIPFNSTNKYQLSIHENNMAGESNHLLVMKGAPERILDSCSTILLQGKEHPLDDEIKESFQKAYEELGGLGERVLGFSHFQLPDDQFPEGFDFDCEDVNFPTENLCFVGLMSMIDPPRAAVPDAVSKCRCAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEEIAARLKIPVSEVNPRDAKACVVHGGELKDMTAEELDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALRKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSITYTLSSKIPEMTPFLFLLLANIPLALGTVTILCIDLGTDMIPAISLAYEQAENDIMKRQPRNPKTDRLVNERLISVAYGQFGVMLAAAGFFTYFVIMAENGFYPMDLLGIRLDWENQYINDLEDSYGQQWTYESRKIIEFTCHTAYFAAVVIAQWAVLIVCKTRKNSFFQQGLMKNRVLIFGLCSESALALFL
|
[
"GO:0006970",
"GO:0050896",
"GO:0009628",
"GO:0009651",
"GO:0006950",
"GO:0008150",
"GO:0042538",
"GO:0006972",
"GO:0045178",
"GO:0009925",
"GO:0110165",
"GO:0016323",
"GO:0098590",
"GO:0071944",
"GO:0005575",
"GO:0016020",
"GO:0005886",
"GO:0015399",
"GO:0008556",
"GO:0008554",
"GO:0015079",
"GO:0140358",
"GO:0022890",
"GO:0005215",
"GO:0015662",
"GO:1901702",
"GO:0022853",
"GO:0042626",
"GO:0015075",
"GO:0005391",
"GO:0022857",
"GO:0015318",
"GO:0008324",
"GO:0140657",
"GO:0046873",
"GO:0015081",
"GO:0003674",
"GO:0019829",
"GO:0022804"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0009628",
"GO:0006950",
"GO:0006970",
"GO:0009651",
"GO:0006972",
"GO:0042538"
] |
[
"GO:0003674",
"GO:0005215",
"GO:0140657",
"GO:0042626",
"GO:0022857",
"GO:0140358",
"GO:1901702",
"GO:0015075",
"GO:0015318",
"GO:0019829",
"GO:0022804",
"GO:0015399",
"GO:0008556",
"GO:0008554",
"GO:0015079",
"GO:0022890",
"GO:0015662",
"GO:0022853",
"GO:0008324",
"GO:0015081",
"GO:0005391",
"GO:0046873"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0045178",
"GO:0071944",
"GO:0016020",
"GO:0009925",
"GO:0098590",
"GO:0005886",
"GO:0016323"
] |
[
"IPR006068",
"IPR023299",
"IPR018303",
"IPR023298",
"IPR008250",
"IPR050510",
"IPR036412",
"IPR023214",
"IPR005775",
"IPR001757",
"IPR044492"
] |
af_db/AF-A0A060D9G1-F1-model_v4.cif.gz
| null | null | null |
A0A060W6G8
|
Alpha-2A adrenergic receptor (Alpha-2A adrenoreceptor)
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 390
|
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
|
MGCDNLTNSNGTLPARLPYTVQTSVPLTILVGILILLTVFGNVLVVIAVFTSRALRAPQNLFLVSLACADILVATLVMPFSLANELMGYWYFGQVWCEIYLALDVLFCTSSITHLCAISLDRYWSVTQAIEYNSKRTPRRIKCIVLFVWVLAAIISFPPLISMEKEGAKEEGPTCKINEEKWYIIFSSTASFFAPCVIMILVYVRIYQVAKKRTRAPTGERRRENNNPEKRNKRGRDGVEEDAEVNGLNMEEECSSSDGNENQCSIKMKRSKEKTKVCQVKLAEPSPKGDDAQQYVKVSRWKGRQNREKRFTFVLAVVMGVFVVCWFPFFFTYTLTAICDSCCVPESLFNFFFWFGYCNSSLNPVIYTIFNNDFRRSFKKILCKRDRRGL
|
[
"GO:0051716",
"GO:0051602",
"GO:0009628",
"GO:0009987",
"GO:0051952",
"GO:0065007",
"GO:0023052",
"GO:1903530",
"GO:0032811",
"GO:0033604",
"GO:0051046",
"GO:0051049",
"GO:0051051",
"GO:0008150",
"GO:0071875",
"GO:0050896",
"GO:0050789",
"GO:0014060",
"GO:0051953",
"GO:0050433",
"GO:0048523",
"GO:0048519",
"GO:0007186",
"GO:0051048",
"GO:0032879",
"GO:1903531",
"GO:0007154",
"GO:0007165",
"GO:0050794"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0023052",
"GO:0050896",
"GO:0050789",
"GO:0048519",
"GO:0051716",
"GO:0009628",
"GO:0051051",
"GO:0048523",
"GO:0032879",
"GO:0007154",
"GO:0007165",
"GO:0050794",
"GO:0051602",
"GO:1903530",
"GO:0051049",
"GO:0051953",
"GO:0007186",
"GO:0051048",
"GO:1903531",
"GO:0051952",
"GO:0033604",
"GO:0051046",
"GO:0071875",
"GO:0050433",
"GO:0032811",
"GO:0014060"
] | null | null |
[
"IPR002233",
"IPR000276",
"IPR017452"
] |
af_db/AF-A0A060W6G8-F1-model_v4.cif.gz
|
8022.A0A060W6G8
|
[
"8022.A0A060WEW9",
"8022.A0A060Z1D1",
"8022.A0A060Z6E2",
"8022.A0A060Z6I0",
"8022.C1BH40",
"8022.A0A060YR57",
"8022.A0A060Y2Z0",
"8022.Q7SZV5",
"8022.A0A060Y8H5",
"8022.A0A060WHA4",
"8022.A0A060XVD9",
"8022.A0A060XC17",
"8022.A0A060ZAK0",
"8022.A0A060W8V2",
"8022.A0A060YP44",
"8022.A0A060WL89"
] |
[
{
"protein2": "8022.A0A060WEW9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 579,
"textmining": 0,
"combined_score": 716
},
{
"protein2": "8022.A0A060Z1D1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 626,
"database": 523,
"textmining": 0,
"combined_score": 816
},
{
"protein2": "8022.A0A060Z6E2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 579,
"textmining": 0,
"combined_score": 716
},
{
"protein2": "8022.A0A060Z6I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 523,
"textmining": 88,
"combined_score": 716
},
{
"protein2": "8022.C1BH40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 626,
"database": 523,
"textmining": 0,
"combined_score": 816
},
{
"protein2": "8022.A0A060YR57",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 579,
"textmining": 0,
"combined_score": 716
},
{
"protein2": "8022.A0A060Y2Z0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 579,
"textmining": 0,
"combined_score": 716
},
{
"protein2": "8022.Q7SZV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 387,
"database": 568,
"textmining": 86,
"combined_score": 736
},
{
"protein2": "8022.A0A060Y8H5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 596,
"textmining": 0,
"combined_score": 725
},
{
"protein2": "8022.A0A060WHA4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 149,
"experimental": 267,
"database": 571,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060XVD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 291,
"database": 783,
"textmining": 0,
"combined_score": 839
},
{
"protein2": "8022.A0A060XC17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 571,
"textmining": 0,
"combined_score": 708
},
{
"protein2": "8022.A0A060ZAK0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 89,
"combined_score": 751
},
{
"protein2": "8022.A0A060W8V2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 596,
"textmining": 0,
"combined_score": 728
},
{
"protein2": "8022.A0A060YP44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 523,
"textmining": 88,
"combined_score": 716
},
{
"protein2": "8022.A0A060WL89",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 579,
"textmining": 0,
"combined_score": 716
}
] |
A0A060WT98
|
Chemokine interleukin-8-like domain-containing protein
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 95
|
Secreted {ECO:0000256|ARBA:ARBA00004613}.
|
MSIRMSASLVVVLLALLTITEGMSLRGMGADLRCRCIETESRRIGKLIKKVEMFPPSSHCRDTEIIATLSKSGQEICLDVSAPWVKKVIEKMLAK
|
[
"GO:0009743",
"GO:0065007",
"GO:0032928",
"GO:0048518",
"GO:0048870",
"GO:0008150",
"GO:0006954",
"GO:0042221",
"GO:2000145",
"GO:0002523",
"GO:2000377",
"GO:0050896",
"GO:0002685",
"GO:0050900",
"GO:0050789",
"GO:0031325",
"GO:0019222",
"GO:0032930",
"GO:0040017",
"GO:0090322",
"GO:0002684",
"GO:0050794",
"GO:0006952",
"GO:0009893",
"GO:0002376",
"GO:0002682",
"GO:0009987",
"GO:0031323",
"GO:0030335",
"GO:1901700",
"GO:0006950",
"GO:0030334",
"GO:1902624",
"GO:2000379",
"GO:1902622",
"GO:0010033",
"GO:2000147",
"GO:0002687",
"GO:0040012",
"GO:0016477",
"GO:0048522",
"GO:0110165",
"GO:0005575",
"GO:0005576",
"GO:0005615"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0048518",
"GO:0050896",
"GO:0050789",
"GO:0002376",
"GO:0009987",
"GO:0048870",
"GO:0042221",
"GO:0050900",
"GO:0019222",
"GO:0040017",
"GO:0002684",
"GO:0050794",
"GO:0009893",
"GO:0002682",
"GO:0006950",
"GO:0040012",
"GO:0048522",
"GO:2000145",
"GO:0002523",
"GO:0002685",
"GO:0031325",
"GO:0006952",
"GO:0031323",
"GO:1901700",
"GO:0010033",
"GO:2000147",
"GO:0002687",
"GO:0016477",
"GO:0009743",
"GO:0006954",
"GO:2000377",
"GO:0030335",
"GO:0030334",
"GO:1902624",
"GO:2000379",
"GO:1902622",
"GO:0032930",
"GO:0090322",
"GO:0032928"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005576",
"GO:0005615"
] |
[
"IPR039809",
"IPR001089",
"IPR001811",
"IPR033899",
"IPR036048"
] |
af_db/AF-A0A060WT98-F1-model_v4.cif.gz
|
8022.A0A060WT98
|
[
"8022.A0A060VUU9",
"8022.A0A060Y0D9",
"8022.A0A060X5F3",
"8022.A0A060WB80",
"8022.A0A060W8I0",
"8022.A0A060WDY2",
"8022.A0A060X035",
"8022.A0A060VW55",
"8022.A0A060WQ51",
"8022.Q64IC2",
"8022.A0A060XGQ8",
"8022.A0A060YWY6",
"8022.A0A061A7B1",
"8022.A0A060WZ17",
"8022.A0A060XGI5",
"8022.A0A060Z5E6",
"8022.A0A060XPJ4",
"8022.A0A060WNJ9",
"8022.A0A060ZH67",
"8022.A0A060YC27",
"8022.A0A060VVA1",
"8022.A4F345",
"8022.A0A060WU43",
"8022.A0A060WYC1",
"8022.Q1G669",
"8022.H1ZZ93",
"8022.A0A060WFM4",
"8022.A0A060VTH0",
"8022.A0A060VSL8",
"8022.A0A060Y097",
"8022.A0A060XL04",
"8022.A0A060YGE9",
"8022.H1ZZ96",
"8022.A0A060XKD8",
"8022.A0A060XE26",
"8022.A0A060YA11",
"8022.A0A060VY72",
"8022.A0A060W3U5",
"8022.A0A061A6H0",
"8022.A0A060WPR8",
"8022.A0A060XF12",
"8022.A0A060VPX8",
"8022.A0A060WVB6",
"8022.A0A060YAX3",
"8022.A0A060XTS9",
"8022.A0A060Y1V5",
"8022.A0A060YXH5",
"8022.A0A060YBB6",
"8022.A0A060VQU0",
"8022.A0A060XBF3",
"8022.A0A060VZ13",
"8022.A0A060YQ42",
"8022.A0A060X2E2",
"8022.A0A060XZ47",
"8022.A0A060XW82",
"8022.A0A060WCR4",
"8022.A0A060Y453",
"8022.A0A060YBG9"
] |
[
{
"protein2": "8022.A0A060VUU9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 506,
"database": 736,
"textmining": 136,
"combined_score": 888
},
{
"protein2": "8022.A0A060Y0D9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 419,
"textmining": 246,
"combined_score": 718
},
{
"protein2": "8022.A0A060X5F3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 0,
"database": 827,
"textmining": 318,
"combined_score": 878
},
{
"protein2": "8022.A0A060WB80",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 0,
"database": 614,
"textmining": 338,
"combined_score": 739
},
{
"protein2": "8022.A0A060W8I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 44,
"experimental": 0,
"database": 832,
"textmining": 148,
"combined_score": 851
},
{
"protein2": "8022.A0A060WDY2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 816,
"textmining": 73,
"combined_score": 825
},
{
"protein2": "8022.A0A060X035",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 826,
"textmining": 48,
"combined_score": 832
},
{
"protein2": "8022.A0A060VW55",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 789,
"textmining": 87,
"combined_score": 799
},
{
"protein2": "8022.A0A060WQ51",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 179,
"database": 831,
"textmining": 493,
"combined_score": 925
},
{
"protein2": "8022.Q64IC2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 419,
"textmining": 274,
"combined_score": 729
},
{
"protein2": "8022.A0A060XGQ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 104,
"experimental": 932,
"database": 609,
"textmining": 375,
"combined_score": 983
},
{
"protein2": "8022.A0A060YWY6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 506,
"database": 736,
"textmining": 136,
"combined_score": 888
},
{
"protein2": "8022.A0A061A7B1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 506,
"database": 736,
"textmining": 136,
"combined_score": 888
},
{
"protein2": "8022.A0A060WZ17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 758,
"database": 736,
"textmining": 183,
"combined_score": 948
},
{
"protein2": "8022.A0A060XGI5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 825,
"textmining": 74,
"combined_score": 855
},
{
"protein2": "8022.A0A060Z5E6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 419,
"textmining": 220,
"combined_score": 709
},
{
"protein2": "8022.A0A060XPJ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 789,
"textmining": 87,
"combined_score": 799
},
{
"protein2": "8022.A0A060WNJ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 115,
"combined_score": 840
},
{
"protein2": "8022.A0A060ZH67",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 87,
"combined_score": 766
},
{
"protein2": "8022.A0A060YC27",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 805,
"textmining": 48,
"combined_score": 811
},
{
"protein2": "8022.A0A060VVA1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 785,
"textmining": 74,
"combined_score": 822
},
{
"protein2": "8022.A4F345",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 308,
"combined_score": 873
},
{
"protein2": "8022.A0A060WU43",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 87,
"combined_score": 766
},
{
"protein2": "8022.A0A060WYC1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 826,
"textmining": 48,
"combined_score": 832
},
{
"protein2": "8022.Q1G669",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 255,
"experimental": 918,
"database": 832,
"textmining": 453,
"combined_score": 993
},
{
"protein2": "8022.H1ZZ93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 104,
"experimental": 932,
"database": 609,
"textmining": 375,
"combined_score": 983
},
{
"protein2": "8022.A0A060WFM4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 789,
"textmining": 87,
"combined_score": 799
},
{
"protein2": "8022.A0A060VTH0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 893,
"database": 0,
"textmining": 177,
"combined_score": 908
},
{
"protein2": "8022.A0A060VSL8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 0,
"database": 827,
"textmining": 389,
"combined_score": 893
},
{
"protein2": "8022.A0A060Y097",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 419,
"textmining": 246,
"combined_score": 718
},
{
"protein2": "8022.A0A060XL04",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 439,
"textmining": 297,
"combined_score": 746
},
{
"protein2": "8022.A0A060YGE9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 87,
"combined_score": 766
},
{
"protein2": "8022.H1ZZ96",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 893,
"database": 0,
"textmining": 177,
"combined_score": 908
},
{
"protein2": "8022.A0A060XKD8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 233,
"database": 736,
"textmining": 125,
"combined_score": 807
},
{
"protein2": "8022.A0A060XE26",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 789,
"textmining": 87,
"combined_score": 799
},
{
"protein2": "8022.A0A060YA11",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 439,
"textmining": 220,
"combined_score": 719
},
{
"protein2": "8022.A0A060VY72",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 805,
"textmining": 48,
"combined_score": 811
},
{
"protein2": "8022.A0A060W3U5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 827,
"textmining": 111,
"combined_score": 841
},
{
"protein2": "8022.A0A061A6H0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 506,
"database": 736,
"textmining": 136,
"combined_score": 888
},
{
"protein2": "8022.A0A060WPR8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 43,
"experimental": 0,
"database": 826,
"textmining": 59,
"combined_score": 829
},
{
"protein2": "8022.A0A060XF12",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 87,
"combined_score": 824
},
{
"protein2": "8022.A0A060VPX8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 179,
"database": 827,
"textmining": 429,
"combined_score": 913
},
{
"protein2": "8022.A0A060WVB6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 932,
"database": 736,
"textmining": 186,
"combined_score": 985
},
{
"protein2": "8022.A0A060YAX3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 825,
"textmining": 74,
"combined_score": 855
},
{
"protein2": "8022.A0A060XTS9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 785,
"textmining": 74,
"combined_score": 822
},
{
"protein2": "8022.A0A060Y1V5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 179,
"database": 827,
"textmining": 429,
"combined_score": 913
},
{
"protein2": "8022.A0A060YXH5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 179,
"database": 827,
"textmining": 422,
"combined_score": 912
},
{
"protein2": "8022.A0A060YBB6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 702,
"database": 419,
"textmining": 220,
"combined_score": 857
},
{
"protein2": "8022.A0A060VQU0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 0,
"database": 827,
"textmining": 389,
"combined_score": 893
},
{
"protein2": "8022.A0A060XBF3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 827,
"textmining": 111,
"combined_score": 841
},
{
"protein2": "8022.A0A060VZ13",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 0,
"database": 827,
"textmining": 126,
"combined_score": 844
},
{
"protein2": "8022.A0A060YQ42",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 816,
"textmining": 75,
"combined_score": 825
},
{
"protein2": "8022.A0A060X2E2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 115,
"combined_score": 840
},
{
"protein2": "8022.A0A060XZ47",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 825,
"textmining": 74,
"combined_score": 855
},
{
"protein2": "8022.A0A060XW82",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 43,
"experimental": 0,
"database": 826,
"textmining": 59,
"combined_score": 829
},
{
"protein2": "8022.A0A060WCR4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 0,
"database": 827,
"textmining": 318,
"combined_score": 878
},
{
"protein2": "8022.A0A060Y453",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 233,
"database": 736,
"textmining": 125,
"combined_score": 807
},
{
"protein2": "8022.A0A060YBG9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 0,
"database": 827,
"textmining": 126,
"combined_score": 844
}
] |
A0A060Y8H0
|
Fructose-1,6-bisphosphatase 1 (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 1) (Liver FBPase)
|
Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations, acting as a rate-limiting enzyme in gluconeogenesis. Plays a role in regulating glucose sensing and insulin secretion of pancreatic beta-cells. Appears to modulate glycerol gluconeogenesis in liver. Important regulator of appetite and adiposity; increased expression of the protein in liver after nutrient excess increases circulating satiety hormones and reduces appetite-stimulating neuropeptides and thus seems to provide a feedback mechanism to limit weight gain. {ECO:0000256|ARBA:ARBA00037308}.
|
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 337
| null |
MSDRGSFDTNVVTLTRFVLEEGRKAKGTGELTTLLNSICTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDVLSNDLVINMIKSSFTSCVLVSEEDERALIVEPEKQGKYIVCFDPLDGSSNIDCLVSIGTIFAIYRKTTDDEPNEKDALQSGRHIVAAGYALYGSATMMVLSTGQGVNCFMLDPSIGEFILTDKDVKIKKRGKIYSLNEGYAQHFYPDVTEYLKKKKYPEDGSAPYGGRYVGSMVADVHRTLVYGGIFLYPANVKSPKGKLRLLYECNPMSFIIEQAGGMATTGEMNVLDIQPENIHQRVPVVLGSPEDVQEYIAIYKKTRM
|
[
"GO:0050896",
"GO:0009743",
"GO:0010033",
"GO:1901700",
"GO:0034284",
"GO:0009749",
"GO:0008150",
"GO:0042221",
"GO:0009746",
"GO:0019203",
"GO:0042578",
"GO:0042132",
"GO:0003824",
"GO:0016788",
"GO:0003674",
"GO:0016791",
"GO:0050308",
"GO:0016787"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0042221",
"GO:0010033",
"GO:1901700",
"GO:0009743",
"GO:0034284",
"GO:0009746",
"GO:0009749"
] |
[
"GO:0003674",
"GO:0003824",
"GO:0016787",
"GO:0016788",
"GO:0042578",
"GO:0016791",
"GO:0019203",
"GO:0050308",
"GO:0042132"
] | null |
[
"IPR044015",
"IPR000146",
"IPR033391",
"IPR028343",
"IPR020548"
] |
af_db/AF-A0A060Y8H0-F1-model_v4.cif.gz
|
8022.A0A060Y8H0
|
[
"8022.A0A060WUD2",
"8022.A0A060Z1V4",
"8022.A0A060WKL9",
"8022.A0A060YVQ1",
"8022.A0A060WN66",
"8022.A0A060X451",
"8022.A0A060Z1R4",
"8022.A0A060W1Q7",
"8022.A0A060YVM5",
"8022.A0A060WTE4",
"8022.A0A060XV20",
"8022.A0A060Z9H8",
"8022.A0A060Y149",
"8022.A0A060XRV8",
"8022.A0A060VNK8",
"8022.A0A060XPQ5",
"8022.A0A060Z2V0",
"8022.A0A060Z5H7",
"8022.A0A060VPR7",
"8022.A0A060VMK2",
"8022.A0A060YHN8",
"8022.A0A060WHT6",
"8022.A0A060WEA8",
"8022.A0A060X554",
"8022.A0A060WTT7",
"8022.A0A060XDI7",
"8022.A0A060Z2Q3",
"8022.A0A060VNR1",
"8022.A0A060Y572",
"8022.A0A060XQD6",
"8022.A0A060Y0E2",
"8022.A0A060WKY9",
"8022.A0A060VU68",
"8022.A0A060Y5A1",
"8022.A0A060Z8Y1",
"8022.A0A060XH89",
"8022.A0A060WBE2",
"8022.A0A060YAU7",
"8022.A0A060W078",
"8022.A0A060VXB7",
"8022.A0A060VVS9",
"8022.A0A060XXJ7",
"8022.A0A060VPT7",
"8022.A0A060VTT5",
"8022.A0A060VW41",
"8022.A0A060YIV6",
"8022.A0A060Z666",
"8022.A0A060X0C8",
"8022.A0A060XP04",
"8022.A0A060YAR4",
"8022.A0A060VZM1",
"8022.A0A060YS35",
"8022.A0A060Y974",
"8022.A0A060Y6E6",
"8022.A0A060XD08",
"8022.A0A060X6L1",
"8022.A0A060X6R6",
"8022.A0A060XIP8",
"8022.A0A060Y2F6",
"8022.A0A060XFI2",
"8022.A0A060YAI9",
"8022.A0A060WDZ2",
"8022.A0A060WWX4",
"8022.A0A060VUG3",
"8022.A0A060YIC2",
"8022.A0A060YDE0",
"8022.A0A060X7X1",
"8022.A0A060Z098",
"8022.A0A060XE19",
"8022.A0A060YQT4",
"8022.A0A060WET7",
"8022.A0A060XQL0",
"8022.A0A060Z973",
"8022.A0A060Z8F9",
"8022.A0A060Y6U5",
"8022.A0A060YW82",
"8022.A0A060YYC4",
"8022.A0A060XHN5",
"8022.A0A060WN41",
"8022.A0A060WAF6",
"8022.A0A060WBT3",
"8022.A0A060WHB9",
"8022.A0A060VVL9",
"8022.A0A060X8A4",
"8022.A0A060WPX1",
"8022.A0A060X816",
"8022.A0A060WVQ0",
"8022.A0A060X6V3",
"8022.A0A060ZPA8",
"8022.A0A060VVZ9",
"8022.A0A060Y9T0",
"8022.A0A060VXR5",
"8022.A0A060X1J6",
"8022.A0A060X807",
"8022.A0A060XVB1",
"8022.A0A060YK26",
"8022.A0A060YGA7",
"8022.A0A060YKK6",
"8022.A0A060W458",
"8022.A0A060XBK0",
"8022.A0A060YV08",
"8022.A0A060W0T4",
"8022.A0A060XEX5",
"8022.A0A060XY35",
"8022.A0A060VZK5",
"8022.A0A060WV84",
"8022.A0A060XTV2",
"8022.A0A060Y7I6",
"8022.A0A060X2I1",
"8022.A0A060W147",
"8022.A0A060XFS1",
"8022.A0A060XZ30",
"8022.A0A060YFA3",
"8022.A0A060ZB08",
"8022.A0A060ZAC2",
"8022.A0A060Y3Q3",
"8022.A0A060WUI1",
"8022.A0A060YLD3",
"8022.A0A060WBZ8",
"8022.A0A060X1D5",
"8022.A0A060W2P0",
"8022.A0A060X567",
"8022.A0A060YEC4",
"8022.A0A060XB28",
"8022.A0A060X323",
"8022.A0A060VVE5",
"8022.A0A060VYV2",
"8022.A0A060X0T4",
"8022.A0A060XEE3",
"8022.A0A060Z6C0",
"8022.A0A060X7Z0",
"8022.A0A060X7A0",
"8022.A0A060YTU9",
"8022.A0A060YSX6",
"8022.A0A060W9M9",
"8022.A0A060YVM7",
"8022.A0A060YZW8",
"8022.A0A060Z7Y7",
"8022.A0A060X3G2",
"8022.A0A060YBF1",
"8022.A0A060XQG3",
"8022.A0A060WD05",
"8022.A0A060ZEY9",
"8022.A0A060YKF3",
"8022.A0A060XNA5",
"8022.A0A060WZJ0",
"8022.A0A060VWF5",
"8022.A0A060Y609",
"8022.A0A060WDJ5",
"8022.A0A060X713",
"8022.A0A060W743",
"8022.A0A060Y3N4",
"8022.A0A060Y1A1",
"8022.A0A060WI24",
"8022.A0A060WFB8",
"8022.A0A060X7J3",
"8022.A0A060WV51",
"8022.A0A060Z2J6"
] |
[
{
"protein2": "8022.A0A060WUD2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 785,
"textmining": 0,
"combined_score": 787
},
{
"protein2": "8022.A0A060Z1V4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 783,
"textmining": 199,
"combined_score": 818
},
{
"protein2": "8022.A0A060WKL9",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060YVQ1",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060WN66",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 785,
"textmining": 0,
"combined_score": 787
},
{
"protein2": "8022.A0A060X451",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 568,
"textmining": 411,
"combined_score": 738
},
{
"protein2": "8022.A0A060Z1R4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 51,
"experimental": 0,
"database": 736,
"textmining": 123,
"combined_score": 761
},
{
"protein2": "8022.A0A060W1Q7",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 261,
"combined_score": 880
},
{
"protein2": "8022.A0A060YVM5",
"neighborhood": 166,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 841,
"textmining": 451,
"combined_score": 928
},
{
"protein2": "8022.A0A060WTE4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 220,
"combined_score": 788
},
{
"protein2": "8022.A0A060XV20",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 277,
"database": 706,
"textmining": 325,
"combined_score": 861
},
{
"protein2": "8022.A0A060Z9H8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060Y149",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 0,
"database": 736,
"textmining": 123,
"combined_score": 768
},
{
"protein2": "8022.A0A060XRV8",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 137,
"experimental": 0,
"database": 839,
"textmining": 379,
"combined_score": 907
},
{
"protein2": "8022.A0A060VNK8",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 841,
"textmining": 261,
"combined_score": 891
},
{
"protein2": "8022.A0A060XPQ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 715,
"database": 0,
"textmining": 326,
"combined_score": 799
},
{
"protein2": "8022.A0A060Z2V0",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 825,
"textmining": 186,
"combined_score": 856
},
{
"protein2": "8022.A0A060Z5H7",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060VPR7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 220,
"combined_score": 788
},
{
"protein2": "8022.A0A060VMK2",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 862,
"textmining": 308,
"combined_score": 942
},
{
"protein2": "8022.A0A060YHN8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 839,
"textmining": 225,
"combined_score": 881
},
{
"protein2": "8022.A0A060WHT6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 80,
"experimental": 0,
"database": 670,
"textmining": 309,
"combined_score": 771
},
{
"protein2": "8022.A0A060WEA8",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 137,
"experimental": 0,
"database": 816,
"textmining": 379,
"combined_score": 893
},
{
"protein2": "8022.A0A060X554",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 568,
"textmining": 411,
"combined_score": 738
},
{
"protein2": "8022.A0A060WTT7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 785,
"textmining": 0,
"combined_score": 787
},
{
"protein2": "8022.A0A060XDI7",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 825,
"textmining": 186,
"combined_score": 856
},
{
"protein2": "8022.A0A060Z2Q3",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060VNR1",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 825,
"textmining": 186,
"combined_score": 856
},
{
"protein2": "8022.A0A060Y572",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 137,
"experimental": 0,
"database": 839,
"textmining": 379,
"combined_score": 907
},
{
"protein2": "8022.A0A060XQD6",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060Y0E2",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060WKY9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 738,
"database": 0,
"textmining": 338,
"combined_score": 819
},
{
"protein2": "8022.A0A060VU68",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 352,
"combined_score": 875
},
{
"protein2": "8022.A0A060Y5A1",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060Z8Y1",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 839,
"textmining": 308,
"combined_score": 932
},
{
"protein2": "8022.A0A060XH89",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 715,
"database": 0,
"textmining": 326,
"combined_score": 799
},
{
"protein2": "8022.A0A060WBE2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 827,
"textmining": 275,
"combined_score": 879
},
{
"protein2": "8022.A0A060YAU7",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 137,
"experimental": 0,
"database": 839,
"textmining": 379,
"combined_score": 907
},
{
"protein2": "8022.A0A060W078",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 738,
"database": 0,
"textmining": 338,
"combined_score": 819
},
{
"protein2": "8022.A0A060VXB7",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 825,
"textmining": 186,
"combined_score": 856
},
{
"protein2": "8022.A0A060VVS9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 783,
"textmining": 199,
"combined_score": 818
},
{
"protein2": "8022.A0A060XXJ7",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 505,
"combined_score": 810
},
{
"protein2": "8022.A0A060VPT7",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 277,
"database": 706,
"textmining": 325,
"combined_score": 861
},
{
"protein2": "8022.A0A060VTT5",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060VW41",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 75,
"experimental": 0,
"database": 670,
"textmining": 378,
"combined_score": 793
},
{
"protein2": "8022.A0A060YIV6",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 841,
"textmining": 261,
"combined_score": 891
},
{
"protein2": "8022.A0A060Z666",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 816,
"textmining": 186,
"combined_score": 848
},
{
"protein2": "8022.A0A060X0C8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 839,
"textmining": 225,
"combined_score": 881
},
{
"protein2": "8022.A0A060XP04",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 824,
"textmining": 186,
"combined_score": 855
},
{
"protein2": "8022.A0A060YAR4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 75,
"experimental": 0,
"database": 670,
"textmining": 378,
"combined_score": 793
},
{
"protein2": "8022.A0A060VZM1",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060YS35",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 862,
"textmining": 308,
"combined_score": 942
},
{
"protein2": "8022.A0A060Y974",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 816,
"textmining": 186,
"combined_score": 848
},
{
"protein2": "8022.A0A060Y6E6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 830,
"textmining": 44,
"combined_score": 830
},
{
"protein2": "8022.A0A060XD08",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 839,
"textmining": 308,
"combined_score": 932
},
{
"protein2": "8022.A0A060X6L1",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 568,
"textmining": 411,
"combined_score": 738
},
{
"protein2": "8022.A0A060X6R6",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060XIP8",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060Y2F6",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 277,
"database": 706,
"textmining": 325,
"combined_score": 861
},
{
"protein2": "8022.A0A060XFI2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 155,
"database": 816,
"textmining": 0,
"combined_score": 837
},
{
"protein2": "8022.A0A060YAI9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 746,
"database": 0,
"textmining": 309,
"combined_score": 816
},
{
"protein2": "8022.A0A060WDZ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 352,
"combined_score": 875
},
{
"protein2": "8022.A0A060WWX4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 80,
"experimental": 0,
"database": 670,
"textmining": 309,
"combined_score": 771
},
{
"protein2": "8022.A0A060VUG3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 352,
"combined_score": 875
},
{
"protein2": "8022.A0A060YIC2",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 261,
"combined_score": 853
},
{
"protein2": "8022.A0A060YDE0",
"neighborhood": 175,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 0,
"database": 830,
"textmining": 505,
"combined_score": 931
},
{
"protein2": "8022.A0A060X7X1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 841,
"textmining": 225,
"combined_score": 883
},
{
"protein2": "8022.A0A060Z098",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060XE19",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 839,
"textmining": 225,
"combined_score": 881
},
{
"protein2": "8022.A0A060YQT4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 51,
"experimental": 0,
"database": 736,
"textmining": 123,
"combined_score": 761
},
{
"protein2": "8022.A0A060WET7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 153,
"database": 829,
"textmining": 0,
"combined_score": 848
},
{
"protein2": "8022.A0A060XQL0",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 256,
"database": 556,
"textmining": 279,
"combined_score": 751
},
{
"protein2": "8022.A0A060Z973",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 785,
"textmining": 0,
"combined_score": 787
},
{
"protein2": "8022.A0A060Z8F9",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 841,
"textmining": 308,
"combined_score": 933
},
{
"protein2": "8022.A0A060Y6U5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 830,
"textmining": 0,
"combined_score": 845
},
{
"protein2": "8022.A0A060YW82",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 90,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 720
},
{
"protein2": "8022.A0A060YYC4",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 816,
"textmining": 186,
"combined_score": 848
},
{
"protein2": "8022.A0A060XHN5",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 772,
"textmining": 276,
"combined_score": 874
},
{
"protein2": "8022.A0A060WN41",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 836,
"textmining": 225,
"combined_score": 879
},
{
"protein2": "8022.A0A060WAF6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060WBT3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 155,
"database": 816,
"textmining": 0,
"combined_score": 837
},
{
"protein2": "8022.A0A060WHB9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 839,
"textmining": 225,
"combined_score": 881
},
{
"protein2": "8022.A0A060VVL9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 783,
"textmining": 199,
"combined_score": 818
},
{
"protein2": "8022.A0A060X8A4",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060WPX1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 665,
"database": 0,
"textmining": 309,
"combined_score": 758
},
{
"protein2": "8022.A0A060X816",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060WVQ0",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 827,
"textmining": 276,
"combined_score": 904
},
{
"protein2": "8022.A0A060X6V3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 841,
"textmining": 225,
"combined_score": 883
},
{
"protein2": "8022.A0A060ZPA8",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060VVZ9",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 772,
"textmining": 276,
"combined_score": 874
},
{
"protein2": "8022.A0A060Y9T0",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 816,
"textmining": 186,
"combined_score": 848
},
{
"protein2": "8022.A0A060VXR5",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060X1J6",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060X807",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 746,
"database": 0,
"textmining": 309,
"combined_score": 816
},
{
"protein2": "8022.A0A060XVB1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060YK26",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060YGA7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 785,
"textmining": 0,
"combined_score": 787
},
{
"protein2": "8022.A0A060YKK6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 779,
"textmining": 391,
"combined_score": 861
},
{
"protein2": "8022.A0A060W458",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 256,
"database": 556,
"textmining": 279,
"combined_score": 751
},
{
"protein2": "8022.A0A060XBK0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060YV08",
"neighborhood": 166,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 841,
"textmining": 451,
"combined_score": 928
},
{
"protein2": "8022.A0A060W0T4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060XEX5",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 772,
"textmining": 276,
"combined_score": 874
},
{
"protein2": "8022.A0A060XY35",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 839,
"textmining": 308,
"combined_score": 932
},
{
"protein2": "8022.A0A060VZK5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 783,
"textmining": 199,
"combined_score": 818
},
{
"protein2": "8022.A0A060WV84",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 772,
"textmining": 276,
"combined_score": 874
},
{
"protein2": "8022.A0A060XTV2",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 256,
"database": 556,
"textmining": 279,
"combined_score": 751
},
{
"protein2": "8022.A0A060Y7I6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060X2I1",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060W147",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060XFS1",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060XZ30",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 862,
"textmining": 261,
"combined_score": 906
},
{
"protein2": "8022.A0A060YFA3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 0,
"database": 736,
"textmining": 123,
"combined_score": 768
},
{
"protein2": "8022.A0A060ZB08",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 825,
"textmining": 186,
"combined_score": 856
},
{
"protein2": "8022.A0A060ZAC2",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 841,
"textmining": 308,
"combined_score": 933
},
{
"protein2": "8022.A0A060Y3Q3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 665,
"database": 0,
"textmining": 309,
"combined_score": 758
},
{
"protein2": "8022.A0A060WUI1",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 824,
"textmining": 276,
"combined_score": 903
},
{
"protein2": "8022.A0A060YLD3",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 827,
"textmining": 276,
"combined_score": 904
},
{
"protein2": "8022.A0A060WBZ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 862,
"textmining": 225,
"combined_score": 898
},
{
"protein2": "8022.A0A060X1D5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 839,
"textmining": 225,
"combined_score": 881
},
{
"protein2": "8022.A0A060W2P0",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060X567",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 825,
"textmining": 186,
"combined_score": 856
},
{
"protein2": "8022.A0A060YEC4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 665,
"database": 0,
"textmining": 309,
"combined_score": 758
},
{
"protein2": "8022.A0A060XB28",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 660,
"textmining": 276,
"combined_score": 813
},
{
"protein2": "8022.A0A060X323",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 277,
"database": 706,
"textmining": 325,
"combined_score": 861
},
{
"protein2": "8022.A0A060VVE5",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 824,
"textmining": 276,
"combined_score": 903
},
{
"protein2": "8022.A0A060VYV2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 665,
"database": 0,
"textmining": 309,
"combined_score": 758
},
{
"protein2": "8022.A0A060X0T4",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060XEE3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 738,
"database": 0,
"textmining": 338,
"combined_score": 819
},
{
"protein2": "8022.A0A060Z6C0",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 261,
"combined_score": 880
},
{
"protein2": "8022.A0A060X7Z0",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 841,
"textmining": 261,
"combined_score": 891
},
{
"protein2": "8022.A0A060X7A0",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060YTU9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 831,
"textmining": 0,
"combined_score": 832
},
{
"protein2": "8022.A0A060YSX6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 155,
"database": 816,
"textmining": 0,
"combined_score": 837
},
{
"protein2": "8022.A0A060W9M9",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 261,
"combined_score": 880
},
{
"protein2": "8022.A0A060YVM7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 220,
"combined_score": 788
},
{
"protein2": "8022.A0A060YZW8",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 76,
"experimental": 0,
"database": 652,
"textmining": 277,
"combined_score": 750
},
{
"protein2": "8022.A0A060Z7Y7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 839,
"textmining": 225,
"combined_score": 881
},
{
"protein2": "8022.A0A060X3G2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 80,
"experimental": 0,
"database": 670,
"textmining": 309,
"combined_score": 771
},
{
"protein2": "8022.A0A060YBF1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 51,
"experimental": 0,
"database": 736,
"textmining": 123,
"combined_score": 761
},
{
"protein2": "8022.A0A060XQG3",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060WD05",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 827,
"textmining": 275,
"combined_score": 879
},
{
"protein2": "8022.A0A060ZEY9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 0,
"database": 736,
"textmining": 123,
"combined_score": 768
},
{
"protein2": "8022.A0A060YKF3",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 261,
"combined_score": 853
},
{
"protein2": "8022.A0A060XNA5",
"neighborhood": 49,
"fusion": 0,
"cooccurence": 0,
"coexpression": 866,
"experimental": 0,
"database": 0,
"textmining": 519,
"combined_score": 933
},
{
"protein2": "8022.A0A060WZJ0",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 220,
"combined_score": 852
},
{
"protein2": "8022.A0A060VWF5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 75,
"experimental": 0,
"database": 670,
"textmining": 378,
"combined_score": 793
},
{
"protein2": "8022.A0A060Y609",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 220,
"combined_score": 852
},
{
"protein2": "8022.A0A060WDJ5",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 841,
"textmining": 261,
"combined_score": 891
},
{
"protein2": "8022.A0A060X713",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 220,
"combined_score": 852
},
{
"protein2": "8022.A0A060W743",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 839,
"textmining": 366,
"combined_score": 893
},
{
"protein2": "8022.A0A060Y3N4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060Y1A1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 746,
"database": 0,
"textmining": 309,
"combined_score": 816
},
{
"protein2": "8022.A0A060WI24",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 862,
"textmining": 261,
"combined_score": 906
},
{
"protein2": "8022.A0A060WFB8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 832,
"textmining": 225,
"combined_score": 876
},
{
"protein2": "8022.A0A060X7J3",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060WV51",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 836,
"textmining": 225,
"combined_score": 879
},
{
"protein2": "8022.A0A060Z2J6",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
}
] |
A0A060YK73
|
Sodium/potassium-transporting ATPase subunit alpha
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 534
|
Cell membrane {ECO:0000256|RuleBase:RU362084}; Multi-pass membrane protein {ECO:0000256|RuleBase:RU362084}. Membrane {ECO:0000256|ARBA:ARBA00004370}.
|
LSIHKNIVAGESNHLLVMKGAPERILDRCSTILIQGKEQTLNDELKEAFQNAYEELGGLGERVLGFCHFQLPDDQFAEGFQFDCEEVNFPTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLKIPVSEVNPRDAKACVVHGGELKDLSAEQLDDILAHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEEAENDIMKRQPRNPKTDKLVNERLISIAYGQIGMMQATAGFFTYFVILAENGFLPMDLLGMRVDWDNKIMNDMEDSYGQQWTYERRKIVEFTCHTAFFASIVVVQWADLIICKTRRNSILQQGMKNRILIFGLFEETALAVFLSYCPGMDVALRMYPLKPCWWFCALPYSLLIFLYDEGRRYILRRNPGGWVEQETYY
|
[
"GO:0006970",
"GO:0043434",
"GO:1901652",
"GO:0009628",
"GO:1901700",
"GO:0009651",
"GO:0006950",
"GO:0008150",
"GO:0042538",
"GO:0042221",
"GO:0010243",
"GO:0050896",
"GO:1901698",
"GO:0010033",
"GO:0009725",
"GO:0060416",
"GO:0009719",
"GO:0006972",
"GO:0015399",
"GO:0008556",
"GO:0008554",
"GO:0015079",
"GO:0140358",
"GO:0022890",
"GO:0005215",
"GO:0015662",
"GO:1901702",
"GO:0022853",
"GO:0042626",
"GO:0015075",
"GO:0005391",
"GO:0022857",
"GO:0015318",
"GO:0008324",
"GO:0140657",
"GO:0046873",
"GO:0015081",
"GO:0003674",
"GO:0019829",
"GO:0022804"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0009628",
"GO:0006950",
"GO:0042221",
"GO:0009719",
"GO:0006970",
"GO:1901700",
"GO:1901698",
"GO:0010033",
"GO:0009725",
"GO:0043434",
"GO:1901652",
"GO:0009651",
"GO:0010243",
"GO:0006972",
"GO:0042538",
"GO:0060416"
] |
[
"GO:0003674",
"GO:0005215",
"GO:0140657",
"GO:0042626",
"GO:0022857",
"GO:0140358",
"GO:1901702",
"GO:0015075",
"GO:0015318",
"GO:0019829",
"GO:0022804",
"GO:0015399",
"GO:0008556",
"GO:0008554",
"GO:0015079",
"GO:0022890",
"GO:0015662",
"GO:0022853",
"GO:0008324",
"GO:0015081",
"GO:0005391",
"GO:0046873"
] | null |
[
"IPR006068",
"IPR023299",
"IPR023298",
"IPR050510",
"IPR036412",
"IPR023214",
"IPR005775",
"IPR001757"
] |
af_db/AF-A0A060YK73-F1-model_v4.cif.gz
|
8022.A0A060YK73
|
[
"8022.A0A060XCM7",
"8022.A0A060ZIV0",
"8022.A0A060YFB0",
"8022.A0A060XM52",
"8022.A0A060YI40",
"8022.A0A060VYP9",
"8022.A0A060YEQ6",
"8022.A0A060WZD8",
"8022.A0A060VMX9",
"8022.A0A060Z7D4",
"8022.A0A060YU43",
"8022.A0A060ZAX9",
"8022.A0A060VV08",
"8022.A0A060XUR5",
"8022.A0A060W616",
"8022.A0A060Z8B0",
"8022.A0A060YXW3",
"8022.A0A060XAY3",
"8022.A0A060WM21",
"8022.A0A060W5G5",
"8022.A0A060XKC6",
"8022.A0A060X014",
"8022.A0A060Z640",
"8022.A0A060Y7Y8",
"8022.A0A060YM41",
"8022.A0A060ZL40",
"8022.A0A060YJV3",
"8022.A0A060Y1F8",
"8022.A0A060YYE6",
"8022.A0A060XVJ2",
"8022.A0A060VTX4",
"8022.A0A060Z2N8",
"8022.A0A061AEV5",
"8022.A0A060WA02"
] |
[
{
"protein2": "8022.A0A060XCM7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 788,
"textmining": 156,
"combined_score": 907
},
{
"protein2": "8022.A0A060ZIV0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 681,
"database": 569,
"textmining": 144,
"combined_score": 876
},
{
"protein2": "8022.A0A060YFB0",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A060XM52",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060YI40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 750
},
{
"protein2": "8022.A0A060VYP9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 614,
"database": 510,
"textmining": 198,
"combined_score": 835
},
{
"protein2": "8022.A0A060YEQ6",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A060WZD8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 660,
"database": 451,
"textmining": 88,
"combined_score": 814
},
{
"protein2": "8022.A0A060VMX9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 574,
"textmining": 120,
"combined_score": 807
},
{
"protein2": "8022.A0A060Z7D4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 535,
"coexpression": 0,
"experimental": 0,
"database": 586,
"textmining": 0,
"combined_score": 799
},
{
"protein2": "8022.A0A060YU43",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060ZAX9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 533,
"coexpression": 0,
"experimental": 0,
"database": 530,
"textmining": 0,
"combined_score": 771
},
{
"protein2": "8022.A0A060VV08",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 783,
"textmining": 86,
"combined_score": 795
},
{
"protein2": "8022.A0A060XUR5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060W616",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 574,
"textmining": 108,
"combined_score": 804
},
{
"protein2": "8022.A0A060Z8B0",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A060YXW3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060XAY3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 719,
"textmining": 99,
"combined_score": 869
},
{
"protein2": "8022.A0A060WM21",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 574,
"textmining": 108,
"combined_score": 804
},
{
"protein2": "8022.A0A060W5G5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 574,
"textmining": 108,
"combined_score": 804
},
{
"protein2": "8022.A0A060XKC6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060X014",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 719,
"textmining": 99,
"combined_score": 869
},
{
"protein2": "8022.A0A060Z640",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060Y7Y8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 699,
"database": 671,
"textmining": 178,
"combined_score": 913
},
{
"protein2": "8022.A0A060YM41",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A060ZL40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 681,
"database": 569,
"textmining": 144,
"combined_score": 876
},
{
"protein2": "8022.A0A060YJV3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 533,
"coexpression": 0,
"experimental": 0,
"database": 530,
"textmining": 0,
"combined_score": 771
},
{
"protein2": "8022.A0A060Y1F8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 750
},
{
"protein2": "8022.A0A060YYE6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 699,
"database": 671,
"textmining": 178,
"combined_score": 913
},
{
"protein2": "8022.A0A060XVJ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 783,
"textmining": 86,
"combined_score": 795
},
{
"protein2": "8022.A0A060VTX4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 536,
"coexpression": 0,
"experimental": 0,
"database": 530,
"textmining": 0,
"combined_score": 772
},
{
"protein2": "8022.A0A060Z2N8",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A061AEV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 699,
"database": 671,
"textmining": 178,
"combined_score": 913
},
{
"protein2": "8022.A0A060WA02",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 764,
"textmining": 86,
"combined_score": 777
}
] |
A0A060VZM9
|
RNA helicase (EC 3.6.4.13)
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 1,026
|
Cytoplasm {ECO:0000256|ARBA:ARBA00004496}.
|
MAADKDNTTNISLIEDFRPRLRKLIEIEFVLDHLNFLDNDNKDLIRTKARKESNLKAVDLLIDTIIRIRPLPKGWFREFVDALSAGGCKHAATYVEDSPPCPALEAENDNCVRLIELLSPRLLGMKTTDVCWDCFSKGILTAEDREIILAECQNRGNMGGARELLRRIVRFPPGWFSTFLKALQVTEHNDLCKELTGESPGDNLIDEPGVLMAVNEAPGNVDPMVEEGPVEAAGKSFLPEQETLDSSVTSMHLDEPSEADSEIADLYSGTEEPMENGKPENSLDLSMSGCIAPAAESPPKAVIVLRDYQMDVARPALEGKNIIICLPTGSGKTRVAVYITKEHLDSRRKEGRPGKVVVLVNKVPLVEQHYSTEFWKFLKNKYKVERVSGDSQLKISFTDIVQKNDIVICTAQLLENYLERAHSGDDDGIKLSDLSLIVIDECHHTQKGGVYNHIMIRYLKQKHKNAKLKKEQKDTVAIPQILGLTASPGVGGAKKIEKAEEHILRICANLDAYKIMTGNLGENKKEPHKKIATAEERKRDVDFHEIIYIYIILMCKCIYVLTSDPFGDVLKGVMNAIHIHAELNPTCDLGTQNYEQWVVQKEQNAAKEENQKVRVCAEHLRQYNEALYLGKTIRMWDAFSFLDKYFDEELKKKVAPEDEEAIIKTDTERFLFTLFKDSKVKLQELAKLPQYENNSLAKLRTKILHEFTSREKARGIIFTKTRRSAIALAQWVQENSKFEEVGVKACHVIGGGGQSVVKPMTAAEQRDVLNKFQNAEINLLIATTVAEEGLDIAACNFVIRYELVTNEIAMIQARGRGRAEDSSYTLVAGEGSGVAERESVNEYREKMMSKAIDKVKKLDQEEYEKRIKEFQIQAIMEERVRTTKKKQKGMKKESPSKVKFSCRSCNKPVCSGEDVEIIENMHRVNVTPQFKELFIQRENTSLVKRLLDYESNGFIACKDCGQRWGSMMLYRGIECPCLHVKNFLVTYDEKRKNVNKWSELGIQLPAFDYAEHARSVAESSEDEESM
|
[
"GO:0006952",
"GO:0009605",
"GO:0043331",
"GO:0002376",
"GO:0006950",
"GO:0008150",
"GO:0042221",
"GO:0014070",
"GO:0043207",
"GO:0043330",
"GO:0050896",
"GO:1901698",
"GO:0010033",
"GO:0051707",
"GO:0045087",
"GO:0006955",
"GO:0009607",
"GO:0098542",
"GO:1902615",
"GO:0044419",
"GO:0110165",
"GO:0005737",
"GO:0005575",
"GO:0005622",
"GO:0003676",
"GO:0097159",
"GO:1901363",
"GO:0005488",
"GO:0003674",
"GO:0003723",
"GO:0003725"
] |
[
"GO:0008150",
"GO:0002376",
"GO:0050896",
"GO:0044419",
"GO:0009605",
"GO:0006950",
"GO:0042221",
"GO:0051707",
"GO:0006955",
"GO:0009607",
"GO:0006952",
"GO:0043207",
"GO:1901698",
"GO:0010033",
"GO:0045087",
"GO:0098542",
"GO:1902615",
"GO:0043331",
"GO:0014070",
"GO:0043330"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0097159",
"GO:1901363",
"GO:0003676",
"GO:0003723",
"GO:0003725"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0005737",
"GO:0005622"
] |
[
"IPR031964",
"IPR011545",
"IPR011029",
"IPR014001",
"IPR001650",
"IPR027417",
"IPR041204",
"IPR038557",
"IPR021673",
"IPR051363"
] |
af_db/AF-A0A060VZM9-F1-model_v4.cif.gz
|
8022.A0A060VZM9
|
[
"8022.A0A060WEB4",
"8022.A0A060YTZ8",
"8022.A0A060X6Z6",
"8022.A0A060YN46",
"8022.A0A060WQG6",
"8022.A0A060XL84",
"8022.A0A060WW34",
"8022.A0A060WH56",
"8022.A0A060W4N0",
"8022.A0A060YLC4",
"8022.A0A060YC09",
"8022.A0A060ZBM2",
"8022.A0A060YK39",
"8022.A0A060XY19",
"8022.A0A060XJI1",
"8022.A0A060XJ85",
"8022.A0A060YP86",
"8022.A0A060WKG7",
"8022.A0A060X8M8",
"8022.A0A060XMA3",
"8022.A0A060Y891",
"8022.A0A060YNY0",
"8022.A0A060XLY4",
"8022.A0A060YZ88",
"8022.A0A060YGR3",
"8022.A0A060YJZ6",
"8022.A0A060YE44",
"8022.A0A060YZ26",
"8022.A0A060XZL1",
"8022.A0A060W248",
"8022.A0A060Y144",
"8022.A0A060WAI5",
"8022.A0A060XUZ1",
"8022.A0A060VRW6",
"8022.A0A060XTY3",
"8022.A0A060Z5H7",
"8022.A0A060XK45",
"8022.A0A060ZHX0",
"8022.A0A060X8B3",
"8022.A0A060YN99",
"8022.A0A060VW80",
"8022.C1BFG2",
"8022.A0A060Z1S1",
"8022.A0A060XWW5",
"8022.A0A060VWJ9",
"8022.A0A060WP82",
"8022.A0A060XEU9",
"8022.A0A060WAB8",
"8022.A0A060W266",
"8022.A0A060WZ23",
"8022.A0A060WI08",
"8022.A0A060X6C4",
"8022.A0A060WKE3",
"8022.A0A060Z4D1",
"8022.A0A060YYM9",
"8022.A0A060YRP9",
"8022.A0A060YM65",
"8022.C1BG62",
"8022.A0A060WKE6",
"8022.A0A060W7K8",
"8022.A0A060WS77",
"8022.A0A060Z3T6",
"8022.A0A060XDQ4",
"8022.A0A060X2R7",
"8022.A0A060WT92",
"8022.A0A060YNG8",
"8022.A0A060WD36",
"8022.A0A060Z655",
"8022.A0A060XRR2",
"8022.A0A060Z6F4",
"8022.A0A060WA73",
"8022.A0A060Y1N8",
"8022.A0A060W5A5",
"8022.A0A060Z4W8",
"8022.A0A060XI12",
"8022.A0A060X6S5",
"8022.A0A060YMR9",
"8022.A0A061AEY4",
"8022.A0A060X5I3",
"8022.A0A060Z000",
"8022.A0A060XDM2",
"8022.A0A060ZBY8",
"8022.A0A060WG92",
"8022.A0A060XXI9",
"8022.A0A060X3S8",
"8022.A0A060W8A7",
"8022.A0A060W6R9",
"8022.A0A060XW94",
"8022.A0A060YRF9",
"8022.A0A060YGN0",
"8022.A0A060Y5Y0",
"8022.A0A060XTX7",
"8022.A0A060WZW0",
"8022.A0A060WK21",
"8022.A0A060VPV4",
"8022.A0A060Y4K2",
"8022.A0A060YEJ5",
"8022.A0A060X2B7",
"8022.A0A060X4G8",
"8022.A0A060Y135",
"8022.A0A060XER0",
"8022.A0A060WP39",
"8022.A0A060WVN0",
"8022.A0A060YX92",
"8022.A0A060Y6S6",
"8022.A0A060WGE5",
"8022.A0A060XVP1",
"8022.A0A060XZH1",
"8022.A0A060XJT9",
"8022.A0A060ZEW9",
"8022.A0A060ZA43",
"8022.A0A060WHG0",
"8022.A0A060XYH4",
"8022.A0A060YDE8",
"8022.A0A060WQX1",
"8022.A0A060XX03",
"8022.A0A060Y7H3",
"8022.C1BI16",
"8022.A0A060Y1E2",
"8022.A0A060ZXZ7",
"8022.A0A060XU58",
"8022.A0A060Z320",
"8022.A0A060Y9V2",
"8022.A0A060X606",
"8022.A0A060YFT4",
"8022.A0A060YQV1",
"8022.A0A060XV19",
"8022.A0A060X2J9",
"8022.A0A060X656",
"8022.A0A060X4P6",
"8022.A0A060W7E9",
"8022.A0A060WAH7",
"8022.A0A060XRZ7",
"8022.A0A060Z0R5",
"8022.A0A060Z173",
"8022.A0A060Z4S6",
"8022.A0A060W1P0",
"8022.A0A060ZDZ5",
"8022.A0A060WW06",
"8022.A0A060XVQ5",
"8022.A0A060X2M8",
"8022.A0A060W9W8",
"8022.A0A060W9X0",
"8022.A0A060WKD2",
"8022.A0A060XBU0",
"8022.A0A060YIJ3",
"8022.A0A060X729",
"8022.A0A060W716",
"8022.A0A060XYU5",
"8022.A0A060XB77",
"8022.C1BG84",
"8022.A0A060X0Z8",
"8022.A0A060YE39",
"8022.A0A060YTZ5",
"8022.A0A060YDW3",
"8022.A0A060X0A0",
"8022.A0A060Z6E8",
"8022.A0A060YEB0",
"8022.A0A060VWD5",
"8022.A0A060XXY8",
"8022.A0A060XNR8",
"8022.A0A060XGN6",
"8022.A0A060WAD4",
"8022.A0A060XXJ1",
"8022.A0A060Z3S0",
"8022.A0A060YJ69",
"8022.A0A060VXY4",
"8022.A0A060YH96",
"8022.A0A060YHX9",
"8022.A0A060WM17",
"8022.A0A060YI26",
"8022.A0A060WGY3",
"8022.A0A060YHA2",
"8022.C1BHI8",
"8022.A0A060YT06",
"8022.A0A060ZEB5",
"8022.A0A060WF04",
"8022.A0A060W5V1",
"8022.A0A060WRH2",
"8022.A0A060VU69",
"8022.A0A060YW55",
"8022.A0A060XUU8",
"8022.A0A060YW05",
"8022.A0A060XSK5",
"8022.A0A060XPT1",
"8022.A0A060YST3",
"8022.A0A060XNV6",
"8022.A0A060YQF1",
"8022.A0A060XFH7",
"8022.A0A060Y0H6",
"8022.A0A060ZAM3",
"8022.A0A060WFX5",
"8022.A0A060WE07",
"8022.A0A060Y4Q1",
"8022.A0A060Z819",
"8022.A0A060XPN1",
"8022.A0A060W1U5",
"8022.A0A060Z041",
"8022.A0A060X8S8",
"8022.A0A060WZ94",
"8022.A0A060WKV9",
"8022.A0A060ZQU3",
"8022.A0A060Y3B2",
"8022.A0A060XX02",
"8022.A0A060WC46",
"8022.A0A060WJD4",
"8022.A0A060XCS7",
"8022.A0A060YNT6",
"8022.A0A060Z3Y6",
"8022.A0A060YCF8",
"8022.A0A060WLM0",
"8022.Q9PT09",
"8022.A0A060WMT5",
"8022.A0A060XWU6",
"8022.A0A060Z5B4",
"8022.A0A060XC88",
"8022.A0A060WAH4",
"8022.A0A060VZX4",
"8022.A0A060YR45",
"8022.A0A060XTB8",
"8022.A0A060YHT0",
"8022.A0A060WA29",
"8022.A0A060Y5B1",
"8022.A0A060WIG3"
] |
[
{
"protein2": "8022.A0A060WEB4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 669,
"database": 774,
"textmining": 388,
"combined_score": 950
},
{
"protein2": "8022.A0A060YTZ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 600,
"experimental": 0,
"database": 0,
"textmining": 351,
"combined_score": 729
},
{
"protein2": "8022.A0A060X6Z6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 792,
"experimental": 158,
"database": 0,
"textmining": 133,
"combined_score": 834
},
{
"protein2": "8022.A0A060YN46",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 75,
"experimental": 215,
"database": 299,
"textmining": 510,
"combined_score": 717
},
{
"protein2": "8022.A0A060WQG6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 758
},
{
"protein2": "8022.A0A060XL84",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 673,
"database": 754,
"textmining": 52,
"combined_score": 917
},
{
"protein2": "8022.A0A060WW34",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
},
{
"protein2": "8022.A0A060WH56",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 747,
"database": 824,
"textmining": 420,
"combined_score": 971
},
{
"protein2": "8022.A0A060W4N0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 839,
"experimental": 0,
"database": 0,
"textmining": 376,
"combined_score": 895
},
{
"protein2": "8022.A0A060YLC4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 450,
"combined_score": 937
},
{
"protein2": "8022.A0A060YC09",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 148,
"experimental": 184,
"database": 583,
"textmining": 110,
"combined_score": 707
},
{
"protein2": "8022.A0A060ZBM2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 178,
"database": 785,
"textmining": 387,
"combined_score": 884
},
{
"protein2": "8022.A0A060YK39",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 616,
"database": 721,
"textmining": 208,
"combined_score": 907
},
{
"protein2": "8022.A0A060XY19",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 669,
"database": 774,
"textmining": 388,
"combined_score": 950
},
{
"protein2": "8022.A0A060XJI1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 675,
"database": 785,
"textmining": 230,
"combined_score": 941
},
{
"protein2": "8022.A0A060XJ85",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 690,
"database": 547,
"textmining": 238,
"combined_score": 895
},
{
"protein2": "8022.A0A060YP86",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060WKG7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 673,
"database": 754,
"textmining": 52,
"combined_score": 917
},
{
"protein2": "8022.A0A060X8M8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 360,
"database": 433,
"textmining": 400,
"combined_score": 766
},
{
"protein2": "8022.A0A060XMA3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060Y891",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 180,
"database": 772,
"textmining": 234,
"combined_score": 844
},
{
"protein2": "8022.A0A060YNY0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060XLY4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 812,
"database": 829,
"textmining": 337,
"combined_score": 976
},
{
"protein2": "8022.A0A060YZ88",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060YGR3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 0,
"textmining": 373,
"combined_score": 706
},
{
"protein2": "8022.A0A060YJZ6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 115,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 770
},
{
"protein2": "8022.A0A060YE44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 812,
"experimental": 158,
"database": 0,
"textmining": 89,
"combined_score": 843
},
{
"protein2": "8022.A0A060YZ26",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 109,
"combined_score": 747
},
{
"protein2": "8022.A0A060XZL1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 180,
"database": 772,
"textmining": 234,
"combined_score": 844
},
{
"protein2": "8022.A0A060W248",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 375,
"experimental": 0,
"database": 330,
"textmining": 450,
"combined_score": 749
},
{
"protein2": "8022.A0A060Y144",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 706,
"experimental": 158,
"database": 0,
"textmining": 128,
"combined_score": 765
},
{
"protein2": "8022.A0A060WAI5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 167,
"database": 736,
"textmining": 121,
"combined_score": 789
},
{
"protein2": "8022.A0A060XUZ1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 299,
"database": 824,
"textmining": 0,
"combined_score": 871
},
{
"protein2": "8022.A0A060VRW6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 172,
"database": 593,
"textmining": 389,
"combined_score": 776
},
{
"protein2": "8022.A0A060XTY3",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 199,
"experimental": 694,
"database": 0,
"textmining": 384,
"combined_score": 836
},
{
"protein2": "8022.A0A060Z5H7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 683,
"database": 0,
"textmining": 309,
"combined_score": 771
},
{
"protein2": "8022.A0A060XK45",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 167,
"database": 736,
"textmining": 121,
"combined_score": 789
},
{
"protein2": "8022.A0A060ZHX0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 386,
"database": 568,
"textmining": 398,
"combined_score": 831
},
{
"protein2": "8022.A0A060X8B3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 170,
"experimental": 254,
"database": 334,
"textmining": 505,
"combined_score": 768
},
{
"protein2": "8022.A0A060YN99",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 217,
"experimental": 326,
"database": 0,
"textmining": 504,
"combined_score": 715
},
{
"protein2": "8022.A0A060VW80",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 812,
"experimental": 158,
"database": 0,
"textmining": 89,
"combined_score": 843
},
{
"protein2": "8022.C1BFG2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 86,
"combined_score": 741
},
{
"protein2": "8022.A0A060Z1S1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 245,
"database": 816,
"textmining": 504,
"combined_score": 925
},
{
"protein2": "8022.A0A060XWW5",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
},
{
"protein2": "8022.A0A060VWJ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 109,
"combined_score": 747
},
{
"protein2": "8022.A0A060WP82",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060XEU9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 170,
"experimental": 254,
"database": 334,
"textmining": 505,
"combined_score": 768
},
{
"protein2": "8022.A0A060WAB8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 180,
"database": 772,
"textmining": 317,
"combined_score": 861
},
{
"protein2": "8022.A0A060W266",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 172,
"database": 593,
"textmining": 389,
"combined_score": 776
},
{
"protein2": "8022.A0A060WZ23",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 947,
"database": 489,
"textmining": 111,
"combined_score": 974
},
{
"protein2": "8022.A0A060WI08",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 812,
"experimental": 158,
"database": 0,
"textmining": 89,
"combined_score": 843
},
{
"protein2": "8022.A0A060X6C4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 792,
"experimental": 158,
"database": 0,
"textmining": 133,
"combined_score": 834
},
{
"protein2": "8022.A0A060WKE3",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 679,
"database": 0,
"textmining": 279,
"combined_score": 763
},
{
"protein2": "8022.A0A060Z4D1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 582,
"experimental": 166,
"database": 347,
"textmining": 451,
"combined_score": 858
},
{
"protein2": "8022.A0A060YYM9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 424,
"experimental": 158,
"database": 0,
"textmining": 454,
"combined_score": 712
},
{
"protein2": "8022.A0A060YRP9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 690,
"database": 547,
"textmining": 238,
"combined_score": 895
},
{
"protein2": "8022.A0A060YM65",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 812,
"experimental": 158,
"database": 0,
"textmining": 89,
"combined_score": 843
},
{
"protein2": "8022.C1BG62",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 937,
"database": 435,
"textmining": 0,
"combined_score": 962
},
{
"protein2": "8022.A0A060WKE6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 837,
"experimental": 0,
"database": 431,
"textmining": 450,
"combined_score": 944
},
{
"protein2": "8022.A0A060W7K8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 616,
"database": 721,
"textmining": 208,
"combined_score": 907
},
{
"protein2": "8022.A0A060WS77",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 679,
"database": 0,
"textmining": 279,
"combined_score": 763
},
{
"protein2": "8022.A0A060Z3T6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 850,
"experimental": 44,
"database": 0,
"textmining": 417,
"combined_score": 909
},
{
"protein2": "8022.A0A060XDQ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 749,
"database": 0,
"textmining": 441,
"combined_score": 853
},
{
"protein2": "8022.A0A060X2R7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 170,
"experimental": 254,
"database": 334,
"textmining": 505,
"combined_score": 768
},
{
"protein2": "8022.A0A060WT92",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 685,
"textmining": 86,
"combined_score": 730
},
{
"protein2": "8022.A0A060YNG8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 450,
"combined_score": 937
},
{
"protein2": "8022.A0A060WD36",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 172,
"database": 593,
"textmining": 389,
"combined_score": 776
},
{
"protein2": "8022.A0A060Z655",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 749,
"database": 0,
"textmining": 441,
"combined_score": 853
},
{
"protein2": "8022.A0A060XRR2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 76,
"experimental": 745,
"database": 0,
"textmining": 498,
"combined_score": 871
},
{
"protein2": "8022.A0A060Z6F4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 685,
"textmining": 86,
"combined_score": 730
},
{
"protein2": "8022.A0A060WA73",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 666,
"database": 0,
"textmining": 342,
"combined_score": 774
},
{
"protein2": "8022.A0A060Y1N8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060W5A5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 694,
"textmining": 273,
"combined_score": 768
},
{
"protein2": "8022.A0A060Z4W8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 690,
"database": 547,
"textmining": 238,
"combined_score": 895
},
{
"protein2": "8022.A0A060XI12",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 690,
"database": 547,
"textmining": 238,
"combined_score": 895
},
{
"protein2": "8022.A0A060X6S5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 874,
"experimental": 0,
"database": 0,
"textmining": 505,
"combined_score": 934
},
{
"protein2": "8022.A0A060YMR9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 794,
"experimental": 231,
"database": 409,
"textmining": 510,
"combined_score": 947
},
{
"protein2": "8022.A0A061AEY4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 766,
"database": 824,
"textmining": 447,
"combined_score": 975
},
{
"protein2": "8022.A0A060X5I3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 675,
"database": 785,
"textmining": 268,
"combined_score": 944
},
{
"protein2": "8022.A0A060Z000",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 579,
"database": 721,
"textmining": 216,
"combined_score": 899
},
{
"protein2": "8022.A0A060XDM2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 167,
"database": 736,
"textmining": 121,
"combined_score": 789
},
{
"protein2": "8022.A0A060ZBY8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 75,
"experimental": 215,
"database": 299,
"textmining": 504,
"combined_score": 713
},
{
"protein2": "8022.A0A060WG92",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060XXI9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 266,
"database": 827,
"textmining": 506,
"combined_score": 931
},
{
"protein2": "8022.A0A060X3S8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 802,
"database": 829,
"textmining": 504,
"combined_score": 981
},
{
"protein2": "8022.A0A060W8A7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 167,
"database": 736,
"textmining": 121,
"combined_score": 789
},
{
"protein2": "8022.A0A060W6R9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060XW94",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 684,
"database": 824,
"textmining": 340,
"combined_score": 961
},
{
"protein2": "8022.A0A060YRF9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 582,
"experimental": 166,
"database": 347,
"textmining": 451,
"combined_score": 858
},
{
"protein2": "8022.A0A060YGN0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 167,
"database": 736,
"textmining": 121,
"combined_score": 789
},
{
"protein2": "8022.A0A060Y5Y0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 167,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 784
},
{
"protein2": "8022.A0A060XTX7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 87,
"combined_score": 741
},
{
"protein2": "8022.A0A060WZW0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 178,
"database": 785,
"textmining": 387,
"combined_score": 884
},
{
"protein2": "8022.A0A060WK21",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060VPV4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 666,
"database": 0,
"textmining": 342,
"combined_score": 774
},
{
"protein2": "8022.A0A060Y4K2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 0,
"database": 0,
"textmining": 402,
"combined_score": 773
},
{
"protein2": "8022.A0A060YEJ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 824,
"textmining": 190,
"combined_score": 851
},
{
"protein2": "8022.A0A060X2B7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 167,
"database": 736,
"textmining": 121,
"combined_score": 789
},
{
"protein2": "8022.A0A060X4G8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 675,
"experimental": 299,
"database": 272,
"textmining": 86,
"combined_score": 828
},
{
"protein2": "8022.A0A060Y135",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060XER0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 180,
"database": 772,
"textmining": 317,
"combined_score": 861
},
{
"protein2": "8022.A0A060WP39",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 673,
"database": 754,
"textmining": 52,
"combined_score": 917
},
{
"protein2": "8022.A0A060WVN0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 172,
"database": 593,
"textmining": 389,
"combined_score": 776
},
{
"protein2": "8022.A0A060YX92",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 747,
"database": 824,
"textmining": 420,
"combined_score": 971
},
{
"protein2": "8022.A0A060Y6S6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060WGE5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 837,
"experimental": 0,
"database": 431,
"textmining": 450,
"combined_score": 944
},
{
"protein2": "8022.A0A060XVP1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 180,
"database": 772,
"textmining": 317,
"combined_score": 861
},
{
"protein2": "8022.A0A060XZH1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060XJT9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 675,
"experimental": 299,
"database": 272,
"textmining": 86,
"combined_score": 828
},
{
"protein2": "8022.A0A060ZEW9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 288,
"database": 910,
"textmining": 329,
"combined_score": 953
},
{
"protein2": "8022.A0A060ZA43",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 812,
"experimental": 158,
"database": 0,
"textmining": 89,
"combined_score": 843
},
{
"protein2": "8022.A0A060WHG0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 87,
"combined_score": 741
},
{
"protein2": "8022.A0A060XYH4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 675,
"database": 785,
"textmining": 268,
"combined_score": 944
},
{
"protein2": "8022.A0A060YDE8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 792,
"experimental": 158,
"database": 0,
"textmining": 133,
"combined_score": 834
},
{
"protein2": "8022.A0A060WQX1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 816,
"experimental": 0,
"database": 0,
"textmining": 87,
"combined_score": 824
},
{
"protein2": "8022.A0A060XX03",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 684,
"database": 824,
"textmining": 340,
"combined_score": 961
},
{
"protein2": "8022.A0A060Y7H3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 802,
"database": 0,
"textmining": 222,
"combined_score": 839
},
{
"protein2": "8022.C1BI16",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 616,
"database": 721,
"textmining": 208,
"combined_score": 907
},
{
"protein2": "8022.A0A060Y1E2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 115,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 770
},
{
"protein2": "8022.A0A060ZXZ7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 122,
"experimental": 222,
"database": 832,
"textmining": 505,
"combined_score": 935
},
{
"protein2": "8022.A0A060XU58",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 889,
"experimental": 0,
"database": 0,
"textmining": 276,
"combined_score": 916
},
{
"protein2": "8022.A0A060Z320",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 579,
"database": 721,
"textmining": 216,
"combined_score": 899
},
{
"protein2": "8022.A0A060Y9V2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 874,
"experimental": 0,
"database": 0,
"textmining": 505,
"combined_score": 934
},
{
"protein2": "8022.A0A060X606",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 706,
"experimental": 158,
"database": 0,
"textmining": 128,
"combined_score": 765
},
{
"protein2": "8022.A0A060YFT4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 947,
"database": 489,
"textmining": 111,
"combined_score": 974
},
{
"protein2": "8022.A0A060YQV1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 240,
"database": 910,
"textmining": 507,
"combined_score": 963
},
{
"protein2": "8022.A0A060XV19",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 87,
"combined_score": 741
},
{
"protein2": "8022.A0A060X2J9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 217,
"experimental": 326,
"database": 0,
"textmining": 504,
"combined_score": 715
},
{
"protein2": "8022.A0A060X656",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 768,
"experimental": 0,
"database": 0,
"textmining": 505,
"combined_score": 880
},
{
"protein2": "8022.A0A060X4P6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 0,
"textmining": 373,
"combined_score": 706
},
{
"protein2": "8022.A0A060W7E9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 299,
"database": 829,
"textmining": 0,
"combined_score": 875
},
{
"protein2": "8022.A0A060WAH7",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 199,
"experimental": 694,
"database": 0,
"textmining": 384,
"combined_score": 836
},
{
"protein2": "8022.A0A060XRZ7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 424,
"experimental": 158,
"database": 0,
"textmining": 454,
"combined_score": 712
},
{
"protein2": "8022.A0A060Z0R5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 706,
"database": 824,
"textmining": 441,
"combined_score": 968
},
{
"protein2": "8022.A0A060Z173",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 245,
"database": 816,
"textmining": 504,
"combined_score": 925
},
{
"protein2": "8022.A0A060Z4S6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 375,
"experimental": 0,
"database": 330,
"textmining": 450,
"combined_score": 749
},
{
"protein2": "8022.A0A060W1P0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 375,
"experimental": 0,
"database": 330,
"textmining": 450,
"combined_score": 749
},
{
"protein2": "8022.A0A060ZDZ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 652,
"database": 435,
"textmining": 0,
"combined_score": 794
},
{
"protein2": "8022.A0A060WW06",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 666,
"database": 0,
"textmining": 342,
"combined_score": 774
},
{
"protein2": "8022.A0A060XVQ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 758,
"database": 824,
"textmining": 370,
"combined_score": 970
},
{
"protein2": "8022.A0A060X2M8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 685,
"textmining": 86,
"combined_score": 730
},
{
"protein2": "8022.A0A060W9W8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 360,
"database": 433,
"textmining": 400,
"combined_score": 766
},
{
"protein2": "8022.A0A060W9X0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060WKD2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060XBU0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 690,
"database": 547,
"textmining": 238,
"combined_score": 895
},
{
"protein2": "8022.A0A060YIJ3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 551,
"database": 0,
"textmining": 373,
"combined_score": 706
},
{
"protein2": "8022.A0A060X729",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 616,
"database": 721,
"textmining": 208,
"combined_score": 907
},
{
"protein2": "8022.A0A060W716",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 616,
"database": 721,
"textmining": 208,
"combined_score": 907
},
{
"protein2": "8022.A0A060XYU5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 115,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 770
},
{
"protein2": "8022.A0A060XB77",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 679,
"database": 0,
"textmining": 279,
"combined_score": 763
},
{
"protein2": "8022.C1BG84",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 600,
"experimental": 0,
"database": 0,
"textmining": 351,
"combined_score": 729
},
{
"protein2": "8022.A0A060X0Z8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 167,
"database": 736,
"textmining": 121,
"combined_score": 789
},
{
"protein2": "8022.A0A060YE39",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 0,
"database": 0,
"textmining": 402,
"combined_score": 773
},
{
"protein2": "8022.A0A060YTZ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 582,
"experimental": 166,
"database": 347,
"textmining": 451,
"combined_score": 858
},
{
"protein2": "8022.A0A060YDW3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 199,
"experimental": 361,
"database": 370,
"textmining": 514,
"combined_score": 822
},
{
"protein2": "8022.A0A060X0A0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 148,
"experimental": 184,
"database": 583,
"textmining": 110,
"combined_score": 707
},
{
"protein2": "8022.A0A060Z6E8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 672,
"database": 0,
"textmining": 396,
"combined_score": 793
},
{
"protein2": "8022.A0A060YEB0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 850,
"experimental": 44,
"database": 0,
"textmining": 417,
"combined_score": 909
},
{
"protein2": "8022.A0A060VWD5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 706,
"experimental": 158,
"database": 0,
"textmining": 128,
"combined_score": 765
},
{
"protein2": "8022.A0A060XXY8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 600,
"experimental": 0,
"database": 0,
"textmining": 351,
"combined_score": 729
},
{
"protein2": "8022.A0A060XNR8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 675,
"database": 785,
"textmining": 230,
"combined_score": 941
},
{
"protein2": "8022.A0A060XGN6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 86,
"combined_score": 741
},
{
"protein2": "8022.A0A060WAD4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 360,
"database": 433,
"textmining": 400,
"combined_score": 766
},
{
"protein2": "8022.A0A060XXJ1",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
},
{
"protein2": "8022.A0A060Z3S0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 766,
"database": 824,
"textmining": 447,
"combined_score": 975
},
{
"protein2": "8022.A0A060YJ69",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 675,
"experimental": 299,
"database": 272,
"textmining": 86,
"combined_score": 828
},
{
"protein2": "8022.A0A060VXY4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 283,
"experimental": 159,
"database": 333,
"textmining": 507,
"combined_score": 775
},
{
"protein2": "8022.A0A060YH96",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 375,
"experimental": 0,
"database": 330,
"textmining": 450,
"combined_score": 749
},
{
"protein2": "8022.A0A060YHX9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 245,
"database": 816,
"textmining": 504,
"combined_score": 925
},
{
"protein2": "8022.A0A060WM17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 666,
"database": 0,
"textmining": 342,
"combined_score": 774
},
{
"protein2": "8022.A0A060YI26",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060WGY3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 685,
"textmining": 86,
"combined_score": 730
},
{
"protein2": "8022.A0A060YHA2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 672,
"database": 0,
"textmining": 396,
"combined_score": 793
},
{
"protein2": "8022.C1BHI8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 86,
"combined_score": 741
},
{
"protein2": "8022.A0A060YT06",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 824,
"textmining": 190,
"combined_score": 851
},
{
"protein2": "8022.A0A060ZEB5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 240,
"database": 910,
"textmining": 507,
"combined_score": 963
},
{
"protein2": "8022.A0A060WF04",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 172,
"database": 593,
"textmining": 389,
"combined_score": 776
},
{
"protein2": "8022.A0A060W5V1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 53,
"experimental": 802,
"database": 829,
"textmining": 450,
"combined_score": 980
},
{
"protein2": "8022.A0A060WRH2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 758
},
{
"protein2": "8022.A0A060VU69",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 167,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 784
},
{
"protein2": "8022.A0A060YW55",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 794,
"experimental": 231,
"database": 409,
"textmining": 506,
"combined_score": 947
},
{
"protein2": "8022.A0A060XUU8",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
},
{
"protein2": "8022.A0A060YW05",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 366,
"database": 824,
"textmining": 220,
"combined_score": 905
},
{
"protein2": "8022.A0A060XSK5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060XPT1",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
},
{
"protein2": "8022.A0A060YST3",
"neighborhood": 46,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 779,
"textmining": 86,
"combined_score": 790
},
{
"protein2": "8022.A0A060XNV6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 167,
"experimental": 580,
"database": 378,
"textmining": 126,
"combined_score": 784
},
{
"protein2": "8022.A0A060YQF1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 180,
"database": 772,
"textmining": 317,
"combined_score": 861
},
{
"protein2": "8022.A0A060XFH7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060Y0H6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 728,
"database": 570,
"textmining": 235,
"combined_score": 912
},
{
"protein2": "8022.A0A060ZAM3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 815,
"database": 829,
"textmining": 451,
"combined_score": 981
},
{
"protein2": "8022.A0A060WFX5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 685,
"textmining": 86,
"combined_score": 730
},
{
"protein2": "8022.A0A060WE07",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 856,
"database": 829,
"textmining": 450,
"combined_score": 985
},
{
"protein2": "8022.A0A060Y4Q1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 266,
"database": 827,
"textmining": 506,
"combined_score": 931
},
{
"protein2": "8022.A0A060Z819",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 245,
"database": 816,
"textmining": 504,
"combined_score": 925
},
{
"protein2": "8022.A0A060XPN1",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
},
{
"protein2": "8022.A0A060W1U5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 0,
"database": 829,
"textmining": 503,
"combined_score": 913
},
{
"protein2": "8022.A0A060Z041",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 675,
"experimental": 299,
"database": 272,
"textmining": 86,
"combined_score": 828
},
{
"protein2": "8022.A0A060X8S8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 386,
"database": 568,
"textmining": 86,
"combined_score": 741
},
{
"protein2": "8022.A0A060WZ94",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 675,
"database": 785,
"textmining": 230,
"combined_score": 941
},
{
"protein2": "8022.A0A060WKV9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 850,
"experimental": 44,
"database": 0,
"textmining": 417,
"combined_score": 909
},
{
"protein2": "8022.A0A060ZQU3",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 679,
"database": 0,
"textmining": 279,
"combined_score": 763
},
{
"protein2": "8022.A0A060Y3B2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 69,
"coexpression": 628,
"experimental": 471,
"database": 862,
"textmining": 512,
"combined_score": 985
},
{
"protein2": "8022.A0A060XX02",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 405,
"textmining": 226,
"combined_score": 878
},
{
"protein2": "8022.A0A060WC46",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 386,
"database": 568,
"textmining": 398,
"combined_score": 831
},
{
"protein2": "8022.A0A060WJD4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 706,
"database": 824,
"textmining": 441,
"combined_score": 968
},
{
"protein2": "8022.A0A060XCS7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 167,
"database": 736,
"textmining": 121,
"combined_score": 789
},
{
"protein2": "8022.A0A060YNT6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 728,
"database": 569,
"textmining": 226,
"combined_score": 901
},
{
"protein2": "8022.A0A060Z3Y6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 178,
"database": 785,
"textmining": 387,
"combined_score": 884
},
{
"protein2": "8022.A0A060YCF8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 928,
"experimental": 0,
"database": 570,
"textmining": 390,
"combined_score": 979
},
{
"protein2": "8022.A0A060WLM0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 669,
"database": 774,
"textmining": 388,
"combined_score": 950
},
{
"protein2": "8022.Q9PT09",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 937,
"database": 435,
"textmining": 0,
"combined_score": 962
},
{
"protein2": "8022.A0A060WMT5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 386,
"database": 568,
"textmining": 398,
"combined_score": 831
},
{
"protein2": "8022.A0A060XWU6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 758,
"database": 824,
"textmining": 370,
"combined_score": 970
},
{
"protein2": "8022.A0A060Z5B4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 375,
"experimental": 0,
"database": 330,
"textmining": 450,
"combined_score": 749
},
{
"protein2": "8022.A0A060XC88",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 148,
"experimental": 184,
"database": 583,
"textmining": 110,
"combined_score": 707
},
{
"protein2": "8022.A0A060WAH4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 299,
"database": 824,
"textmining": 0,
"combined_score": 871
},
{
"protein2": "8022.A0A060VZX4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 675,
"database": 785,
"textmining": 268,
"combined_score": 944
},
{
"protein2": "8022.A0A060YR45",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 366,
"database": 824,
"textmining": 220,
"combined_score": 905
},
{
"protein2": "8022.A0A060XTB8",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 199,
"experimental": 694,
"database": 0,
"textmining": 384,
"combined_score": 836
},
{
"protein2": "8022.A0A060YHT0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 375,
"experimental": 0,
"database": 330,
"textmining": 450,
"combined_score": 749
},
{
"protein2": "8022.A0A060WA29",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 582,
"experimental": 166,
"database": 347,
"textmining": 451,
"combined_score": 858
},
{
"protein2": "8022.A0A060Y5B1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 346,
"database": 428,
"textmining": 346,
"combined_score": 733
},
{
"protein2": "8022.A0A060WIG3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 792,
"experimental": 158,
"database": 0,
"textmining": 133,
"combined_score": 834
}
] |
A0A060W032
|
Ventricular natriuretic peptide
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 149
|
Secreted {ECO:0000256|ARBA:ARBA00004613, ECO:0000256|RuleBase:RU003686}.
|
MAKLHIFLGYIVLITTLSVSCGTPYASRNVQELENLKDLIQRLEDKLTVNEENYAYPSESEDVDTAEMEDIEYSPTAIRGQEERMTMNAPNRIAPESPVVSRLKDLIGLTKTAKSFNSCFGNRIERIGSWSGLGCNNVKTGNKKRIFGN
|
[
"GO:0042310",
"GO:0042311",
"GO:0003018",
"GO:0065008",
"GO:0065007",
"GO:0097746",
"GO:0008150",
"GO:0008015",
"GO:0003013",
"GO:0090066",
"GO:0003008",
"GO:0035296",
"GO:0032501",
"GO:0035150"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0032501",
"GO:0065008",
"GO:0003008",
"GO:0003013",
"GO:0090066",
"GO:0003018",
"GO:0008015",
"GO:0035150",
"GO:0097746",
"GO:0035296",
"GO:0042310",
"GO:0042311"
] | null | null |
[
"IPR000663",
"IPR030480",
"IPR050787",
"IPR002407"
] |
af_db/AF-A0A060W032-F1-model_v4.cif.gz
|
8022.A0A060W032
| null | null |
A0A060WRY3
|
Chemokine interleukin-8-like domain-containing protein
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 95
|
Secreted {ECO:0000256|ARBA:ARBA00004613}.
|
MSIRMSASLVVVLLALLTITEEMSLRGMGADLRCRCIETESRRIGKLIKKVEMFPPSSHCRDTEIIATLSKSGQEICLDVSAPWVKKVIEKMLAK
|
[
"GO:0009743",
"GO:0065007",
"GO:0032928",
"GO:0048518",
"GO:0048870",
"GO:0008150",
"GO:0006954",
"GO:0042221",
"GO:2000145",
"GO:0002523",
"GO:2000377",
"GO:0050896",
"GO:0002685",
"GO:0050900",
"GO:0050789",
"GO:0031325",
"GO:0019222",
"GO:0032930",
"GO:0040017",
"GO:0090322",
"GO:0002684",
"GO:0050794",
"GO:0006952",
"GO:0009893",
"GO:0002376",
"GO:0002682",
"GO:0009987",
"GO:0031323",
"GO:0030335",
"GO:1901700",
"GO:0006950",
"GO:0030334",
"GO:1902624",
"GO:2000379",
"GO:1902622",
"GO:0010033",
"GO:2000147",
"GO:0002687",
"GO:0040012",
"GO:0016477",
"GO:0048522"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0048518",
"GO:0050896",
"GO:0050789",
"GO:0002376",
"GO:0009987",
"GO:0048870",
"GO:0042221",
"GO:0050900",
"GO:0019222",
"GO:0040017",
"GO:0002684",
"GO:0050794",
"GO:0009893",
"GO:0002682",
"GO:0006950",
"GO:0040012",
"GO:0048522",
"GO:2000145",
"GO:0002523",
"GO:0002685",
"GO:0031325",
"GO:0006952",
"GO:0031323",
"GO:1901700",
"GO:0010033",
"GO:2000147",
"GO:0002687",
"GO:0016477",
"GO:0009743",
"GO:0006954",
"GO:2000377",
"GO:0030335",
"GO:0030334",
"GO:1902624",
"GO:2000379",
"GO:1902622",
"GO:0032930",
"GO:0090322",
"GO:0032928"
] | null | null |
[
"IPR039809",
"IPR001089",
"IPR001811",
"IPR033899",
"IPR036048"
] |
af_db/AF-A0A060WRY3-F1-model_v4.cif.gz
|
8022.A0A060WRY3
|
[
"8022.A0A060WCR4",
"8022.A0A060XW82",
"8022.A0A060Y453",
"8022.A0A060YBG9",
"8022.A0A060VQU0",
"8022.A0A060XBF3",
"8022.A0A060VZ13",
"8022.A0A060YQ42",
"8022.A0A060X2E2",
"8022.A0A060XZ47",
"8022.A0A061A6H0",
"8022.A0A060WPR8",
"8022.A0A060W3U5",
"8022.A0A060XF12",
"8022.A0A060VPX8",
"8022.A0A060WVB6",
"8022.A0A060XTS9",
"8022.A0A060YAX3",
"8022.A0A060YXH5",
"8022.A0A060YBB6",
"8022.A0A060Y1V5",
"8022.A0A060XKD8",
"8022.A0A060XE26",
"8022.A0A060YA11",
"8022.A0A060VY72",
"8022.A0A060WFM4",
"8022.H1ZZ93",
"8022.A0A060VTH0",
"8022.A0A060VSL8",
"8022.A0A060Y097",
"8022.A0A060XL04",
"8022.A0A060YGE9",
"8022.H1ZZ96",
"8022.A0A060ZH67",
"8022.A0A060YC27",
"8022.A0A060VVA1",
"8022.A4F345",
"8022.A0A060WU43",
"8022.A0A060WYC1",
"8022.Q1G669",
"8022.Q64IC2",
"8022.A0A060XGQ8",
"8022.A0A061A7B1",
"8022.A0A060WZ17",
"8022.A0A060YWY6",
"8022.A0A060XGI5",
"8022.A0A060Z5E6",
"8022.A0A060WNJ9",
"8022.A0A060XPJ4",
"8022.A0A060Y0D9",
"8022.A0A060X5F3",
"8022.A0A060VUU9",
"8022.A0A060WB80",
"8022.A0A060W8I0",
"8022.A0A060VW55",
"8022.A0A060WQ51",
"8022.A0A060WDY2",
"8022.A0A060X035"
] |
[
{
"protein2": "8022.A0A060WCR4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 0,
"database": 827,
"textmining": 318,
"combined_score": 878
},
{
"protein2": "8022.A0A060XW82",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 43,
"experimental": 0,
"database": 826,
"textmining": 59,
"combined_score": 829
},
{
"protein2": "8022.A0A060Y453",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 233,
"database": 736,
"textmining": 125,
"combined_score": 807
},
{
"protein2": "8022.A0A060YBG9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 0,
"database": 827,
"textmining": 126,
"combined_score": 844
},
{
"protein2": "8022.A0A060VQU0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 0,
"database": 827,
"textmining": 389,
"combined_score": 893
},
{
"protein2": "8022.A0A060XBF3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 827,
"textmining": 111,
"combined_score": 841
},
{
"protein2": "8022.A0A060VZ13",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 0,
"database": 827,
"textmining": 126,
"combined_score": 844
},
{
"protein2": "8022.A0A060YQ42",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 816,
"textmining": 75,
"combined_score": 825
},
{
"protein2": "8022.A0A060X2E2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 115,
"combined_score": 840
},
{
"protein2": "8022.A0A060XZ47",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 825,
"textmining": 74,
"combined_score": 855
},
{
"protein2": "8022.A0A061A6H0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 506,
"database": 736,
"textmining": 136,
"combined_score": 888
},
{
"protein2": "8022.A0A060WPR8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 43,
"experimental": 0,
"database": 826,
"textmining": 59,
"combined_score": 829
},
{
"protein2": "8022.A0A060W3U5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 827,
"textmining": 111,
"combined_score": 841
},
{
"protein2": "8022.A0A060XF12",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 87,
"combined_score": 824
},
{
"protein2": "8022.A0A060VPX8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 179,
"database": 827,
"textmining": 429,
"combined_score": 913
},
{
"protein2": "8022.A0A060WVB6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 932,
"database": 736,
"textmining": 186,
"combined_score": 985
},
{
"protein2": "8022.A0A060XTS9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 785,
"textmining": 74,
"combined_score": 822
},
{
"protein2": "8022.A0A060YAX3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 825,
"textmining": 74,
"combined_score": 855
},
{
"protein2": "8022.A0A060YXH5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 179,
"database": 827,
"textmining": 422,
"combined_score": 912
},
{
"protein2": "8022.A0A060YBB6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 702,
"database": 419,
"textmining": 220,
"combined_score": 857
},
{
"protein2": "8022.A0A060Y1V5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 179,
"database": 827,
"textmining": 429,
"combined_score": 913
},
{
"protein2": "8022.A0A060XKD8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 233,
"database": 736,
"textmining": 125,
"combined_score": 807
},
{
"protein2": "8022.A0A060XE26",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 789,
"textmining": 87,
"combined_score": 799
},
{
"protein2": "8022.A0A060YA11",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 439,
"textmining": 220,
"combined_score": 719
},
{
"protein2": "8022.A0A060VY72",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 805,
"textmining": 48,
"combined_score": 811
},
{
"protein2": "8022.A0A060WFM4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 789,
"textmining": 87,
"combined_score": 799
},
{
"protein2": "8022.H1ZZ93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 104,
"experimental": 932,
"database": 609,
"textmining": 375,
"combined_score": 983
},
{
"protein2": "8022.A0A060VTH0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 893,
"database": 0,
"textmining": 177,
"combined_score": 908
},
{
"protein2": "8022.A0A060VSL8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 0,
"database": 827,
"textmining": 389,
"combined_score": 893
},
{
"protein2": "8022.A0A060Y097",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 419,
"textmining": 246,
"combined_score": 718
},
{
"protein2": "8022.A0A060XL04",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 439,
"textmining": 220,
"combined_score": 719
},
{
"protein2": "8022.A0A060YGE9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 87,
"combined_score": 766
},
{
"protein2": "8022.H1ZZ96",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 893,
"database": 0,
"textmining": 177,
"combined_score": 908
},
{
"protein2": "8022.A0A060ZH67",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 87,
"combined_score": 766
},
{
"protein2": "8022.A0A060YC27",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 805,
"textmining": 48,
"combined_score": 811
},
{
"protein2": "8022.A0A060VVA1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 785,
"textmining": 74,
"combined_score": 822
},
{
"protein2": "8022.A4F345",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 308,
"combined_score": 873
},
{
"protein2": "8022.A0A060WU43",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 87,
"combined_score": 766
},
{
"protein2": "8022.A0A060WYC1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 826,
"textmining": 48,
"combined_score": 832
},
{
"protein2": "8022.Q1G669",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 255,
"experimental": 918,
"database": 832,
"textmining": 453,
"combined_score": 993
},
{
"protein2": "8022.Q64IC2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 419,
"textmining": 220,
"combined_score": 709
},
{
"protein2": "8022.A0A060XGQ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 104,
"experimental": 932,
"database": 609,
"textmining": 375,
"combined_score": 983
},
{
"protein2": "8022.A0A061A7B1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 506,
"database": 736,
"textmining": 136,
"combined_score": 888
},
{
"protein2": "8022.A0A060WZ17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 758,
"database": 736,
"textmining": 183,
"combined_score": 948
},
{
"protein2": "8022.A0A060YWY6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 506,
"database": 736,
"textmining": 136,
"combined_score": 888
},
{
"protein2": "8022.A0A060XGI5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 825,
"textmining": 74,
"combined_score": 855
},
{
"protein2": "8022.A0A060Z5E6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 419,
"textmining": 220,
"combined_score": 709
},
{
"protein2": "8022.A0A060WNJ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 115,
"combined_score": 840
},
{
"protein2": "8022.A0A060XPJ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 789,
"textmining": 87,
"combined_score": 799
},
{
"protein2": "8022.A0A060Y0D9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 419,
"textmining": 246,
"combined_score": 718
},
{
"protein2": "8022.A0A060X5F3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 0,
"database": 827,
"textmining": 318,
"combined_score": 878
},
{
"protein2": "8022.A0A060VUU9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 506,
"database": 736,
"textmining": 136,
"combined_score": 888
},
{
"protein2": "8022.A0A060WB80",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 0,
"database": 614,
"textmining": 338,
"combined_score": 739
},
{
"protein2": "8022.A0A060W8I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 44,
"experimental": 0,
"database": 832,
"textmining": 148,
"combined_score": 851
},
{
"protein2": "8022.A0A060VW55",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 789,
"textmining": 87,
"combined_score": 799
},
{
"protein2": "8022.A0A060WQ51",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 179,
"database": 831,
"textmining": 493,
"combined_score": 925
},
{
"protein2": "8022.A0A060WDY2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 816,
"textmining": 73,
"combined_score": 825
},
{
"protein2": "8022.A0A060X035",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 826,
"textmining": 48,
"combined_score": 832
}
] |
A0A060WUE4
|
Chemokine interleukin-8-like domain-containing protein
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 95
|
Secreted {ECO:0000256|ARBA:ARBA00004613}.
|
MSIRMSASLVVVLLALLTITEGMSLRGMGADLRCRCIETESRRIGKLIKKVEMFPPSSHCRDTEIIATLSKSGQEICLDVSAPWVKRVIEKMLAK
|
[
"GO:0009743",
"GO:0065007",
"GO:0032928",
"GO:0048518",
"GO:0048870",
"GO:0008150",
"GO:0006954",
"GO:0042221",
"GO:2000145",
"GO:0002523",
"GO:2000377",
"GO:0050896",
"GO:0002685",
"GO:0050900",
"GO:0050789",
"GO:0031325",
"GO:0019222",
"GO:0032930",
"GO:0040017",
"GO:0090322",
"GO:0002684",
"GO:0050794",
"GO:0006952",
"GO:0009893",
"GO:0002376",
"GO:0002682",
"GO:0009987",
"GO:0031323",
"GO:0030335",
"GO:1901700",
"GO:0006950",
"GO:0030334",
"GO:1902624",
"GO:2000379",
"GO:1902622",
"GO:0010033",
"GO:2000147",
"GO:0002687",
"GO:0040012",
"GO:0016477",
"GO:0048522",
"GO:0110165",
"GO:0005575",
"GO:0005576",
"GO:0005615"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0048518",
"GO:0050896",
"GO:0050789",
"GO:0002376",
"GO:0009987",
"GO:0048870",
"GO:0042221",
"GO:0050900",
"GO:0019222",
"GO:0040017",
"GO:0002684",
"GO:0050794",
"GO:0009893",
"GO:0002682",
"GO:0006950",
"GO:0040012",
"GO:0048522",
"GO:2000145",
"GO:0002523",
"GO:0002685",
"GO:0031325",
"GO:0006952",
"GO:0031323",
"GO:1901700",
"GO:0010033",
"GO:2000147",
"GO:0002687",
"GO:0016477",
"GO:0009743",
"GO:0006954",
"GO:2000377",
"GO:0030335",
"GO:0030334",
"GO:1902624",
"GO:2000379",
"GO:1902622",
"GO:0032930",
"GO:0090322",
"GO:0032928"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005576",
"GO:0005615"
] |
[
"IPR039809",
"IPR001089",
"IPR001811",
"IPR033899",
"IPR036048"
] |
af_db/AF-A0A060WUE4-F1-model_v4.cif.gz
|
8022.A0A060WUE4
|
[
"8022.A0A060YAX3",
"8022.A0A060XTS9",
"8022.A0A060Y1V5",
"8022.A0A060YXH5",
"8022.A0A060YBB6",
"8022.A0A060W3U5",
"8022.A0A060WPR8",
"8022.A0A061A6H0",
"8022.A0A060VPX8",
"8022.A0A060XF12",
"8022.A0A060WVB6",
"8022.A0A060YA11",
"8022.A0A060VY72",
"8022.A0A060XKD8",
"8022.A0A060XE26",
"8022.A0A060XW82",
"8022.A0A060WCR4",
"8022.A0A060Y453",
"8022.A0A060YBG9",
"8022.A0A060YQ42",
"8022.A0A060X2E2",
"8022.A0A060XZ47",
"8022.A0A060VQU0",
"8022.A0A060XBF3",
"8022.A0A060VZ13",
"8022.A0A060XGI5",
"8022.A0A060Z5E6",
"8022.A0A060XPJ4",
"8022.A0A060WNJ9",
"8022.Q64IC2",
"8022.A0A060XGQ8",
"8022.A0A060YWY6",
"8022.A0A061A7B1",
"8022.A0A060WZ17",
"8022.A0A060W8I0",
"8022.A0A060WDY2",
"8022.A0A060X035",
"8022.A0A060VW55",
"8022.A0A060WQ51",
"8022.A0A060VUU9",
"8022.A0A060Y0D9",
"8022.A0A060X5F3",
"8022.A0A060WB80",
"8022.A0A060XL04",
"8022.A0A060VSL8",
"8022.A0A060Y097",
"8022.A0A060YGE9",
"8022.H1ZZ96",
"8022.H1ZZ93",
"8022.A0A060WFM4",
"8022.A0A060VTH0",
"8022.A0A060WU43",
"8022.A0A060WYC1",
"8022.Q1G669",
"8022.A0A060ZH67",
"8022.A0A060YC27",
"8022.A0A060VVA1",
"8022.A4F345"
] |
[
{
"protein2": "8022.A0A060YAX3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 825,
"textmining": 74,
"combined_score": 855
},
{
"protein2": "8022.A0A060XTS9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 785,
"textmining": 74,
"combined_score": 822
},
{
"protein2": "8022.A0A060Y1V5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 179,
"database": 827,
"textmining": 429,
"combined_score": 913
},
{
"protein2": "8022.A0A060YXH5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 179,
"database": 827,
"textmining": 422,
"combined_score": 912
},
{
"protein2": "8022.A0A060YBB6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 702,
"database": 419,
"textmining": 220,
"combined_score": 857
},
{
"protein2": "8022.A0A060W3U5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 827,
"textmining": 111,
"combined_score": 841
},
{
"protein2": "8022.A0A060WPR8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 43,
"experimental": 0,
"database": 826,
"textmining": 59,
"combined_score": 829
},
{
"protein2": "8022.A0A061A6H0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 506,
"database": 736,
"textmining": 136,
"combined_score": 888
},
{
"protein2": "8022.A0A060VPX8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 179,
"database": 827,
"textmining": 429,
"combined_score": 913
},
{
"protein2": "8022.A0A060XF12",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 87,
"combined_score": 824
},
{
"protein2": "8022.A0A060WVB6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 932,
"database": 736,
"textmining": 186,
"combined_score": 985
},
{
"protein2": "8022.A0A060YA11",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 439,
"textmining": 220,
"combined_score": 719
},
{
"protein2": "8022.A0A060VY72",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 805,
"textmining": 48,
"combined_score": 811
},
{
"protein2": "8022.A0A060XKD8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 233,
"database": 736,
"textmining": 125,
"combined_score": 807
},
{
"protein2": "8022.A0A060XE26",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 789,
"textmining": 87,
"combined_score": 799
},
{
"protein2": "8022.A0A060XW82",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 43,
"experimental": 0,
"database": 826,
"textmining": 59,
"combined_score": 829
},
{
"protein2": "8022.A0A060WCR4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 0,
"database": 827,
"textmining": 318,
"combined_score": 878
},
{
"protein2": "8022.A0A060Y453",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 233,
"database": 736,
"textmining": 125,
"combined_score": 807
},
{
"protein2": "8022.A0A060YBG9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 0,
"database": 827,
"textmining": 126,
"combined_score": 844
},
{
"protein2": "8022.A0A060YQ42",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 816,
"textmining": 75,
"combined_score": 825
},
{
"protein2": "8022.A0A060X2E2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 115,
"combined_score": 840
},
{
"protein2": "8022.A0A060XZ47",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 825,
"textmining": 74,
"combined_score": 855
},
{
"protein2": "8022.A0A060VQU0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 0,
"database": 827,
"textmining": 389,
"combined_score": 893
},
{
"protein2": "8022.A0A060XBF3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 827,
"textmining": 111,
"combined_score": 841
},
{
"protein2": "8022.A0A060VZ13",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 0,
"database": 827,
"textmining": 126,
"combined_score": 844
},
{
"protein2": "8022.A0A060XGI5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 825,
"textmining": 74,
"combined_score": 855
},
{
"protein2": "8022.A0A060Z5E6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 419,
"textmining": 220,
"combined_score": 709
},
{
"protein2": "8022.A0A060XPJ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 789,
"textmining": 87,
"combined_score": 799
},
{
"protein2": "8022.A0A060WNJ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 115,
"combined_score": 840
},
{
"protein2": "8022.Q64IC2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 419,
"textmining": 274,
"combined_score": 729
},
{
"protein2": "8022.A0A060XGQ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 104,
"experimental": 932,
"database": 609,
"textmining": 375,
"combined_score": 983
},
{
"protein2": "8022.A0A060YWY6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 506,
"database": 736,
"textmining": 136,
"combined_score": 888
},
{
"protein2": "8022.A0A061A7B1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 506,
"database": 736,
"textmining": 136,
"combined_score": 888
},
{
"protein2": "8022.A0A060WZ17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 758,
"database": 736,
"textmining": 183,
"combined_score": 948
},
{
"protein2": "8022.A0A060W8I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 44,
"experimental": 0,
"database": 832,
"textmining": 148,
"combined_score": 851
},
{
"protein2": "8022.A0A060WDY2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 816,
"textmining": 73,
"combined_score": 825
},
{
"protein2": "8022.A0A060X035",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 826,
"textmining": 48,
"combined_score": 832
},
{
"protein2": "8022.A0A060VW55",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 789,
"textmining": 87,
"combined_score": 799
},
{
"protein2": "8022.A0A060WQ51",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 179,
"database": 831,
"textmining": 493,
"combined_score": 925
},
{
"protein2": "8022.A0A060VUU9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 506,
"database": 736,
"textmining": 136,
"combined_score": 888
},
{
"protein2": "8022.A0A060Y0D9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 419,
"textmining": 246,
"combined_score": 718
},
{
"protein2": "8022.A0A060X5F3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 0,
"database": 827,
"textmining": 318,
"combined_score": 878
},
{
"protein2": "8022.A0A060WB80",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 0,
"database": 614,
"textmining": 338,
"combined_score": 739
},
{
"protein2": "8022.A0A060XL04",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 439,
"textmining": 297,
"combined_score": 746
},
{
"protein2": "8022.A0A060VSL8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 0,
"database": 827,
"textmining": 389,
"combined_score": 893
},
{
"protein2": "8022.A0A060Y097",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 392,
"database": 419,
"textmining": 246,
"combined_score": 718
},
{
"protein2": "8022.A0A060YGE9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 87,
"combined_score": 766
},
{
"protein2": "8022.H1ZZ96",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 893,
"database": 0,
"textmining": 177,
"combined_score": 908
},
{
"protein2": "8022.H1ZZ93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 104,
"experimental": 932,
"database": 609,
"textmining": 375,
"combined_score": 983
},
{
"protein2": "8022.A0A060WFM4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 789,
"textmining": 87,
"combined_score": 799
},
{
"protein2": "8022.A0A060VTH0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 893,
"database": 0,
"textmining": 177,
"combined_score": 908
},
{
"protein2": "8022.A0A060WU43",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 87,
"combined_score": 766
},
{
"protein2": "8022.A0A060WYC1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 826,
"textmining": 48,
"combined_score": 832
},
{
"protein2": "8022.Q1G669",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 255,
"experimental": 918,
"database": 832,
"textmining": 453,
"combined_score": 993
},
{
"protein2": "8022.A0A060ZH67",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 87,
"combined_score": 766
},
{
"protein2": "8022.A0A060YC27",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 805,
"textmining": 48,
"combined_score": 811
},
{
"protein2": "8022.A0A060VVA1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 63,
"experimental": 162,
"database": 785,
"textmining": 74,
"combined_score": 822
},
{
"protein2": "8022.A4F345",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 308,
"combined_score": 873
}
] |
A0A060WZC7
|
Skeletal muscle ryanodine receptor
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 4,791
|
Sarcoplasmic reticulum membrane {ECO:0000256|ARBA:ARBA00004326}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004326}.
|
MAEGGDGEEEIQFLRTPISVFRIAHYEGGAVCSHARSLWRLEPLRIGWSGGHMKWGQSFRVRHITTGRYLCLDEEKGLLVVDPEKANAKMSAFCFRISKEKIEVAQKRDVEGMGTPEIKYGESMCFVQHVSSGLWLTYASVDAKSARLGPLKRKAILHKEGHMDDALTVARSQTEEFQAARMIYNTAGLFTQFIKALDSLSGKNKSSSGPPSLPMDSVALSLQDLIFYFRPPEEELEHEEKQTKLRSLKNRQNLFQEEGMITLVLDCIDRLNVYNTAAHFSEFAGEEAAESWKEIVNLLYELLASLIRGNRANCALFCDNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQNLITENLLPGRDLLLQSNIINYVTSVRPNIFLGTCEGSTQYKKWYFEVMVDYVEPFLTAQAFHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYAFDGLHLWSGRVLRHVASPNMHILAADDVVSCCLDLSVPSISFRINGHPVQGMFENFNLDGLFFPVVSFSAGVRVRFLLGGRHGDFKFLPPPGYAPCYEAVLPKDRLRIEPIKEYKHDFNGVRNLLGPTQSLSHTAFTPCPVDTVQIVLPPHLERIREKLAENSHELWAATRIEQGWTYGSFRDDNKKLHPCLVDFQSLPEPEKNYNLAMSGETLKTLLALGCHVGMGDEKAEENLKNIKMPKTYMMSSGYKPAPLDLNHVKLTPNQTNLVERLAENGHNVWARDRVHQGWTYSIVQDIMSKRNPRLVPYNLLDEKTKKTNRDTVCAAVRTLIGYGYNIEPPDQESSGNGEGHSRGNKIRVFRAEKSYAVTQGKWYFEFEAVTVGDMRVGWARPSVRADTELGADELAYVFNGFKAQRWHVGNEPFGRSWLPGDVVGCMIDLVEQNIFFTLNGEMLISDSGSEMAFKDIDTGDGFIPVCSLGLSQVGRLNLGQNVSSLRYFTICGLQEGFEPFAINMKRDITMWFSKSLPQFIPVPTEHPHIEVSRVDGTVDSAPCLKLTHKTFGSQNANTDLLFLRLSMPVEFHETFKVMAGTTPLTRALTIPEDEVLEVDPDSDFEVLKKSASRTEKEEEKKEPSVPKEIPVNEGGENVKDASTEKSKKKGFLFKAKKAAFTPPPVVPTMPRLMEEVVPDDRDDDDIILNTTTYYYSVRVIAGQEPSGVWVGWITPDYHQYDLHFDLSKVRNVTVTVGDDKGNIHDSMKRSNCYMVWGGEFSSSQQTRVSQEDFVIGCLIDLDTGLMTFTANGKEINTFYQVEPNTKLFPAVFVLPSSQNMLQVELGKLKNIMPISAAMFRSERKNPVPQCPPRLDVQMLTPVIWSRMPNHFLSPETGRVNERHGWMVECREPLTMMALHIPEENRCIDVLELSERMDLLKFHYHTLKLYGSVCALGNNRVAHALCSHVDESQLFYAIENTYLPGPMRSGYYDLLISMHLESAKRNRLMTNKEFIVPMTDETRSINLYSDTDNSHALPGVGLTTCLRPKLHFSPTGFVGTDLDIYTLSPFIPLQVLKAKALTMLTEAVQDGGQAMRDPVGGSVEFHFVPILKLISTLLIMGVFENEDVKHILKMIEPTVFNEELEAELEELDGEKVDGEKGAEETEKEATPGEADGEAEEQVGLEEGLLHMKLPESVKLQMCTLLQYFCDCELRHRVEAIIAFSDQFVSQVQANQRARYNELMLAFTMSAAETARKTREFRSPPQEQVNMLMNFKSIAEDEECPVPDEVRDALLSFHKNLLAHCGVHIEEEEVEEELDMSLKGRLFRILDKLRHLRKKKVEEAPEPVEETKPSTLQELISHTMIHWAQESFIQNPELVRLMFSLLHRQYDGLGELIRALPKAYTINAISIKDTMDLLECLGQIRSLLIVQMGPEEERLMIQSIGNIMSNKVFYQHPNLMRALGMHETVMEVMVNVLGGGDSKEIRFPRMVTNCCRFLCYFCRISRQNQRSMFDHLSYLLQNSGIGLGMRGSTPLDVAAASCIDNNELALALQEQDLEKVVKYLAGCGLQSCPQLLAKGYPDIGWNPCGGEKYLDFLRFAVFVNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAIEEAIKISEDPARDGPTVKKDRRFPGMFPGGEEQHEENKVHLGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPMEDLVGVISLSVQIPDFGKDNSVIEPKMSSSFVPDHKAPMVLFLDRVYGIDNQDFLLHVLEVGFLPDMRAAASLDTAAFCTTEMALALNRYLSLAVLPLITKCAFLFAGTDHRAIMIDSMLHTIYRLSRGRAFTKAQRDVIEECLMALCKNLRPSMLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWKYYCLPNGWGNFGVSSEEELHLTRKLFWGIFESLAHKKFDAELFKIAMPCICAIAGAIPPDYVDASYSSKTEKKALVDAEGNFDPKPVETTNTIIPERLDGFINRYAEYTHDKWAFEKIQNNWTYGEMLDENSKTHPMLRPYKTFSEKDKEIYRWPIKESMKAMIAWEWTLDQTREGDEAKTEQKKAARKISQTAQATYDPSHGYSPQPIEISHTALSRELQSMAEQLAENYHNTWGRKKKMELQSKGGGAHPLLVPYDTLTAKEKARDREKAHELLKFLQLNGFAVTRGMKDMESDISSIEKRFAYGFLQKLLKWMEIAQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFKNHCLYFLSTPAKVLGSGGHSSNKEKEMIASIFCKMAALVRHRVSLFGNDAAAIVNCLHILARSLDARTVMKSGPEIVKAGLRSFFEGAADDIEKMVENLKLGKVSKGNQQVKGVSQNINYTTIALLPVLTSLFDHISQHQFGDDVMLDDLQMSCYRIMCAIYSLGSVKNPHVERQRPALGECLAHLAAAMPVAYLEPHLNEYNAFSVYTTKSPRERAILGLPNEVQELCQDIPELDVLLKEIGDLAESGARYTEMPHVIEITLPMLCNYLPRWWERGLENFPELEGQICTDVTSDQLNQLLGSIMKIVVNNLGIDEASWMKRLAVFSQPIVSRARPEMLKSHFIPTMEKLKKRTGKVVAEEDHLRMEGKAEGDEEEGTIRDEFAVLCRDLYALYPLLIRYVDNNRARWLTCPDPDAEELFRMVGEVFIFWSKSHNFKREEQNFVVMNEINNMSFLTADSKSKMSKAGGSDVERTKKKRRGDRYSVQTSLIVAALKKMLPIGLNMCSPADHELINLAKIRYSLRDTDEEVREFLQNNLHLQGKVENPSMRWQMSLYKEMAGKAEDADAPEKVVKRVQEVSAVLYHIEVTEHPFKSKKMVWHKLLSKQRRKAVVACFRMTPLYNLPRHRASNMFLEGYKRNWIHTEGYSFEDRMIDDLSKAMEQEGEEEEETETKPDPLHQLILHFSRTALTEKSKLDTDYLYMAYADIMAKSCHIGEEDEGGEEVEEGAEDEMSFEVRQTELEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGCMVSSTLKLGISILNGGNVEVQQKMLEYLKDKKDVGFFLSVQALMQTCSVLDLNAFERQNKAEGLGMVSEEGTSKSFFPLECLTADLLKLRSSPLLRLIRIPEHGISAISQSIDLSNSPLVKLLNCVVCLYTVMSIVPIHESISDFYWYYSGKDIIDEPGKKNFSKAMTVAKQIFNSLTEYIQGPCTGNQQSLTHSRLWDAVVGFLHVFAHMMMKLAQHRQNPRGKPGSDSSQIGLLKELLDLQKDMVVMLLSLLEGNVVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFQKAMDSQKQYSPSEIQFLLSCSEADENDMINFEEFADRFQEPAKDIGFNIAVLLTNLSEHVPHDLRLKNFLEQAESVLNYFRPFLGRIEIMGASRKIERIYFEISEVNRTQWEMPQVRESKRQFIFDVVNEGGESEKMEMFVNFCEDTIFEMNIASQISEQEEEKEEEDDDEPAEGGAEAGGGGGGDEEGNGEEGEPESSSAFADFINSLLNFLSIFTFRNLRRQYRRVRKMTIKQIVVGLATFFWTILIGILHFIYSVCKGFFLLIWQTLFGGGLVEGAKNITVTEILASMPDPTQDEVHGDLPGEPRTGEEQEAGGVTDQMDTGGGEEEEEDKQDKEGGGPPRIDAPGGLGDMGIEATVEPPTPEGTPLTRRKQQPEEGAAAAADGQAAEPAPAPAPAIEEPPPEPEKADTENGEKAEKEAETKEEEKQEEPKEKKAKDKKTKKQHREQGFQLWTELDIQRNKFLNYLSRNFYNLRFLALFIAFALNFILLFYKVSDSPPGEGDEVEGSGMFEGSGEEEEEGPVYFFLEESTGYMQPTLTFLAALHTVIAFLCIIGYNCLKIPLVIFKREKELARKLEFDGLYITEQPEDDDIKGQWDRLVLNTPSFPNNYWDKFVKRKVLDKYGDIYGRERIAELLGMDLASLDVSQQTDKKPEEPDNSTLAWCTSIDFKYQIWKCGVVFTDGTFLYLCWYTIMSLLGHYNNFFYACHLLDIAIGVKDLRTILSSVTHNGKQLMMTLGLLAVVVYLYTVVAFIFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDVYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERAWDFFPAGDCFRKQYEDQLA
|
[
"GO:0014808",
"GO:0051234",
"GO:0070588",
"GO:0098655",
"GO:0051283",
"GO:0051209",
"GO:0065007",
"GO:0009987",
"GO:0071702",
"GO:0051179",
"GO:0097553",
"GO:0006816",
"GO:0098662",
"GO:0034220",
"GO:0008150",
"GO:0030001",
"GO:0055085",
"GO:0006812",
"GO:0050789",
"GO:0048523",
"GO:0048519",
"GO:1903514",
"GO:0051282",
"GO:0006811",
"GO:0098660",
"GO:0032879",
"GO:0006810",
"GO:0050794",
"GO:0070296",
"GO:0005622",
"GO:0043226",
"GO:0016529",
"GO:0005783",
"GO:0005575",
"GO:0016020",
"GO:0043231",
"GO:0043229",
"GO:0014802",
"GO:0110165",
"GO:0005737",
"GO:0016528",
"GO:0043227",
"GO:0012505",
"GO:0031984",
"GO:0098827",
"GO:0015643",
"GO:0003674",
"GO:0005488"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0009987",
"GO:0051179",
"GO:0050789",
"GO:0048519",
"GO:0051234",
"GO:0055085",
"GO:0048523",
"GO:0032879",
"GO:0050794",
"GO:0051283",
"GO:0034220",
"GO:0051282",
"GO:0098660",
"GO:0006810",
"GO:0098655",
"GO:0051209",
"GO:0071702",
"GO:0098662",
"GO:0006811",
"GO:0070588",
"GO:0006816",
"GO:0006812",
"GO:1903514",
"GO:0014808",
"GO:0097553",
"GO:0030001",
"GO:0070296"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0015643"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0016020",
"GO:0005737",
"GO:0012505",
"GO:0031984",
"GO:0005783",
"GO:0043229",
"GO:0016528",
"GO:0043227",
"GO:0098827",
"GO:0016529",
"GO:0043231",
"GO:0014802"
] |
[
"IPR001870",
"IPR043136",
"IPR013320",
"IPR011992",
"IPR005821",
"IPR036300",
"IPR016093",
"IPR013662",
"IPR000699",
"IPR013333",
"IPR015925",
"IPR003032",
"IPR009460",
"IPR048581",
"IPR035910",
"IPR035761",
"IPR035764",
"IPR035762",
"IPR003877"
] | null |
8022.A0A060WZC7
|
[
"8022.A0A060XT19",
"8022.A0A060VV08",
"8022.A0A060YI40",
"8022.A0A060W552",
"8022.A0A060WND2",
"8022.A0A060W7T8",
"8022.A0A060WVU0",
"8022.A0A060WZJ2",
"8022.A0A060ZCJ0",
"8022.A0A060Y1F8",
"8022.A0A060YSV0",
"8022.C1BHS5",
"8022.A0A060X1N4",
"8022.A0A060X010",
"8022.A0A060Y7R5",
"8022.A0A060Y7X2",
"8022.A0A060YSJ4",
"8022.A0A060XPD1",
"8022.A0A060WZU7",
"8022.A0A060Y6N6",
"8022.A0A060WA02",
"8022.A0A060XLH8",
"8022.A0A060Y2D4",
"8022.A0A060VW65",
"8022.A0A060X0K0",
"8022.A0A060XVJ2",
"8022.C1BFZ3",
"8022.A0A060YC57",
"8022.A0A060VRI3",
"8022.A0A060Y0G1",
"8022.A0A060WIX3"
] |
[
{
"protein2": "8022.A0A060XT19",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 528,
"database": 431,
"textmining": 86,
"combined_score": 733
},
{
"protein2": "8022.A0A060VV08",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 534,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060YI40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 504,
"textmining": 86,
"combined_score": 704
},
{
"protein2": "8022.A0A060W552",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 374,
"database": 504,
"textmining": 125,
"combined_score": 711
},
{
"protein2": "8022.A0A060WND2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 0,
"database": 825,
"textmining": 85,
"combined_score": 837
},
{
"protein2": "8022.A0A060W7T8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 528,
"database": 431,
"textmining": 86,
"combined_score": 733
},
{
"protein2": "8022.A0A060WVU0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 528,
"database": 431,
"textmining": 86,
"combined_score": 733
},
{
"protein2": "8022.A0A060WZJ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 528,
"database": 431,
"textmining": 86,
"combined_score": 733
},
{
"protein2": "8022.A0A060ZCJ0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 528,
"database": 431,
"textmining": 86,
"combined_score": 733
},
{
"protein2": "8022.A0A060Y1F8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 504,
"textmining": 86,
"combined_score": 704
},
{
"protein2": "8022.A0A060YSV0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 578,
"database": 337,
"textmining": 111,
"combined_score": 729
},
{
"protein2": "8022.C1BHS5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 598,
"database": 342,
"textmining": 115,
"combined_score": 745
},
{
"protein2": "8022.A0A060X1N4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 386,
"database": 581,
"textmining": 182,
"combined_score": 771
},
{
"protein2": "8022.A0A060X010",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 640,
"database": 356,
"textmining": 137,
"combined_score": 782
},
{
"protein2": "8022.A0A060Y7R5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 374,
"database": 504,
"textmining": 125,
"combined_score": 711
},
{
"protein2": "8022.A0A060Y7X2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 528,
"database": 431,
"textmining": 86,
"combined_score": 733
},
{
"protein2": "8022.A0A060YSJ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 528,
"database": 431,
"textmining": 86,
"combined_score": 733
},
{
"protein2": "8022.A0A060XPD1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 528,
"database": 431,
"textmining": 86,
"combined_score": 733
},
{
"protein2": "8022.A0A060WZU7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 640,
"database": 356,
"textmining": 137,
"combined_score": 782
},
{
"protein2": "8022.A0A060Y6N6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 640,
"database": 356,
"textmining": 137,
"combined_score": 782
},
{
"protein2": "8022.A0A060WA02",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 504,
"textmining": 86,
"combined_score": 704
},
{
"protein2": "8022.A0A060XLH8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 528,
"database": 431,
"textmining": 86,
"combined_score": 733
},
{
"protein2": "8022.A0A060Y2D4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 386,
"database": 577,
"textmining": 89,
"combined_score": 742
},
{
"protein2": "8022.A0A060VW65",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 43,
"combined_score": 832
},
{
"protein2": "8022.A0A060X0K0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 598,
"database": 342,
"textmining": 115,
"combined_score": 745
},
{
"protein2": "8022.A0A060XVJ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 534,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.C1BFZ3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 640,
"database": 356,
"textmining": 137,
"combined_score": 782
},
{
"protein2": "8022.A0A060YC57",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 386,
"database": 581,
"textmining": 185,
"combined_score": 772
},
{
"protein2": "8022.A0A060VRI3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 374,
"database": 504,
"textmining": 125,
"combined_score": 711
},
{
"protein2": "8022.A0A060Y0G1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 528,
"database": 431,
"textmining": 86,
"combined_score": 733
},
{
"protein2": "8022.A0A060WIX3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 528,
"database": 431,
"textmining": 86,
"combined_score": 733
}
] |
A0A060XA63
|
Sodium/potassium-transporting ATPase subunit alpha
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 517
|
Cell membrane {ECO:0000256|RuleBase:RU362084}; Multi-pass membrane protein {ECO:0000256|RuleBase:RU362084}. Membrane {ECO:0000256|ARBA:ARBA00004370}.
|
MKGAPERILDRCSTILIQGKEQPLDDELKEAFQNAYEELGGLGERVLGFCHFQLPDDQFAEGFQFDCEEVNFPTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLKIPVSEVNPRDAKACVVHGGELKDLSAEQLDDILAHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEEAENDIMKRQPRNPKTDKLVNERLISIAYGQIGMMQATAGFFTYFVILAENGFLPMDLLGMRVDWDNKIMNDMEDSYGQQWTYERRKIVEFTCHTAFFASIVVVQWADLIICKTRRNSILQQGMKNRILIFGLFEETALAVFLSYCPGMDVALRMYPLKPCWWFCALPYSLLIFLYDEGRRYILRRNPGGWVEQETYY
|
[
"GO:0006970",
"GO:0043434",
"GO:1901652",
"GO:0009628",
"GO:1901700",
"GO:0009651",
"GO:0006950",
"GO:0008150",
"GO:0042538",
"GO:0042221",
"GO:0010243",
"GO:0050896",
"GO:1901698",
"GO:0010033",
"GO:0009725",
"GO:0060416",
"GO:0009719",
"GO:0006972",
"GO:0015399",
"GO:0008556",
"GO:0008554",
"GO:0015079",
"GO:0140358",
"GO:0022890",
"GO:0005215",
"GO:0015662",
"GO:1901702",
"GO:0022853",
"GO:0042626",
"GO:0015075",
"GO:0005391",
"GO:0022857",
"GO:0015318",
"GO:0008324",
"GO:0140657",
"GO:0046873",
"GO:0015081",
"GO:0003674",
"GO:0019829",
"GO:0022804"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0009628",
"GO:0006950",
"GO:0042221",
"GO:0009719",
"GO:0006970",
"GO:1901700",
"GO:1901698",
"GO:0010033",
"GO:0009725",
"GO:0043434",
"GO:1901652",
"GO:0009651",
"GO:0010243",
"GO:0006972",
"GO:0042538",
"GO:0060416"
] |
[
"GO:0003674",
"GO:0005215",
"GO:0140657",
"GO:0042626",
"GO:0022857",
"GO:0140358",
"GO:1901702",
"GO:0015075",
"GO:0015318",
"GO:0019829",
"GO:0022804",
"GO:0015399",
"GO:0008556",
"GO:0008554",
"GO:0015079",
"GO:0022890",
"GO:0015662",
"GO:0022853",
"GO:0008324",
"GO:0015081",
"GO:0005391",
"GO:0046873"
] | null |
[
"IPR006068",
"IPR023299",
"IPR023298",
"IPR050510",
"IPR036412",
"IPR023214",
"IPR005775",
"IPR001757"
] |
af_db/AF-A0A060XA63-F1-model_v4.cif.gz
|
8022.A0A060XA63
|
[
"8022.A0A060XAY3",
"8022.A0A060YXW3",
"8022.A0A060Z8B0",
"8022.A0A060WM21",
"8022.A0A060W5G5",
"8022.A0A060ZAX9",
"8022.A0A060YU43",
"8022.A0A060W616",
"8022.A0A060VV08",
"8022.A0A060XUR5",
"8022.A0A060VMX9",
"8022.A0A060Z7D4",
"8022.A0A060ZIV0",
"8022.A0A060XCM7",
"8022.A0A060WZD8",
"8022.A0A060VYP9",
"8022.A0A060YEQ6",
"8022.A0A060YI40",
"8022.A0A060XM52",
"8022.A0A060YFB0",
"8022.A0A060Z2N8",
"8022.A0A060VTX4",
"8022.A0A060XVJ2",
"8022.A0A060YYE6",
"8022.A0A060WA02",
"8022.A0A061AEV5",
"8022.A0A060Y1F8",
"8022.A0A060YJV3",
"8022.A0A060YM41",
"8022.A0A060ZL40",
"8022.A0A060Z640",
"8022.A0A060XKC6",
"8022.A0A060X014",
"8022.A0A060Y7Y8"
] |
[
{
"protein2": "8022.A0A060XAY3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 719,
"textmining": 99,
"combined_score": 869
},
{
"protein2": "8022.A0A060YXW3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060Z8B0",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A060WM21",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 574,
"textmining": 108,
"combined_score": 804
},
{
"protein2": "8022.A0A060W5G5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 574,
"textmining": 108,
"combined_score": 804
},
{
"protein2": "8022.A0A060ZAX9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 533,
"coexpression": 0,
"experimental": 0,
"database": 530,
"textmining": 0,
"combined_score": 771
},
{
"protein2": "8022.A0A060YU43",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060W616",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 574,
"textmining": 108,
"combined_score": 804
},
{
"protein2": "8022.A0A060VV08",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 783,
"textmining": 86,
"combined_score": 795
},
{
"protein2": "8022.A0A060XUR5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060VMX9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 574,
"textmining": 120,
"combined_score": 807
},
{
"protein2": "8022.A0A060Z7D4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 535,
"coexpression": 0,
"experimental": 0,
"database": 586,
"textmining": 0,
"combined_score": 799
},
{
"protein2": "8022.A0A060ZIV0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 681,
"database": 569,
"textmining": 144,
"combined_score": 876
},
{
"protein2": "8022.A0A060XCM7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 788,
"textmining": 156,
"combined_score": 907
},
{
"protein2": "8022.A0A060WZD8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 660,
"database": 451,
"textmining": 88,
"combined_score": 814
},
{
"protein2": "8022.A0A060VYP9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 614,
"database": 510,
"textmining": 198,
"combined_score": 835
},
{
"protein2": "8022.A0A060YEQ6",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A060YI40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 750
},
{
"protein2": "8022.A0A060XM52",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060YFB0",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A060Z2N8",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A060VTX4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 536,
"coexpression": 0,
"experimental": 0,
"database": 530,
"textmining": 0,
"combined_score": 772
},
{
"protein2": "8022.A0A060XVJ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 783,
"textmining": 86,
"combined_score": 795
},
{
"protein2": "8022.A0A060YYE6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 699,
"database": 671,
"textmining": 178,
"combined_score": 913
},
{
"protein2": "8022.A0A060WA02",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 764,
"textmining": 86,
"combined_score": 777
},
{
"protein2": "8022.A0A061AEV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 699,
"database": 671,
"textmining": 178,
"combined_score": 913
},
{
"protein2": "8022.A0A060Y1F8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 750
},
{
"protein2": "8022.A0A060YJV3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 533,
"coexpression": 0,
"experimental": 0,
"database": 530,
"textmining": 0,
"combined_score": 771
},
{
"protein2": "8022.A0A060YM41",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 829,
"textmining": 73,
"combined_score": 840
},
{
"protein2": "8022.A0A060ZL40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 681,
"database": 569,
"textmining": 144,
"combined_score": 876
},
{
"protein2": "8022.A0A060Z640",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060XKC6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 429,
"textmining": 87,
"combined_score": 731
},
{
"protein2": "8022.A0A060X014",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 516,
"database": 719,
"textmining": 99,
"combined_score": 869
},
{
"protein2": "8022.A0A060Y7Y8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 62,
"experimental": 699,
"database": 671,
"textmining": 178,
"combined_score": 913
}
] |
A0A060XXJ7
|
Glycogen [starch] synthase (EC 2.4.1.11)
|
Glycogen synthase participates in the glycogen biosynthetic process along with glycogenin and glycogen branching enzyme. Extends the primer composed of a few glucose units formed by glycogenin by adding new glucose units to it. In this context, glycogen synthase transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan. {ECO:0000256|ARBA:ARBA00043883}.; FUNCTION: Transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan. {ECO:0000256|RuleBase:RU363104}.
|
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 696
| null |
FFFATQPRRPASQSCLFTVDVETGVFLVLFNEAAMGGIYTVIQTKAKITVDEWGENLFMMGPYYEHNFNTQVEQCEPPNPAIKKAMGALIDNGCLVYFGRWLIEGSPYVILFDTGSAAWNLDRWKGDLWDTCGIGMPAHDREANDSLLFGSMVAWFFKELTDELGDSPNVLAHFHEWQVGAGLILCRSRKIPLATIFTTHATLLGRYICAGNVDFYNNLDKFNIDQEAGERQIYHRYCLERAAVHCAHVFTTVSQITAVEANHMLHRKPDVVTPNGLNIKKFSAMHEFQNLHSTNKGQIQEFIRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGVDIFLESLSRLNYLLRVHKNDVTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHTVKDKFGKRLYEALLKGDIPDMNTILDRDDFTIMKRAIYATQRHTLPPVTTHNMLDDTSDPILANVRRIGLFNARTDRVKIVFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFMEEHVSDPTAYGIYIVDRRFRSADDSCNQLTQFMFGFCQQSRRQRIIQRNRTERLSDLLDWRYLGRFYMHARSLALSRAFPDKFKMEPLAPPQTEGFRYPRPGSVPPSPSVSVHSTPHHSDEEDDEEPYDEDMEAERDRQNIKAPFTLGATPEGKKTHPGESAN
|
[
"GO:0043434",
"GO:1901652",
"GO:0032868",
"GO:0009743",
"GO:1901700",
"GO:0006950",
"GO:0008150",
"GO:0042221",
"GO:0010243",
"GO:0050896",
"GO:1901698",
"GO:0010033",
"GO:0009725",
"GO:0090664",
"GO:0009719",
"GO:0034284",
"GO:0032501",
"GO:0009749",
"GO:0009746",
"GO:0009011",
"GO:0046527",
"GO:0016740",
"GO:0003674",
"GO:0003824",
"GO:0016757",
"GO:0016758"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0032501",
"GO:0006950",
"GO:0042221",
"GO:0090664",
"GO:0009719",
"GO:1901700",
"GO:1901698",
"GO:0010033",
"GO:0009725",
"GO:0043434",
"GO:1901652",
"GO:0009743",
"GO:0010243",
"GO:0032868",
"GO:0034284",
"GO:0009746",
"GO:0009749"
] |
[
"GO:0003674",
"GO:0003824",
"GO:0016740",
"GO:0016757",
"GO:0016758",
"GO:0046527",
"GO:0009011"
] | null |
[
"IPR008631"
] |
af_db/AF-A0A060XXJ7-F1-model_v4.cif.gz
|
8022.A0A060XXJ7
|
[
"8022.A0A060WYJ9",
"8022.A0A060YIP8",
"8022.A0A060WRI4",
"8022.A0A060X2M1",
"8022.A0A060Y8P1",
"8022.A0A060YMT8",
"8022.A0A060XV67",
"8022.A0A060XDC6",
"8022.A0A060XS00",
"8022.A0A060W1Z0",
"8022.A0A060Y5X7",
"8022.A0A060YIM7",
"8022.A0A060ZAN1",
"8022.A0A060YX04",
"8022.A0A060X7K4",
"8022.A0A060WM17",
"8022.A0A060XZP7",
"8022.A0A060XJT2",
"8022.A0A060YVM7",
"8022.A0A060XZ37",
"8022.A0A060ZEK4",
"8022.A0A060YH61",
"8022.A0A060W2G6",
"8022.A0A060YVA7",
"8022.A0A060WUC8",
"8022.A0A060X323",
"8022.A0A060XT37",
"8022.A0A060Y1F8",
"8022.A0A060X0Y1",
"8022.A0A060WIJ8",
"8022.A0A060XRD2",
"8022.A0A060X616",
"8022.A0A060Y6W1",
"8022.A0A060VTF9",
"8022.A0A060WIJ2",
"8022.A0A060X8N3",
"8022.A0A060XKP6",
"8022.A0A060Z4R9",
"8022.A0A060Z5F5",
"8022.A0A060YL26",
"8022.A0A060X713",
"8022.A0A060WQ25",
"8022.A0A060WLB7",
"8022.A0A060VUU1",
"8022.A0A060XSN8",
"8022.A0A060ZNH6",
"8022.A0A060XH06",
"8022.A0A060Y5I2",
"8022.A0A060XXN7",
"8022.A0A060Z5F3",
"8022.A0A060WEI1",
"8022.A0A060WQP2",
"8022.A0A060XVJ2",
"8022.A0A060WHB4",
"8022.A0A060Z1C5",
"8022.A0A060VZV0",
"8022.A0A060YTQ2",
"8022.A0A060VWG1",
"8022.A0A060YL98",
"8022.A0A060XU63",
"8022.A0A060Y534",
"8022.A0A060XNY0",
"8022.A0A060WH90",
"8022.A0A060XSM8",
"8022.A0A060YTG3",
"8022.A0A060YNX7",
"8022.A0A060VUY5",
"8022.A0A060X1P8",
"8022.A0A060YMQ1",
"8022.A0A060W283",
"8022.A0A061ADV4",
"8022.A0A060YFV0",
"8022.A0A060YQV7",
"8022.A0A060YDL6",
"8022.A0A060YV74",
"8022.A0A060YAF5",
"8022.A0A060XUT6",
"8022.A0A060Y0T0",
"8022.A0A060WA02",
"8022.A0A060X8L2",
"8022.A0A060WZJ0",
"8022.A0A060YFS3",
"8022.A0A060YZG3",
"8022.A0A060YFA7",
"8022.A0A060XT54",
"8022.A0A060YBJ4",
"8022.A0A060Y786",
"8022.A0A060W0B2",
"8022.A0A060WLM0",
"8022.A0A060XV30",
"8022.A0A060XD51",
"8022.A0A060Y609",
"8022.A0A060Y709",
"8022.A0A060VZH4",
"8022.A0A060XRX7",
"8022.A0A060Y2C4",
"8022.A0A061A4H1",
"8022.A0A060XG53",
"8022.A0A060WVD8",
"8022.A0A060Y501",
"8022.A0A060VWH8",
"8022.A0A060VVL9",
"8022.A0A060WT58",
"8022.A0A060XTP5",
"8022.A0A060XS33",
"8022.A0A060XEX3",
"8022.A0A060XSY3",
"8022.A0A060WIW7",
"8022.A0A060Y7A8",
"8022.A0A060W866",
"8022.A0A060XSB7",
"8022.A0A060YFV9",
"8022.A0A060WPP2",
"8022.A0A060Z9N9",
"8022.A0A060WN87",
"8022.A0A060WW06",
"8022.A0A060YSL4",
"8022.A0A060Z3H1",
"8022.A0A060Y3N1",
"8022.A0A060W8A2",
"8022.A0A060Y7X3",
"8022.A0A060Z1E1",
"8022.A0A060XPD8",
"8022.Q91381",
"8022.A0A060XLL5",
"8022.A0A060XTV9",
"8022.A0A060XC32",
"8022.A0A060WW97",
"8022.A0A060XUP8",
"8022.A0A060Y4C1",
"8022.A0A060WGP6",
"8022.A0A060VTH4",
"8022.A0A060W7I7",
"8022.A0A060YBV8",
"8022.A0A060YBX5",
"8022.C1BGD2",
"8022.A0A060VMQ1",
"8022.A0A060XW24",
"8022.A0A060WSG3",
"8022.A0A060W0M8",
"8022.A0A060YL36",
"8022.A0A060VSR1",
"8022.A0A060VX16",
"8022.A0A060YH63",
"8022.A0A060ZF19",
"8022.A0A060X514",
"8022.A0A060YJA5",
"8022.A0A060YLW3",
"8022.A0A060W2L4",
"8022.A0A060XIF0",
"8022.C1BI55",
"8022.A0A060XER1",
"8022.A0A060Y7D9",
"8022.A0A060W299",
"8022.A0A060YEQ2",
"8022.A0A061A6F9",
"8022.A0A060Y189",
"8022.A0A060X8J0",
"8022.A0A060Z6M0",
"8022.A0A060VRS4",
"8022.A0A060YE51",
"8022.A0A060XLG3",
"8022.A0A060VZ75",
"8022.A0A060YXZ4",
"8022.A0A060VZK5",
"8022.A0A060X3J8",
"8022.A0A060YAU7",
"8022.A0A060YBC9",
"8022.A0A060W6I3",
"8022.A0A060W3W4",
"8022.A0A060XG99",
"8022.A0A060W7G4",
"8022.A0A060YB62",
"8022.A0A060VVS9",
"8022.A0A060WKQ0",
"8022.A0A060XFQ4",
"8022.A0A060XN85",
"8022.A0A060Z7M7",
"8022.A0A060VTG5",
"8022.A0A060ZCK7",
"8022.A0A060Z909",
"8022.A0A060WAZ8",
"8022.A0A060VPT7",
"8022.A0A060WNW6",
"8022.A0A060X8J2",
"8022.A0A060WVF2",
"8022.A0A060VY18",
"8022.A0A060Y703",
"8022.A0A060VUC1",
"8022.A0A060VZV9",
"8022.A0A060XF64",
"8022.A0A060XXT9",
"8022.A0A060YWZ4",
"8022.A0A060X4I5",
"8022.A0A060X549",
"8022.A0A060YT42",
"8022.A0A060WA73",
"8022.A0A060XSA5",
"8022.A0A060XYQ2",
"8022.A0A060WIM8",
"8022.A0A060W5K0",
"8022.A0A060ZGG9",
"8022.A0A060WBX7",
"8022.A0A060W580",
"8022.A0A060YK16",
"8022.A0A060ZY85",
"8022.A0A060Y572",
"8022.A0A060VV08",
"8022.A0A060Y7J3",
"8022.A0A060XEQ2",
"8022.A0A060YNN1",
"8022.A0A060YY15",
"8022.A0A060YRA4",
"8022.A0A060YBG4",
"8022.A0A060W0X7",
"8022.A0A060Y8H0",
"8022.A0A060ZI18",
"8022.A0A060YP62",
"8022.A0A060XIQ6",
"8022.A0A060YZR7",
"8022.A0A060YRP0",
"8022.A0A060XXY2",
"8022.A0A060WIP0",
"8022.A0A060Y9P2",
"8022.A0A060W322",
"8022.A0A060WA27",
"8022.A0A060WHM3",
"8022.A0A060YI57",
"8022.A0A060W4Y9",
"8022.A0A060XHI7",
"8022.A0A060ZLI0",
"8022.A0A060X5X8",
"8022.A0A060VYX3",
"8022.A0A060VU13",
"8022.A0A060W897",
"8022.A0A060Y9R0",
"8022.A0A060XX90",
"8022.A0A060WVL3",
"8022.A0A060WPA9",
"8022.A0A060ZHP3",
"8022.A0A060XAY0",
"8022.A0A060WWG8",
"8022.A0A060WS82",
"8022.A0A060VX13",
"8022.A0A060W352",
"8022.A0A060WVE9",
"8022.A0A060WWN6",
"8022.A0A060X6L1",
"8022.A0A060Y2F6",
"8022.A0A061AE56",
"8022.A0A061A5I3",
"8022.A0A060W782",
"8022.A0A060XBG1",
"8022.A0A060VPV4",
"8022.A0A060WWC7",
"8022.A0A060XY19",
"8022.A0A060X451",
"8022.A0A060WXT5",
"8022.A0A060W1M5",
"8022.A0A060WL30",
"8022.A0A060X5Z6",
"8022.A0A060Y002",
"8022.A0A060XQN1",
"8022.A0A060XLE7",
"8022.A0A060WEB4",
"8022.A0A060W1W2",
"8022.A0A060Y374",
"8022.A0A060YT31",
"8022.A0A060XQ68",
"8022.A0A060XQV6",
"8022.A0A060XR98",
"8022.A0A060WRU8",
"8022.C1BFE0",
"8022.A0A060WR68",
"8022.A0A060W6P2",
"8022.A0A060YZH2",
"8022.A0A060Y7N3",
"8022.A0A061AFP5",
"8022.A0A060Y457",
"8022.A0A060X6C1",
"8022.A0A060Z1V4",
"8022.A0A060YEI0",
"8022.A0A060ZFF2",
"8022.A0A060YN45",
"8022.A0A060X7E8",
"8022.A0A060WBI8",
"8022.A0A060YI40",
"8022.A0A060WUV7",
"8022.A0A060YC16",
"8022.A0A060ZEV1",
"8022.A0A060XLD9",
"8022.A0A060Z5S7",
"8022.A0A060XFS5",
"8022.A0A060Z2G8",
"8022.A0A060WG87",
"8022.A0A060XAF0",
"8022.A0A060Y0X3",
"8022.A0A060XUG1",
"8022.A0A060VQU3",
"8022.A0A060X106",
"8022.A0A060XRG4",
"8022.A0A060WEA8",
"8022.A0A060W448",
"8022.A0A060VPR7",
"8022.A0A060YPM2",
"8022.A0A060XAK7",
"8022.A0A060Y4H0",
"8022.A0A060Z3J9",
"8022.A0A060X554",
"8022.A0A060WSC1",
"8022.A0A060WB43",
"8022.A0A060WMB2",
"8022.A0A061AEK9",
"8022.A0A060Y6Z6",
"8022.A0A060WZ37",
"8022.A0A060WPP4",
"8022.A0A060WXS1",
"8022.A0A060XV20",
"8022.A0A060Y539",
"8022.C1BEI8",
"8022.A0A060WTE4",
"8022.A0A060WKM3",
"8022.A0A060WLZ5",
"8022.C1BHD2",
"8022.O57399",
"8022.A0A060XRV8",
"8022.A0A060YTP7",
"8022.A0A060XZF7",
"8022.A0A060YGT3",
"8022.A0A060WSY5",
"8022.A0A060Z6P1",
"8022.A0A060XNW5",
"8022.A0A060X4P1",
"8022.A0A060Z2E0",
"8022.A0A060YU85"
] |
[
{
"protein2": "8022.A0A060WYJ9",
"neighborhood": 157,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 0,
"combined_score": 846
},
{
"protein2": "8022.A0A060YIP8",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060WRI4",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 358,
"database": 444,
"textmining": 221,
"combined_score": 701
},
{
"protein2": "8022.A0A060X2M1",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 757,
"database": 829,
"textmining": 309,
"combined_score": 969
},
{
"protein2": "8022.A0A060Y8P1",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 790,
"textmining": 136,
"combined_score": 812
},
{
"protein2": "8022.A0A060YMT8",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 825,
"experimental": 342,
"database": 523,
"textmining": 432,
"combined_score": 968
},
{
"protein2": "8022.A0A060XV67",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060XDC6",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 825,
"experimental": 342,
"database": 523,
"textmining": 432,
"combined_score": 968
},
{
"protein2": "8022.A0A060XS00",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 771,
"database": 835,
"textmining": 278,
"combined_score": 973
},
{
"protein2": "8022.A0A060W1Z0",
"neighborhood": 164,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 0,
"database": 518,
"textmining": 450,
"combined_score": 764
},
{
"protein2": "8022.A0A060Y5X7",
"neighborhood": 115,
"fusion": 0,
"cooccurence": 0,
"coexpression": 122,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 745
},
{
"protein2": "8022.A0A060YIM7",
"neighborhood": 141,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 826,
"textmining": 210,
"combined_score": 871
},
{
"protein2": "8022.A0A060ZAN1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 731,
"database": 0,
"textmining": 86,
"combined_score": 743
},
{
"protein2": "8022.A0A060YX04",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 156,
"experimental": 942,
"database": 830,
"textmining": 504,
"combined_score": 995
},
{
"protein2": "8022.A0A060X7K4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 0,
"database": 790,
"textmining": 130,
"combined_score": 818
},
{
"protein2": "8022.A0A060WM17",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 274,
"database": 823,
"textmining": 193,
"combined_score": 888
},
{
"protein2": "8022.A0A060XZP7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 120,
"experimental": 317,
"database": 827,
"textmining": 115,
"combined_score": 895
},
{
"protein2": "8022.A0A060XJT2",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060YVM7",
"neighborhood": 110,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 651,
"textmining": 231,
"combined_score": 766
},
{
"protein2": "8022.A0A060XZ37",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060ZEK4",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060YH61",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 120,
"experimental": 317,
"database": 827,
"textmining": 115,
"combined_score": 895
},
{
"protein2": "8022.A0A060W2G6",
"neighborhood": 162,
"fusion": 0,
"cooccurence": 0,
"coexpression": 140,
"experimental": 0,
"database": 772,
"textmining": 356,
"combined_score": 880
},
{
"protein2": "8022.A0A060YVA7",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 790,
"textmining": 136,
"combined_score": 812
},
{
"protein2": "8022.A0A060WUC8",
"neighborhood": 154,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 173,
"database": 649,
"textmining": 454,
"combined_score": 941
},
{
"protein2": "8022.A0A060X323",
"neighborhood": 143,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 660,
"textmining": 308,
"combined_score": 803
},
{
"protein2": "8022.A0A060XT37",
"neighborhood": 115,
"fusion": 0,
"cooccurence": 0,
"coexpression": 122,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 745
},
{
"protein2": "8022.A0A060Y1F8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 281,
"experimental": 0,
"database": 829,
"textmining": 155,
"combined_score": 887
},
{
"protein2": "8022.A0A060X0Y1",
"neighborhood": 154,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 173,
"database": 649,
"textmining": 454,
"combined_score": 941
},
{
"protein2": "8022.A0A060WIJ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 731,
"database": 0,
"textmining": 86,
"combined_score": 743
},
{
"protein2": "8022.A0A060XRD2",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 693,
"textmining": 139,
"combined_score": 756
},
{
"protein2": "8022.A0A060X616",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060Y6W1",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 170,
"experimental": 0,
"database": 569,
"textmining": 308,
"combined_score": 734
},
{
"protein2": "8022.A0A060VTF9",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 0,
"database": 790,
"textmining": 130,
"combined_score": 818
},
{
"protein2": "8022.A0A060WIJ2",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 757,
"database": 829,
"textmining": 309,
"combined_score": 969
},
{
"protein2": "8022.A0A060X8N3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060XKP6",
"neighborhood": 100,
"fusion": 0,
"cooccurence": 0,
"coexpression": 44,
"experimental": 0,
"database": 700,
"textmining": 340,
"combined_score": 806
},
{
"protein2": "8022.A0A060Z4R9",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 632,
"textmining": 220,
"combined_score": 735
},
{
"protein2": "8022.A0A060Z5F5",
"neighborhood": 43,
"fusion": 0,
"cooccurence": 0,
"coexpression": 167,
"experimental": 0,
"database": 437,
"textmining": 504,
"combined_score": 747
},
{
"protein2": "8022.A0A060YL26",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 532,
"database": 826,
"textmining": 308,
"combined_score": 942
},
{
"protein2": "8022.A0A060X713",
"neighborhood": 110,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 651,
"textmining": 231,
"combined_score": 766
},
{
"protein2": "8022.A0A060WQ25",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 766,
"database": 839,
"textmining": 265,
"combined_score": 972
},
{
"protein2": "8022.A0A060WLB7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 316,
"database": 568,
"textmining": 87,
"combined_score": 722
},
{
"protein2": "8022.A0A060VUU1",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 790,
"textmining": 136,
"combined_score": 812
},
{
"protein2": "8022.A0A060XSN8",
"neighborhood": 93,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 178,
"database": 640,
"textmining": 208,
"combined_score": 758
},
{
"protein2": "8022.A0A060ZNH6",
"neighborhood": 141,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 826,
"textmining": 210,
"combined_score": 871
},
{
"protein2": "8022.A0A060XH06",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 841,
"textmining": 136,
"combined_score": 858
},
{
"protein2": "8022.A0A060Y5I2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 0,
"database": 772,
"textmining": 0,
"combined_score": 778
},
{
"protein2": "8022.A0A060XXN7",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 790,
"textmining": 136,
"combined_score": 812
},
{
"protein2": "8022.A0A060Z5F3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 504,
"database": 825,
"textmining": 275,
"combined_score": 935
},
{
"protein2": "8022.A0A060WEI1",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 862,
"textmining": 136,
"combined_score": 876
},
{
"protein2": "8022.A0A060WQP2",
"neighborhood": 154,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 173,
"database": 649,
"textmining": 454,
"combined_score": 941
},
{
"protein2": "8022.A0A060XVJ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 281,
"experimental": 0,
"database": 829,
"textmining": 155,
"combined_score": 887
},
{
"protein2": "8022.A0A060WHB4",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 632,
"textmining": 220,
"combined_score": 735
},
{
"protein2": "8022.A0A060Z1C5",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 825,
"experimental": 342,
"database": 523,
"textmining": 432,
"combined_score": 968
},
{
"protein2": "8022.A0A060VZV0",
"neighborhood": 144,
"fusion": 0,
"cooccurence": 0,
"coexpression": 222,
"experimental": 182,
"database": 630,
"textmining": 191,
"combined_score": 807
},
{
"protein2": "8022.A0A060YTQ2",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 757,
"database": 832,
"textmining": 309,
"combined_score": 969
},
{
"protein2": "8022.A0A060VWG1",
"neighborhood": 144,
"fusion": 0,
"cooccurence": 0,
"coexpression": 222,
"experimental": 182,
"database": 630,
"textmining": 191,
"combined_score": 807
},
{
"protein2": "8022.A0A060YL98",
"neighborhood": 162,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 772,
"textmining": 365,
"combined_score": 878
},
{
"protein2": "8022.A0A060XU63",
"neighborhood": 53,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 158,
"database": 602,
"textmining": 270,
"combined_score": 741
},
{
"protein2": "8022.A0A060Y534",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 272,
"experimental": 0,
"database": 825,
"textmining": 134,
"combined_score": 880
},
{
"protein2": "8022.A0A060XNY0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 120,
"experimental": 317,
"database": 816,
"textmining": 115,
"combined_score": 889
},
{
"protein2": "8022.A0A060WH90",
"neighborhood": 93,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 178,
"database": 640,
"textmining": 208,
"combined_score": 758
},
{
"protein2": "8022.A0A060XSM8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 244,
"database": 693,
"textmining": 308,
"combined_score": 825
},
{
"protein2": "8022.A0A060YTG3",
"neighborhood": 93,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 178,
"database": 640,
"textmining": 208,
"combined_score": 758
},
{
"protein2": "8022.A0A060YNX7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060VUY5",
"neighborhood": 142,
"fusion": 0,
"cooccurence": 0,
"coexpression": 374,
"experimental": 321,
"database": 835,
"textmining": 505,
"combined_score": 964
},
{
"protein2": "8022.A0A060X1P8",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 757,
"database": 829,
"textmining": 309,
"combined_score": 969
},
{
"protein2": "8022.A0A060YMQ1",
"neighborhood": 155,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 612,
"textmining": 260,
"combined_score": 780
},
{
"protein2": "8022.A0A060W283",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 0,
"database": 790,
"textmining": 130,
"combined_score": 818
},
{
"protein2": "8022.A0A061ADV4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 771,
"database": 839,
"textmining": 278,
"combined_score": 973
},
{
"protein2": "8022.A0A060YFV0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 696,
"database": 829,
"textmining": 87,
"combined_score": 950
},
{
"protein2": "8022.A0A060YQV7",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060YDL6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 450,
"combined_score": 899
},
{
"protein2": "8022.A0A060YV74",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 361,
"database": 825,
"textmining": 450,
"combined_score": 933
},
{
"protein2": "8022.A0A060YAF5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 120,
"experimental": 317,
"database": 827,
"textmining": 115,
"combined_score": 895
},
{
"protein2": "8022.A0A060XUT6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060Y0T0",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060WA02",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 281,
"experimental": 0,
"database": 829,
"textmining": 155,
"combined_score": 887
},
{
"protein2": "8022.A0A060X8L2",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 358,
"database": 444,
"textmining": 221,
"combined_score": 701
},
{
"protein2": "8022.A0A060WZJ0",
"neighborhood": 110,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 651,
"textmining": 231,
"combined_score": 766
},
{
"protein2": "8022.A0A060YFS3",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060YZG3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 156,
"experimental": 942,
"database": 830,
"textmining": 504,
"combined_score": 995
},
{
"protein2": "8022.A0A060YFA7",
"neighborhood": 141,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 826,
"textmining": 210,
"combined_score": 871
},
{
"protein2": "8022.A0A060XT54",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 281,
"experimental": 0,
"database": 826,
"textmining": 155,
"combined_score": 885
},
{
"protein2": "8022.A0A060YBJ4",
"neighborhood": 141,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 826,
"textmining": 210,
"combined_score": 871
},
{
"protein2": "8022.A0A060Y786",
"neighborhood": 93,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 178,
"database": 640,
"textmining": 208,
"combined_score": 758
},
{
"protein2": "8022.A0A060W0B2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 731,
"database": 0,
"textmining": 86,
"combined_score": 743
},
{
"protein2": "8022.A0A060WLM0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 51,
"experimental": 834,
"database": 421,
"textmining": 262,
"combined_score": 923
},
{
"protein2": "8022.A0A060XV30",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 771,
"database": 835,
"textmining": 278,
"combined_score": 973
},
{
"protein2": "8022.A0A060XD51",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 825,
"experimental": 342,
"database": 523,
"textmining": 432,
"combined_score": 968
},
{
"protein2": "8022.A0A060Y609",
"neighborhood": 110,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 651,
"textmining": 231,
"combined_score": 766
},
{
"protein2": "8022.A0A060Y709",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 731,
"database": 0,
"textmining": 86,
"combined_score": 743
},
{
"protein2": "8022.A0A060VZH4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060XRX7",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 757,
"database": 832,
"textmining": 309,
"combined_score": 969
},
{
"protein2": "8022.A0A060Y2C4",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 757,
"database": 829,
"textmining": 309,
"combined_score": 969
},
{
"protein2": "8022.A0A061A4H1",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 790,
"textmining": 136,
"combined_score": 812
},
{
"protein2": "8022.A0A060XG53",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060WVD8",
"neighborhood": 154,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 173,
"database": 649,
"textmining": 454,
"combined_score": 941
},
{
"protein2": "8022.A0A060Y501",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 841,
"textmining": 136,
"combined_score": 858
},
{
"protein2": "8022.A0A060VWH8",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 0,
"database": 790,
"textmining": 130,
"combined_score": 818
},
{
"protein2": "8022.A0A060VVL9",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 657,
"textmining": 155,
"combined_score": 702
},
{
"protein2": "8022.A0A060WT58",
"neighborhood": 154,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 173,
"database": 649,
"textmining": 454,
"combined_score": 941
},
{
"protein2": "8022.A0A060XTP5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 696,
"database": 829,
"textmining": 87,
"combined_score": 950
},
{
"protein2": "8022.A0A060XS33",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 244,
"database": 693,
"textmining": 308,
"combined_score": 825
},
{
"protein2": "8022.A0A060XEX3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 156,
"experimental": 908,
"database": 824,
"textmining": 448,
"combined_score": 991
},
{
"protein2": "8022.A0A060XSY3",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 358,
"database": 444,
"textmining": 232,
"combined_score": 705
},
{
"protein2": "8022.A0A060WIW7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 120,
"experimental": 317,
"database": 816,
"textmining": 115,
"combined_score": 889
},
{
"protein2": "8022.A0A060Y7A8",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 316,
"database": 568,
"textmining": 87,
"combined_score": 722
},
{
"protein2": "8022.A0A060W866",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 0,
"database": 790,
"textmining": 130,
"combined_score": 818
},
{
"protein2": "8022.A0A060XSB7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 0,
"database": 772,
"textmining": 0,
"combined_score": 778
},
{
"protein2": "8022.A0A060YFV9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 771,
"database": 835,
"textmining": 278,
"combined_score": 973
},
{
"protein2": "8022.A0A060WPP2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 771,
"database": 835,
"textmining": 278,
"combined_score": 973
},
{
"protein2": "8022.A0A060Z9N9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 696,
"database": 829,
"textmining": 87,
"combined_score": 950
},
{
"protein2": "8022.A0A060WN87",
"neighborhood": 93,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 326,
"database": 640,
"textmining": 208,
"combined_score": 802
},
{
"protein2": "8022.A0A060WW06",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 274,
"database": 828,
"textmining": 193,
"combined_score": 892
},
{
"protein2": "8022.A0A060YSL4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 272,
"experimental": 0,
"database": 825,
"textmining": 134,
"combined_score": 880
},
{
"protein2": "8022.A0A060Z3H1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 357,
"database": 693,
"textmining": 293,
"combined_score": 848
},
{
"protein2": "8022.A0A060Y3N1",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 825,
"experimental": 342,
"database": 523,
"textmining": 432,
"combined_score": 968
},
{
"protein2": "8022.A0A060W8A2",
"neighborhood": 162,
"fusion": 0,
"cooccurence": 0,
"coexpression": 140,
"experimental": 0,
"database": 772,
"textmining": 356,
"combined_score": 880
},
{
"protein2": "8022.A0A060Y7X3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060Z1E1",
"neighborhood": 93,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 178,
"database": 640,
"textmining": 208,
"combined_score": 758
},
{
"protein2": "8022.A0A060XPD8",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 532,
"database": 826,
"textmining": 308,
"combined_score": 942
},
{
"protein2": "8022.Q91381",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060XLL5",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 170,
"experimental": 0,
"database": 569,
"textmining": 308,
"combined_score": 734
},
{
"protein2": "8022.A0A060XTV9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 321,
"database": 346,
"textmining": 507,
"combined_score": 761
},
{
"protein2": "8022.A0A060XC32",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060WW97",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060XUP8",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060Y4C1",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 826,
"textmining": 136,
"combined_score": 844
},
{
"protein2": "8022.A0A060WGP6",
"neighborhood": 162,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 835,
"textmining": 365,
"combined_score": 904
},
{
"protein2": "8022.A0A060VTH4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 0,
"database": 790,
"textmining": 130,
"combined_score": 818
},
{
"protein2": "8022.A0A060W7I7",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 632,
"textmining": 220,
"combined_score": 735
},
{
"protein2": "8022.A0A060YBV8",
"neighborhood": 100,
"fusion": 0,
"cooccurence": 0,
"coexpression": 44,
"experimental": 0,
"database": 700,
"textmining": 340,
"combined_score": 806
},
{
"protein2": "8022.A0A060YBX5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 156,
"experimental": 908,
"database": 824,
"textmining": 448,
"combined_score": 991
},
{
"protein2": "8022.C1BGD2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 438,
"database": 825,
"textmining": 444,
"combined_score": 940
},
{
"protein2": "8022.A0A060VMQ1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 120,
"experimental": 317,
"database": 816,
"textmining": 115,
"combined_score": 889
},
{
"protein2": "8022.A0A060XW24",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 731,
"database": 0,
"textmining": 86,
"combined_score": 743
},
{
"protein2": "8022.A0A060WSG3",
"neighborhood": 108,
"fusion": 0,
"cooccurence": 0,
"coexpression": 51,
"experimental": 0,
"database": 825,
"textmining": 435,
"combined_score": 905
},
{
"protein2": "8022.A0A060W0M8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 771,
"database": 832,
"textmining": 278,
"combined_score": 972
},
{
"protein2": "8022.A0A060YL36",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 316,
"database": 568,
"textmining": 87,
"combined_score": 722
},
{
"protein2": "8022.A0A060VSR1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060VX16",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 787,
"textmining": 0,
"combined_score": 790
},
{
"protein2": "8022.A0A060YH63",
"neighborhood": 144,
"fusion": 0,
"cooccurence": 0,
"coexpression": 222,
"experimental": 182,
"database": 630,
"textmining": 191,
"combined_score": 807
},
{
"protein2": "8022.A0A060ZF19",
"neighborhood": 156,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 115,
"database": 835,
"textmining": 433,
"combined_score": 928
},
{
"protein2": "8022.A0A060X514",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 786
},
{
"protein2": "8022.A0A060YJA5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060YLW3",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 349,
"combined_score": 751
},
{
"protein2": "8022.A0A060W2L4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 504,
"database": 825,
"textmining": 275,
"combined_score": 935
},
{
"protein2": "8022.A0A060XIF0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 771,
"database": 832,
"textmining": 278,
"combined_score": 972
},
{
"protein2": "8022.C1BI55",
"neighborhood": 162,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 835,
"textmining": 365,
"combined_score": 904
},
{
"protein2": "8022.A0A060XER1",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 841,
"textmining": 136,
"combined_score": 858
},
{
"protein2": "8022.A0A060Y7D9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 787,
"textmining": 0,
"combined_score": 790
},
{
"protein2": "8022.A0A060W299",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 825,
"experimental": 342,
"database": 523,
"textmining": 432,
"combined_score": 968
},
{
"protein2": "8022.A0A060YEQ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 159,
"database": 693,
"textmining": 150,
"combined_score": 761
},
{
"protein2": "8022.A0A061A6F9",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 693,
"textmining": 139,
"combined_score": 756
},
{
"protein2": "8022.A0A060Y189",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 757,
"database": 829,
"textmining": 309,
"combined_score": 969
},
{
"protein2": "8022.A0A060X8J0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060Z6M0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 731,
"database": 0,
"textmining": 86,
"combined_score": 743
},
{
"protein2": "8022.A0A060VRS4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060YE51",
"neighborhood": 43,
"fusion": 0,
"cooccurence": 0,
"coexpression": 346,
"experimental": 0,
"database": 832,
"textmining": 505,
"combined_score": 940
},
{
"protein2": "8022.A0A060XLG3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 696,
"database": 829,
"textmining": 87,
"combined_score": 950
},
{
"protein2": "8022.A0A060VZ75",
"neighborhood": 142,
"fusion": 0,
"cooccurence": 0,
"coexpression": 374,
"experimental": 321,
"database": 835,
"textmining": 505,
"combined_score": 964
},
{
"protein2": "8022.A0A060YXZ4",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 632,
"textmining": 220,
"combined_score": 735
},
{
"protein2": "8022.A0A060VZK5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 657,
"textmining": 155,
"combined_score": 702
},
{
"protein2": "8022.A0A060X3J8",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 757,
"database": 832,
"textmining": 309,
"combined_score": 969
},
{
"protein2": "8022.A0A060YAU7",
"neighborhood": 155,
"fusion": 0,
"cooccurence": 0,
"coexpression": 218,
"experimental": 0,
"database": 660,
"textmining": 273,
"combined_score": 814
},
{
"protein2": "8022.A0A060YBC9",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 632,
"textmining": 220,
"combined_score": 735
},
{
"protein2": "8022.A0A060W6I3",
"neighborhood": 141,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 210,
"combined_score": 870
},
{
"protein2": "8022.A0A060W3W4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 771,
"database": 832,
"textmining": 278,
"combined_score": 972
},
{
"protein2": "8022.A0A060XG99",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 46,
"experimental": 454,
"database": 825,
"textmining": 450,
"combined_score": 943
},
{
"protein2": "8022.A0A060W7G4",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 787,
"textmining": 136,
"combined_score": 810
},
{
"protein2": "8022.A0A060YB62",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 787,
"textmining": 0,
"combined_score": 790
},
{
"protein2": "8022.A0A060VVS9",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 657,
"textmining": 155,
"combined_score": 702
},
{
"protein2": "8022.A0A060WKQ0",
"neighborhood": 128,
"fusion": 0,
"cooccurence": 0,
"coexpression": 47,
"experimental": 0,
"database": 825,
"textmining": 0,
"combined_score": 841
},
{
"protein2": "8022.A0A060XFQ4",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 825,
"experimental": 342,
"database": 523,
"textmining": 432,
"combined_score": 968
},
{
"protein2": "8022.A0A060XN85",
"neighborhood": 128,
"fusion": 0,
"cooccurence": 0,
"coexpression": 47,
"experimental": 0,
"database": 825,
"textmining": 0,
"combined_score": 841
},
{
"protein2": "8022.A0A060Z7M7",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 825,
"experimental": 342,
"database": 523,
"textmining": 432,
"combined_score": 968
},
{
"protein2": "8022.A0A060VTG5",
"neighborhood": 50,
"fusion": 0,
"cooccurence": 0,
"coexpression": 780,
"experimental": 174,
"database": 645,
"textmining": 391,
"combined_score": 955
},
{
"protein2": "8022.A0A060ZCK7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 120,
"experimental": 317,
"database": 816,
"textmining": 115,
"combined_score": 889
},
{
"protein2": "8022.A0A060Z909",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 825,
"experimental": 342,
"database": 523,
"textmining": 432,
"combined_score": 968
},
{
"protein2": "8022.A0A060WAZ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 771,
"database": 835,
"textmining": 278,
"combined_score": 973
},
{
"protein2": "8022.A0A060VPT7",
"neighborhood": 143,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 660,
"textmining": 276,
"combined_score": 794
},
{
"protein2": "8022.A0A060WNW6",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 532,
"database": 862,
"textmining": 308,
"combined_score": 954
},
{
"protein2": "8022.A0A060X8J2",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 632,
"textmining": 220,
"combined_score": 735
},
{
"protein2": "8022.A0A060WVF2",
"neighborhood": 93,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 326,
"database": 640,
"textmining": 208,
"combined_score": 802
},
{
"protein2": "8022.A0A060VY18",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 757,
"database": 830,
"textmining": 309,
"combined_score": 969
},
{
"protein2": "8022.A0A060Y703",
"neighborhood": 144,
"fusion": 0,
"cooccurence": 0,
"coexpression": 222,
"experimental": 182,
"database": 630,
"textmining": 209,
"combined_score": 811
},
{
"protein2": "8022.A0A060VUC1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 88,
"combined_score": 783
},
{
"protein2": "8022.A0A060VZV9",
"neighborhood": 144,
"fusion": 0,
"cooccurence": 0,
"coexpression": 222,
"experimental": 182,
"database": 630,
"textmining": 191,
"combined_score": 807
},
{
"protein2": "8022.A0A060XF64",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060XXT9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 731,
"database": 0,
"textmining": 86,
"combined_score": 743
},
{
"protein2": "8022.A0A060YWZ4",
"neighborhood": 50,
"fusion": 0,
"cooccurence": 0,
"coexpression": 780,
"experimental": 174,
"database": 645,
"textmining": 391,
"combined_score": 955
},
{
"protein2": "8022.A0A060X4I5",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 790,
"textmining": 136,
"combined_score": 812
},
{
"protein2": "8022.A0A060X549",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 0,
"database": 790,
"textmining": 130,
"combined_score": 818
},
{
"protein2": "8022.A0A060YT42",
"neighborhood": 93,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 326,
"database": 640,
"textmining": 208,
"combined_score": 802
},
{
"protein2": "8022.A0A060WA73",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 274,
"database": 823,
"textmining": 193,
"combined_score": 888
},
{
"protein2": "8022.A0A060XSA5",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 0,
"database": 790,
"textmining": 130,
"combined_score": 818
},
{
"protein2": "8022.A0A060XYQ2",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 693,
"textmining": 139,
"combined_score": 756
},
{
"protein2": "8022.A0A060WIM8",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 532,
"database": 826,
"textmining": 308,
"combined_score": 942
},
{
"protein2": "8022.A0A060W5K0",
"neighborhood": 43,
"fusion": 0,
"cooccurence": 0,
"coexpression": 346,
"experimental": 0,
"database": 841,
"textmining": 505,
"combined_score": 944
},
{
"protein2": "8022.A0A060ZGG9",
"neighborhood": 43,
"fusion": 0,
"cooccurence": 0,
"coexpression": 167,
"experimental": 0,
"database": 437,
"textmining": 504,
"combined_score": 747
},
{
"protein2": "8022.A0A060WBX7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060W580",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060YK16",
"neighborhood": 156,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 115,
"database": 835,
"textmining": 433,
"combined_score": 928
},
{
"protein2": "8022.A0A060ZY85",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 0,
"database": 790,
"textmining": 130,
"combined_score": 818
},
{
"protein2": "8022.A0A060Y572",
"neighborhood": 155,
"fusion": 0,
"cooccurence": 0,
"coexpression": 218,
"experimental": 0,
"database": 660,
"textmining": 273,
"combined_score": 814
},
{
"protein2": "8022.A0A060VV08",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 281,
"experimental": 0,
"database": 829,
"textmining": 155,
"combined_score": 887
},
{
"protein2": "8022.A0A060Y7J3",
"neighborhood": 155,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 612,
"textmining": 260,
"combined_score": 780
},
{
"protein2": "8022.A0A060XEQ2",
"neighborhood": 155,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 612,
"textmining": 260,
"combined_score": 780
},
{
"protein2": "8022.A0A060YNN1",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 358,
"database": 444,
"textmining": 232,
"combined_score": 705
},
{
"protein2": "8022.A0A060YY15",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 825,
"experimental": 342,
"database": 523,
"textmining": 432,
"combined_score": 968
},
{
"protein2": "8022.A0A060YRA4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 244,
"database": 693,
"textmining": 308,
"combined_score": 825
},
{
"protein2": "8022.A0A060YBG4",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060W0X7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 120,
"experimental": 317,
"database": 816,
"textmining": 115,
"combined_score": 889
},
{
"protein2": "8022.A0A060Y8H0",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 505,
"combined_score": 810
},
{
"protein2": "8022.A0A060ZI18",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 156,
"experimental": 908,
"database": 824,
"textmining": 448,
"combined_score": 991
},
{
"protein2": "8022.A0A060YP62",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 787,
"textmining": 0,
"combined_score": 790
},
{
"protein2": "8022.A0A060XIQ6",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 532,
"database": 832,
"textmining": 308,
"combined_score": 944
},
{
"protein2": "8022.A0A060YZR7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 731,
"database": 0,
"textmining": 86,
"combined_score": 743
},
{
"protein2": "8022.A0A060YRP0",
"neighborhood": 163,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 0,
"database": 825,
"textmining": 454,
"combined_score": 915
},
{
"protein2": "8022.A0A060XXY2",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 532,
"database": 826,
"textmining": 308,
"combined_score": 942
},
{
"protein2": "8022.A0A060WIP0",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060Y9P2",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060W322",
"neighborhood": 155,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 612,
"textmining": 260,
"combined_score": 780
},
{
"protein2": "8022.A0A060WA27",
"neighborhood": 50,
"fusion": 0,
"cooccurence": 0,
"coexpression": 780,
"experimental": 174,
"database": 645,
"textmining": 391,
"combined_score": 955
},
{
"protein2": "8022.A0A060WHM3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 0,
"database": 790,
"textmining": 130,
"combined_score": 818
},
{
"protein2": "8022.A0A060YI57",
"neighborhood": 141,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 826,
"textmining": 210,
"combined_score": 871
},
{
"protein2": "8022.A0A060W4Y9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 771,
"database": 835,
"textmining": 278,
"combined_score": 973
},
{
"protein2": "8022.A0A060XHI7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060ZLI0",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 601,
"experimental": 0,
"database": 140,
"textmining": 308,
"combined_score": 773
},
{
"protein2": "8022.A0A060X5X8",
"neighborhood": 92,
"fusion": 0,
"cooccurence": 0,
"coexpression": 151,
"experimental": 115,
"database": 602,
"textmining": 258,
"combined_score": 761
},
{
"protein2": "8022.A0A060VYX3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060VU13",
"neighborhood": 144,
"fusion": 0,
"cooccurence": 0,
"coexpression": 222,
"experimental": 182,
"database": 630,
"textmining": 209,
"combined_score": 811
},
{
"protein2": "8022.A0A060W897",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060Y9R0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 120,
"experimental": 317,
"database": 827,
"textmining": 115,
"combined_score": 895
},
{
"protein2": "8022.A0A060XX90",
"neighborhood": 50,
"fusion": 0,
"cooccurence": 0,
"coexpression": 780,
"experimental": 174,
"database": 645,
"textmining": 391,
"combined_score": 955
},
{
"protein2": "8022.A0A060WVL3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 787,
"textmining": 0,
"combined_score": 790
},
{
"protein2": "8022.A0A060WPA9",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 170,
"experimental": 0,
"database": 569,
"textmining": 308,
"combined_score": 734
},
{
"protein2": "8022.A0A060ZHP3",
"neighborhood": 144,
"fusion": 0,
"cooccurence": 0,
"coexpression": 222,
"experimental": 182,
"database": 630,
"textmining": 191,
"combined_score": 807
},
{
"protein2": "8022.A0A060XAY0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060WWG8",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 0,
"database": 790,
"textmining": 130,
"combined_score": 818
},
{
"protein2": "8022.A0A060WS82",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 731,
"database": 0,
"textmining": 86,
"combined_score": 743
},
{
"protein2": "8022.A0A060VX13",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 120,
"experimental": 317,
"database": 827,
"textmining": 115,
"combined_score": 895
},
{
"protein2": "8022.A0A060W352",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060WVE9",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 601,
"experimental": 0,
"database": 140,
"textmining": 308,
"combined_score": 773
},
{
"protein2": "8022.A0A060WWN6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 766,
"database": 839,
"textmining": 265,
"combined_score": 972
},
{
"protein2": "8022.A0A060X6L1",
"neighborhood": 139,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 53,
"database": 693,
"textmining": 308,
"combined_score": 803
},
{
"protein2": "8022.A0A060Y2F6",
"neighborhood": 143,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 660,
"textmining": 276,
"combined_score": 794
},
{
"protein2": "8022.A0A061AE56",
"neighborhood": 144,
"fusion": 0,
"cooccurence": 0,
"coexpression": 222,
"experimental": 182,
"database": 630,
"textmining": 191,
"combined_score": 807
},
{
"protein2": "8022.A0A061A5I3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 156,
"experimental": 942,
"database": 862,
"textmining": 504,
"combined_score": 996
},
{
"protein2": "8022.A0A060W782",
"neighborhood": 92,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 115,
"database": 602,
"textmining": 498,
"combined_score": 836
},
{
"protein2": "8022.A0A060XBG1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 120,
"experimental": 317,
"database": 816,
"textmining": 115,
"combined_score": 889
},
{
"protein2": "8022.A0A060VPV4",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 274,
"database": 828,
"textmining": 193,
"combined_score": 892
},
{
"protein2": "8022.A0A060WWC7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 532,
"database": 832,
"textmining": 308,
"combined_score": 944
},
{
"protein2": "8022.A0A060XY19",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 51,
"experimental": 470,
"database": 421,
"textmining": 119,
"combined_score": 709
},
{
"protein2": "8022.A0A060X451",
"neighborhood": 139,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 53,
"database": 693,
"textmining": 308,
"combined_score": 803
},
{
"protein2": "8022.A0A060WXT5",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 0,
"database": 790,
"textmining": 130,
"combined_score": 818
},
{
"protein2": "8022.A0A060W1M5",
"neighborhood": 50,
"fusion": 0,
"cooccurence": 0,
"coexpression": 780,
"experimental": 174,
"database": 645,
"textmining": 391,
"combined_score": 955
},
{
"protein2": "8022.A0A060WL30",
"neighborhood": 43,
"fusion": 0,
"cooccurence": 0,
"coexpression": 346,
"experimental": 0,
"database": 841,
"textmining": 505,
"combined_score": 944
},
{
"protein2": "8022.A0A060X5Z6",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060Y002",
"neighborhood": 144,
"fusion": 0,
"cooccurence": 0,
"coexpression": 222,
"experimental": 182,
"database": 630,
"textmining": 191,
"combined_score": 807
},
{
"protein2": "8022.A0A060XQN1",
"neighborhood": 53,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 158,
"database": 602,
"textmining": 270,
"combined_score": 741
},
{
"protein2": "8022.A0A060XLE7",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 841,
"textmining": 136,
"combined_score": 858
},
{
"protein2": "8022.A0A060WEB4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 51,
"experimental": 834,
"database": 421,
"textmining": 262,
"combined_score": 923
},
{
"protein2": "8022.A0A060W1W2",
"neighborhood": 53,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 158,
"database": 602,
"textmining": 270,
"combined_score": 741
},
{
"protein2": "8022.A0A060Y374",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 770,
"database": 0,
"textmining": 176,
"combined_score": 802
},
{
"protein2": "8022.A0A060YT31",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 771,
"database": 835,
"textmining": 278,
"combined_score": 973
},
{
"protein2": "8022.A0A060XQ68",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 601,
"experimental": 0,
"database": 140,
"textmining": 308,
"combined_score": 773
},
{
"protein2": "8022.A0A060XQV6",
"neighborhood": 128,
"fusion": 0,
"cooccurence": 0,
"coexpression": 47,
"experimental": 0,
"database": 825,
"textmining": 0,
"combined_score": 841
},
{
"protein2": "8022.A0A060XR98",
"neighborhood": 161,
"fusion": 0,
"cooccurence": 0,
"coexpression": 54,
"experimental": 0,
"database": 772,
"textmining": 358,
"combined_score": 868
},
{
"protein2": "8022.A0A060WRU8",
"neighborhood": 54,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 358,
"database": 444,
"textmining": 221,
"combined_score": 701
},
{
"protein2": "8022.C1BFE0",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060WR68",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 156,
"experimental": 942,
"database": 839,
"textmining": 504,
"combined_score": 995
},
{
"protein2": "8022.A0A060W6P2",
"neighborhood": 141,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 210,
"combined_score": 870
},
{
"protein2": "8022.A0A060YZH2",
"neighborhood": 161,
"fusion": 0,
"cooccurence": 0,
"coexpression": 54,
"experimental": 0,
"database": 772,
"textmining": 358,
"combined_score": 868
},
{
"protein2": "8022.A0A060Y7N3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 325,
"database": 825,
"textmining": 368,
"combined_score": 918
},
{
"protein2": "8022.A0A061AFP5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 159,
"database": 693,
"textmining": 150,
"combined_score": 761
},
{
"protein2": "8022.A0A060Y457",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 770,
"database": 0,
"textmining": 176,
"combined_score": 802
},
{
"protein2": "8022.A0A060X6C1",
"neighborhood": 155,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 612,
"textmining": 260,
"combined_score": 780
},
{
"protein2": "8022.A0A060Z1V4",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 657,
"textmining": 155,
"combined_score": 702
},
{
"protein2": "8022.A0A060YEI0",
"neighborhood": 141,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 826,
"textmining": 210,
"combined_score": 871
},
{
"protein2": "8022.A0A060ZFF2",
"neighborhood": 141,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 826,
"textmining": 210,
"combined_score": 871
},
{
"protein2": "8022.A0A060YN45",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 170,
"experimental": 0,
"database": 569,
"textmining": 308,
"combined_score": 734
},
{
"protein2": "8022.A0A060X7E8",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 632,
"textmining": 220,
"combined_score": 735
},
{
"protein2": "8022.A0A060WBI8",
"neighborhood": 93,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 178,
"database": 640,
"textmining": 208,
"combined_score": 758
},
{
"protein2": "8022.A0A060YI40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 281,
"experimental": 0,
"database": 829,
"textmining": 155,
"combined_score": 887
},
{
"protein2": "8022.A0A060WUV7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 156,
"experimental": 908,
"database": 824,
"textmining": 448,
"combined_score": 991
},
{
"protein2": "8022.A0A060YC16",
"neighborhood": 53,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 158,
"database": 602,
"textmining": 270,
"combined_score": 741
},
{
"protein2": "8022.A0A060ZEV1",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 0,
"database": 790,
"textmining": 130,
"combined_score": 818
},
{
"protein2": "8022.A0A060XLD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 766,
"database": 839,
"textmining": 265,
"combined_score": 972
},
{
"protein2": "8022.A0A060Z5S7",
"neighborhood": 143,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 283,
"combined_score": 883
},
{
"protein2": "8022.A0A060XFS5",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 786
},
{
"protein2": "8022.A0A060Z2G8",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 958,
"experimental": 773,
"database": 973,
"textmining": 513,
"combined_score": 999
},
{
"protein2": "8022.A0A060WG87",
"neighborhood": 93,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 178,
"database": 640,
"textmining": 208,
"combined_score": 758
},
{
"protein2": "8022.A0A060XAF0",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 349,
"combined_score": 751
},
{
"protein2": "8022.A0A060Y0X3",
"neighborhood": 50,
"fusion": 0,
"cooccurence": 0,
"coexpression": 780,
"experimental": 174,
"database": 645,
"textmining": 391,
"combined_score": 955
},
{
"protein2": "8022.A0A060XUG1",
"neighborhood": 162,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 772,
"textmining": 365,
"combined_score": 878
},
{
"protein2": "8022.A0A060VQU3",
"neighborhood": 144,
"fusion": 0,
"cooccurence": 0,
"coexpression": 222,
"experimental": 182,
"database": 630,
"textmining": 191,
"combined_score": 807
},
{
"protein2": "8022.A0A060X106",
"neighborhood": 144,
"fusion": 0,
"cooccurence": 0,
"coexpression": 222,
"experimental": 182,
"database": 630,
"textmining": 209,
"combined_score": 811
},
{
"protein2": "8022.A0A060XRG4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 739,
"textmining": 333,
"combined_score": 818
},
{
"protein2": "8022.A0A060WEA8",
"neighborhood": 155,
"fusion": 0,
"cooccurence": 0,
"coexpression": 218,
"experimental": 0,
"database": 660,
"textmining": 273,
"combined_score": 814
},
{
"protein2": "8022.A0A060W448",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 771,
"database": 835,
"textmining": 278,
"combined_score": 973
},
{
"protein2": "8022.A0A060VPR7",
"neighborhood": 110,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 651,
"textmining": 231,
"combined_score": 766
},
{
"protein2": "8022.A0A060YPM2",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 826,
"textmining": 136,
"combined_score": 844
},
{
"protein2": "8022.A0A060XAK7",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 592,
"experimental": 0,
"database": 689,
"textmining": 308,
"combined_score": 916
},
{
"protein2": "8022.A0A060Y4H0",
"neighborhood": 50,
"fusion": 0,
"cooccurence": 0,
"coexpression": 780,
"experimental": 174,
"database": 645,
"textmining": 391,
"combined_score": 955
},
{
"protein2": "8022.A0A060Z3J9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 357,
"database": 693,
"textmining": 293,
"combined_score": 848
},
{
"protein2": "8022.A0A060X554",
"neighborhood": 139,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 53,
"database": 693,
"textmining": 308,
"combined_score": 803
},
{
"protein2": "8022.A0A060WSC1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 156,
"experimental": 908,
"database": 824,
"textmining": 448,
"combined_score": 991
},
{
"protein2": "8022.A0A060WB43",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 632,
"textmining": 220,
"combined_score": 735
},
{
"protein2": "8022.A0A060WMB2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 50,
"experimental": 260,
"database": 619,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A061AEK9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 357,
"database": 693,
"textmining": 293,
"combined_score": 848
},
{
"protein2": "8022.A0A060Y6Z6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 120,
"experimental": 317,
"database": 827,
"textmining": 115,
"combined_score": 895
},
{
"protein2": "8022.A0A060WZ37",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 316,
"database": 568,
"textmining": 87,
"combined_score": 722
},
{
"protein2": "8022.A0A060WPP4",
"neighborhood": 154,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 173,
"database": 649,
"textmining": 454,
"combined_score": 941
},
{
"protein2": "8022.A0A060WXS1",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 316,
"database": 568,
"textmining": 87,
"combined_score": 722
},
{
"protein2": "8022.A0A060XV20",
"neighborhood": 143,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 660,
"textmining": 276,
"combined_score": 794
},
{
"protein2": "8022.A0A060Y539",
"neighborhood": 50,
"fusion": 0,
"cooccurence": 0,
"coexpression": 780,
"experimental": 174,
"database": 645,
"textmining": 391,
"combined_score": 955
},
{
"protein2": "8022.C1BEI8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 159,
"database": 693,
"textmining": 150,
"combined_score": 761
},
{
"protein2": "8022.A0A060WTE4",
"neighborhood": 110,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 651,
"textmining": 231,
"combined_score": 766
},
{
"protein2": "8022.A0A060WKM3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 281,
"experimental": 0,
"database": 826,
"textmining": 155,
"combined_score": 885
},
{
"protein2": "8022.A0A060WLZ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 696,
"database": 829,
"textmining": 87,
"combined_score": 950
},
{
"protein2": "8022.C1BHD2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 422,
"combined_score": 894
},
{
"protein2": "8022.O57399",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 731,
"database": 0,
"textmining": 86,
"combined_score": 743
},
{
"protein2": "8022.A0A060XRV8",
"neighborhood": 155,
"fusion": 0,
"cooccurence": 0,
"coexpression": 218,
"experimental": 0,
"database": 660,
"textmining": 273,
"combined_score": 814
},
{
"protein2": "8022.A0A060YTP7",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 592,
"experimental": 0,
"database": 689,
"textmining": 308,
"combined_score": 916
},
{
"protein2": "8022.A0A060XZF7",
"neighborhood": 144,
"fusion": 0,
"cooccurence": 0,
"coexpression": 222,
"experimental": 182,
"database": 630,
"textmining": 191,
"combined_score": 807
},
{
"protein2": "8022.A0A060YGT3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 156,
"experimental": 942,
"database": 830,
"textmining": 504,
"combined_score": 995
},
{
"protein2": "8022.A0A060WSY5",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 202,
"experimental": 0,
"database": 611,
"textmining": 165,
"combined_score": 746
},
{
"protein2": "8022.A0A060Z6P1",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 592,
"experimental": 0,
"database": 689,
"textmining": 308,
"combined_score": 916
},
{
"protein2": "8022.A0A060XNW5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 88,
"combined_score": 783
},
{
"protein2": "8022.A0A060X4P1",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 170,
"experimental": 0,
"database": 569,
"textmining": 308,
"combined_score": 734
},
{
"protein2": "8022.A0A060Z2E0",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 349,
"combined_score": 751
},
{
"protein2": "8022.A0A060YU85",
"neighborhood": 138,
"fusion": 0,
"cooccurence": 0,
"coexpression": 825,
"experimental": 342,
"database": 523,
"textmining": 432,
"combined_score": 968
}
] |
A0A060Y644
|
Beta-2 adrenergic receptor (Beta-2 adrenoreceptor)
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 408
|
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
|
MENVSTSALFNLSDLPVEMNLSSHHWSYSEYSEAEAVLLGIIMALLVLGIVFGNVLVITAIVRFQRLQTVTNMFITSLACADLVMGLLVVPFGACYILLNTWHFGSFLCEFWTAADVLCVTASIETLCVIALDRYLAITSPLRYPSLLTKHKACVVVVTVWGVAALISFLPIHMKWWVSDEPEALSCLENAHCCDFNTNAAYAVASSVVSFYIPLAVMAFVYGRVFQEARKQLQKIRGSEGRFHAQIINNNKGQDGGGGGGGNGKRPKFCLKEHKALKTLGIIMGTFTLCWLPFFVLNVAVTIWKVDNIKMPFRILNWIGYANSAFNPLIYCRSPEFRYAFQEILCLRGTAFPTNEYIYRGHSLQVSPKDKPGCSIHDTGTMELSTGSRSSVPNTNRNCNKPSLASIV
|
[
"GO:0043434",
"GO:1901652",
"GO:0051952",
"GO:0065007",
"GO:1903530",
"GO:0032811",
"GO:0033604",
"GO:0051049",
"GO:0051051",
"GO:0008150",
"GO:0042221",
"GO:0010243",
"GO:0050896",
"GO:1901698",
"GO:0050789",
"GO:0050433",
"GO:0009719",
"GO:0032879",
"GO:0007186",
"GO:0050794",
"GO:0051716",
"GO:0009987",
"GO:0023052",
"GO:1901700",
"GO:0051046",
"GO:0071875",
"GO:0014060",
"GO:0051953",
"GO:0048523",
"GO:0048519",
"GO:0010033",
"GO:0009725",
"GO:0051048",
"GO:0007154",
"GO:1903531",
"GO:0007165"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050896",
"GO:0050789",
"GO:0009987",
"GO:0023052",
"GO:0048519",
"GO:0051051",
"GO:0042221",
"GO:0009719",
"GO:0032879",
"GO:0050794",
"GO:0051716",
"GO:0048523",
"GO:0007154",
"GO:0007165",
"GO:1903530",
"GO:0051049",
"GO:1901698",
"GO:0007186",
"GO:1901700",
"GO:0051953",
"GO:0010033",
"GO:0009725",
"GO:0051048",
"GO:1903531",
"GO:0043434",
"GO:1901652",
"GO:0051952",
"GO:0033604",
"GO:0010243",
"GO:0050433",
"GO:0051046",
"GO:0071875",
"GO:0032811",
"GO:0014060"
] | null | null |
[
"IPR002233",
"IPR000276",
"IPR017452"
] |
af_db/AF-A0A060Y644-F1-model_v4.cif.gz
|
8022.A0A060Y644
|
[
"8022.A0A060Y7L4",
"8022.A0A060W081",
"8022.A0A060Z4B9",
"8022.A0A060Z2S8",
"8022.A0A060VY52",
"8022.Q7SZV5",
"8022.A0A060XG51",
"8022.A0A060W066",
"8022.A0A060VW67",
"8022.A0A060Y3I4",
"8022.A0A060Y8R0",
"8022.A0A060WP41",
"8022.A0A060XJN8",
"8022.A0A060Y8H5",
"8022.Q7T2I7",
"8022.A0A060WDT4",
"8022.A0A060YU11",
"8022.A0A060WHA4",
"8022.A0A060Z2C2",
"8022.A0A060XGM0",
"8022.A0A060VZ80",
"8022.A0A060YWJ1",
"8022.A0A060XTK7",
"8022.A0A060WSX0",
"8022.A0A060WE78",
"8022.A0A060VXM2",
"8022.A0A060XB37",
"8022.A0A060Z1D1",
"8022.A0A060W0D6",
"8022.A0A060Z6T3",
"8022.A0A060VPW7",
"8022.A0A060YEE1",
"8022.A0A060Z6I0",
"8022.C1BH40",
"8022.A0A060Z1I0",
"8022.A0A060WIZ5",
"8022.A0A060ZEF4",
"8022.A0A060VWA0",
"8022.A0A060YL43",
"8022.A0A060XUD4",
"8022.A0A060ZG63",
"8022.A0A060WVD9",
"8022.A0A060XA34",
"8022.A0A060XCL5",
"8022.A0A060WJ93",
"8022.A0A060Z480",
"8022.A0A060YP44",
"8022.A0A060Z8T5",
"8022.A0A060Y3C6",
"8022.A0A060YAW4",
"8022.A0A060W808",
"8022.A0A060XLR8",
"8022.B2KL82",
"8022.A0A060WCN9",
"8022.A0A060YR93",
"8022.A0A060XIC8",
"8022.A0A060XLH0",
"8022.A0A060XH49",
"8022.A0A060WHT5",
"8022.A0A060X2B4",
"8022.A0A060WXK5",
"8022.A0A060VWI9",
"8022.A0A060Y433",
"8022.A0A060WVH7",
"8022.A0A060YK59",
"8022.A0A060WF25",
"8022.A0A060XVD9",
"8022.A0A060XC17",
"8022.A0A060W0Q4",
"8022.A0A060XLX4",
"8022.A0A060VXS0",
"8022.A0A060YV89",
"8022.A0A060WRL9",
"8022.A0A061A7Q4",
"8022.A0A060W6W6",
"8022.A0A060W8T4",
"8022.A0A060X5U6",
"8022.A0A060YJ99",
"8022.A0A060WHG5",
"8022.A0A060YC25",
"8022.A0A060XRA0",
"8022.A0A060XBV2",
"8022.A0A060W476",
"8022.A0A060ZAK0",
"8022.A0A060YPP2",
"8022.A0A060ZE50",
"8022.A0A060XB81",
"8022.A0A060WLD6",
"8022.A0A060XAN6",
"8022.A0A060XBN9",
"8022.A0A060WSN3",
"8022.A0A060Y3R9",
"8022.A0A060WVI0",
"8022.A0A060VX07",
"8022.A0A060XFJ9",
"8022.A0A060XJ06",
"8022.A0A060Z6G3",
"8022.A0A060YHK9"
] |
[
{
"protein2": "8022.A0A060Y7L4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060W081",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060Z4B9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060Z2S8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060VY52",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.Q7SZV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 387,
"database": 831,
"textmining": 124,
"combined_score": 901
},
{
"protein2": "8022.A0A060XG51",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 748,
"database": 419,
"textmining": 86,
"combined_score": 854
},
{
"protein2": "8022.A0A060W066",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 779,
"textmining": 86,
"combined_score": 789
},
{
"protein2": "8022.A0A060VW67",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 81,
"combined_score": 832
},
{
"protein2": "8022.A0A060Y3I4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060Y8R0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060WP41",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060XJN8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060Y8H5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 571,
"textmining": 0,
"combined_score": 708
},
{
"protein2": "8022.Q7T2I7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 167,
"combined_score": 849
},
{
"protein2": "8022.A0A060WDT4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060YU11",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060WHA4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 267,
"database": 832,
"textmining": 87,
"combined_score": 881
},
{
"protein2": "8022.A0A060Z2C2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 844,
"textmining": 162,
"combined_score": 961
},
{
"protein2": "8022.A0A060XGM0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 110,
"combined_score": 839
},
{
"protein2": "8022.A0A060VZ80",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 825,
"textmining": 62,
"combined_score": 889
},
{
"protein2": "8022.A0A060YWJ1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 593,
"textmining": 162,
"combined_score": 898
},
{
"protein2": "8022.A0A060XTK7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060WSX0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 829,
"textmining": 62,
"combined_score": 891
},
{
"protein2": "8022.A0A060WE78",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060VXM2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 59,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 838
},
{
"protein2": "8022.A0A060XB37",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 167,
"combined_score": 849
},
{
"protein2": "8022.A0A060Z1D1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 751,
"database": 523,
"textmining": 0,
"combined_score": 876
},
{
"protein2": "8022.A0A060W0D6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 46,
"experimental": 0,
"database": 825,
"textmining": 62,
"combined_score": 829
},
{
"protein2": "8022.A0A060Z6T3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060VPW7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 250,
"database": 827,
"textmining": 109,
"combined_score": 874
},
{
"protein2": "8022.A0A060YEE1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060Z6I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 827,
"textmining": 89,
"combined_score": 897
},
{
"protein2": "8022.C1BH40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 751,
"database": 523,
"textmining": 0,
"combined_score": 876
},
{
"protein2": "8022.A0A060Z1I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060WIZ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060ZEF4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060VWA0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060YL43",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 825,
"textmining": 62,
"combined_score": 889
},
{
"protein2": "8022.A0A060XUD4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060ZG63",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060WVD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 829,
"textmining": 62,
"combined_score": 891
},
{
"protein2": "8022.A0A060XA34",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060XCL5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 250,
"database": 827,
"textmining": 109,
"combined_score": 874
},
{
"protein2": "8022.A0A060WJ93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060Z480",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060YP44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 827,
"textmining": 89,
"combined_score": 897
},
{
"protein2": "8022.A0A060Z8T5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060Y3C6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060YAW4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060W808",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060XLR8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.B2KL82",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 844,
"textmining": 162,
"combined_score": 961
},
{
"protein2": "8022.A0A060WCN9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 110,
"combined_score": 839
},
{
"protein2": "8022.A0A060YR93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060XIC8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060XLH0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060XH49",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 89,
"combined_score": 835
},
{
"protein2": "8022.A0A060WHT5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060X2B4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060WXK5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060VWI9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 86,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 89,
"combined_score": 843
},
{
"protein2": "8022.A0A060Y433",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060WVH7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 825,
"textmining": 62,
"combined_score": 889
},
{
"protein2": "8022.A0A060YK59",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060WF25",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 816,
"textmining": 62,
"combined_score": 883
},
{
"protein2": "8022.A0A060XVD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 291,
"database": 783,
"textmining": 0,
"combined_score": 839
},
{
"protein2": "8022.A0A060XC17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 571,
"textmining": 0,
"combined_score": 708
},
{
"protein2": "8022.A0A060W0Q4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060XLX4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060VXS0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 772,
"textmining": 87,
"combined_score": 782
},
{
"protein2": "8022.A0A060YV89",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 241,
"database": 827,
"textmining": 86,
"combined_score": 869
},
{
"protein2": "8022.A0A060WRL9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 844,
"textmining": 162,
"combined_score": 961
},
{
"protein2": "8022.A0A061A7Q4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060W6W6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 829,
"textmining": 62,
"combined_score": 891
},
{
"protein2": "8022.A0A060W8T4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060X5U6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 46,
"experimental": 0,
"database": 825,
"textmining": 62,
"combined_score": 829
},
{
"protein2": "8022.A0A060YJ99",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 829,
"textmining": 62,
"combined_score": 891
},
{
"protein2": "8022.A0A060WHG5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060YC25",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 152,
"combined_score": 768
},
{
"protein2": "8022.A0A060XRA0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060XBV2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060W476",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060ZAK0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 832,
"textmining": 89,
"combined_score": 902
},
{
"protein2": "8022.A0A060YPP2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060ZE50",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 380,
"database": 555,
"textmining": 62,
"combined_score": 718
},
{
"protein2": "8022.A0A060XB81",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
},
{
"protein2": "8022.A0A060WLD6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 46,
"experimental": 0,
"database": 825,
"textmining": 62,
"combined_score": 829
},
{
"protein2": "8022.A0A060XAN6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 225,
"database": 832,
"textmining": 130,
"combined_score": 876
},
{
"protein2": "8022.A0A060XBN9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 59,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 838
},
{
"protein2": "8022.A0A060WSN3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 241,
"database": 827,
"textmining": 86,
"combined_score": 869
},
{
"protein2": "8022.A0A060Y3R9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 779,
"textmining": 86,
"combined_score": 789
},
{
"protein2": "8022.A0A060WVI0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060VX07",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060XFJ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 63,
"combined_score": 829
},
{
"protein2": "8022.A0A060XJ06",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 353,
"database": 597,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060Z6G3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 727,
"database": 602,
"textmining": 162,
"combined_score": 900
},
{
"protein2": "8022.A0A060YHK9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 419,
"textmining": 86,
"combined_score": 857
}
] |
A0A024A2C9
|
Lipoprotein binding FH
| null |
Haemophilus influenzae
| 280
| null |
MNINLKKFSLTILAALTLTACGSGSGASASNAPTAQPSTPATQPSEQAVLEMPKRSPTNTGLVFSIKTESEEDSVGQINTINNEQELSNRTLTSIDVDGKQIPIAFTENWNEAKYIEQPLNGVPHICCNKYTAMRFGAIASNEAGQNDILFYNGIPTEKLPDSGEVTYEGESIMTSKESVIPDDYMKGSSKFIVNFGDKKLSGSLIIDTTKSTSSSQKVKIDIEKAKITGNTFSGTAQSDSFKSQGIAEGKFYGDGAKELGGMVKAKDNSWAGAYGAKAQ
|
[
"GO:0009605",
"GO:0001971",
"GO:0051701",
"GO:0050777",
"GO:0031341",
"GO:0065007",
"GO:0052200",
"GO:0030449",
"GO:0050776",
"GO:0008150",
"GO:1903659",
"GO:0043207",
"GO:0052173",
"GO:0050896",
"GO:0050789",
"GO:0002683",
"GO:0002697",
"GO:0009607",
"GO:0032879",
"GO:0060341",
"GO:0002921",
"GO:0050794",
"GO:0044419",
"GO:0048583",
"GO:0052553",
"GO:0075136",
"GO:0052562",
"GO:0052572",
"GO:0002682",
"GO:0002698",
"GO:0032880",
"GO:0045916",
"GO:0002920",
"GO:0044403",
"GO:0048519",
"GO:0051707",
"GO:0048585",
"GO:0001969",
"GO:0110165",
"GO:0005575",
"GO:0009986",
"GO:0003674",
"GO:0005488",
"GO:0050840",
"GO:0005515"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050896",
"GO:0050789",
"GO:0044419",
"GO:0048519",
"GO:0009605",
"GO:0002683",
"GO:0009607",
"GO:0032879",
"GO:0050794",
"GO:0048583",
"GO:0002682",
"GO:0044403",
"GO:0051707",
"GO:0048585",
"GO:0051701",
"GO:0050777",
"GO:0031341",
"GO:0050776",
"GO:0043207",
"GO:0052173",
"GO:0002697",
"GO:0060341",
"GO:0075136",
"GO:0002698",
"GO:0052200",
"GO:0030449",
"GO:1903659",
"GO:0002921",
"GO:0032880",
"GO:0045916",
"GO:0002920",
"GO:0001971",
"GO:0052572",
"GO:0001969",
"GO:0052553",
"GO:0052562"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0050840",
"GO:0005515"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0009986"
] |
[
"IPR011250",
"IPR054843",
"IPR001677"
] |
af_db/AF-A0A024A2C9-F1-model_v4.cif.gz
| null | null | null |
A0A060XK41
|
Phospholipid/glycerol acyltransferase domain-containing protein
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 180
|
Membrane {ECO:0000256|ARBA:ARBA00004370}.
|
MTVTVFPVRLFFAVFLMLLAWPFAFAASLGRSELAVETETWWRRICDIALRVIMRAMWFCGGFHWVTVKGEPAPPSQAPILTLAPHSSYFDAIPITMTMASIVMKTESKNIPVWGTLIKFIRPVFVSRSDQDSRRKTVEEIKRRAHAGGEWPQIMIFPEGTCTNRSCLITFKPGMCSSLC
|
[
"GO:0008152",
"GO:1901566",
"GO:0006650",
"GO:0006662",
"GO:1901503",
"GO:0009058",
"GO:0008654",
"GO:0044237",
"GO:0008150",
"GO:1901576",
"GO:1901564",
"GO:0046486",
"GO:0006629",
"GO:0006663",
"GO:0044281",
"GO:0046504",
"GO:0006644",
"GO:0097384",
"GO:0008611",
"GO:0046485",
"GO:0019637",
"GO:0006807",
"GO:0090407",
"GO:0044255",
"GO:0044249",
"GO:0009987",
"GO:0006796",
"GO:0046474",
"GO:0018904",
"GO:0071704",
"GO:0046469",
"GO:0008610",
"GO:0045017",
"GO:0044238",
"GO:0006793",
"GO:0042175",
"GO:0005622",
"GO:0031090",
"GO:0043226",
"GO:0005783",
"GO:0005575",
"GO:0016020",
"GO:0043231",
"GO:0005789",
"GO:0031984",
"GO:0043229",
"GO:0110165",
"GO:0071944",
"GO:0005737",
"GO:0043227",
"GO:0012505",
"GO:0005886",
"GO:0098827",
"GO:0016747",
"GO:0016740",
"GO:0003674",
"GO:0016407",
"GO:0016746",
"GO:0003824",
"GO:0047179"
] |
[
"GO:0008150",
"GO:0008152",
"GO:0009987",
"GO:0009058",
"GO:0044237",
"GO:0044281",
"GO:0006807",
"GO:0071704",
"GO:0044238",
"GO:1901576",
"GO:1901564",
"GO:0006629",
"GO:0019637",
"GO:0044255",
"GO:0044249",
"GO:0018904",
"GO:0006793",
"GO:1901566",
"GO:0006662",
"GO:1901503",
"GO:0046486",
"GO:0046504",
"GO:0006644",
"GO:0097384",
"GO:0046485",
"GO:0090407",
"GO:0006796",
"GO:0046469",
"GO:0008610",
"GO:0045017",
"GO:0006650",
"GO:0008654",
"GO:0006663",
"GO:0008611",
"GO:0046474"
] |
[
"GO:0003674",
"GO:0003824",
"GO:0016740",
"GO:0016746",
"GO:0016747",
"GO:0016407",
"GO:0047179"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0016020",
"GO:0031984",
"GO:0071944",
"GO:0005737",
"GO:0012505",
"GO:0042175",
"GO:0031090",
"GO:0005783",
"GO:0043229",
"GO:0043227",
"GO:0005886",
"GO:0098827",
"GO:0043231",
"GO:0005789"
] |
[
"IPR045252",
"IPR002123"
] |
af_db/AF-A0A060XK41-F1-model_v4.cif.gz
|
8022.A0A060XK41
|
[
"8022.A0A060XLF8",
"8022.A0A060WDA7",
"8022.A0A060YAJ2",
"8022.A0A060Z370",
"8022.A0A060VZH3",
"8022.A0A060YQM4",
"8022.A0A060W8Z2",
"8022.A0A060XKJ6",
"8022.A0A060X4H7",
"8022.A0A060Y6G2",
"8022.A0A060W3V3",
"8022.A0A060XFT6",
"8022.A0A060Y2H4",
"8022.A0A060Y2K1",
"8022.A0A060Z5I3",
"8022.A0A060Y4G9",
"8022.A0A060WXB6",
"8022.A0A060YKM8",
"8022.A0A060XM30",
"8022.A0A060XEI7",
"8022.A0A060YZH2",
"8022.A0A060XR98",
"8022.A0A060WTF2",
"8022.A0A060ZCK2",
"8022.A0A060XEP9",
"8022.A0A060X5K2",
"8022.A0A060XI36",
"8022.A0A060XT39",
"8022.A0A060WDQ0",
"8022.A0A060VU79",
"8022.A0A060W6W8",
"8022.A0A060WCJ4",
"8022.A0A060Z9W8",
"8022.A0A060X101",
"8022.A0A060WK44",
"8022.A0A060WAZ2",
"8022.A0A060ZFN7",
"8022.A0A060XNK8",
"8022.A0A060Z1S9",
"8022.A0A060WE92",
"8022.A0A060Z3A6",
"8022.A0A060Z2V6",
"8022.A0A060WG53",
"8022.A0A060VXV4",
"8022.A0A060XE36",
"8022.A0A060X9R9",
"8022.A0A060Y5Z4",
"8022.A0A060XTV7",
"8022.A0A060YCG4",
"8022.A0A060XN93",
"8022.A0A060X754",
"8022.A0A060W3X0",
"8022.A0A060X5H9",
"8022.A0A060YK16",
"8022.A0A060X1Q1",
"8022.A0A060VWE7",
"8022.A0A060X8I3",
"8022.A0A060VWG7",
"8022.A0A060ZF19",
"8022.A0A060WWB8",
"8022.A0A060W780",
"8022.A0A060VY33",
"8022.A0A060WAH0",
"8022.A0A060VYJ7",
"8022.A0A060YPN4",
"8022.A0A060Y3S3",
"8022.A0A060ZEA0",
"8022.A0A060WKI9",
"8022.A0A060WAM9",
"8022.A0A060Z178",
"8022.A0A060Y525",
"8022.A0A060XJE3",
"8022.A0A060WXJ9",
"8022.A0A060XBF4",
"8022.A0A060YNP0",
"8022.A0A060Y209",
"8022.A0A060XZG5",
"8022.A0A060WMA0",
"8022.A0A060YP76",
"8022.A0A060XZ81",
"8022.A0A060YCR0",
"8022.A0A060VWY0",
"8022.A0A060XQT7",
"8022.A0A060W3M6",
"8022.A0A060YLF9",
"8022.A0A060X659",
"8022.A0A060XN56",
"8022.A0A060X1J7",
"8022.A0A060Y7U0",
"8022.A0A060X836",
"8022.A0A060WCZ0",
"8022.A0A060XI24",
"8022.A0A060VYB1",
"8022.A0A060XCL6",
"8022.A0A060Z8E6",
"8022.A0A060YWG6",
"8022.A0A060Z769",
"8022.A0A060YPX7",
"8022.A0A060XJF5",
"8022.A0A060VML4",
"8022.A0A060Y022",
"8022.A0A060YG60",
"8022.A0A060YR49",
"8022.A0A060WGS1",
"8022.A0A060X8F2",
"8022.A0A060W5A1",
"8022.A0A060W2M5"
] |
[
{
"protein2": "8022.A0A060XLF8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 323,
"combined_score": 889
},
{
"protein2": "8022.A0A060WDA7",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 157,
"combined_score": 848
},
{
"protein2": "8022.A0A060YAJ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 151,
"combined_score": 861
},
{
"protein2": "8022.A0A060Z370",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 782,
"textmining": 112,
"combined_score": 798
},
{
"protein2": "8022.A0A060VZH3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 839,
"textmining": 151,
"combined_score": 857
},
{
"protein2": "8022.A0A060YQM4",
"neighborhood": 154,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 649,
"textmining": 205,
"combined_score": 743
},
{
"protein2": "8022.A0A060W8Z2",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 157,
"combined_score": 854
},
{
"protein2": "8022.A0A060XKJ6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 834,
"textmining": 89,
"combined_score": 842
},
{
"protein2": "8022.A0A060X4H7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 782,
"textmining": 112,
"combined_score": 798
},
{
"protein2": "8022.A0A060Y6G2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 128,
"combined_score": 840
},
{
"protein2": "8022.A0A060W3V3",
"neighborhood": 42,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 212,
"combined_score": 856
},
{
"protein2": "8022.A0A060XFT6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 835
},
{
"protein2": "8022.A0A060Y2H4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 72,
"coexpression": 0,
"experimental": 158,
"database": 827,
"textmining": 137,
"combined_score": 867
},
{
"protein2": "8022.A0A060Y2K1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 84,
"coexpression": 0,
"experimental": 0,
"database": 831,
"textmining": 0,
"combined_score": 838
},
{
"protein2": "8022.A0A060Z5I3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 115,
"combined_score": 838
},
{
"protein2": "8022.A0A060Y4G9",
"neighborhood": 139,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 232,
"database": 534,
"textmining": 180,
"combined_score": 717
},
{
"protein2": "8022.A0A060WXB6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 81,
"combined_score": 839
},
{
"protein2": "8022.A0A060YKM8",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 831,
"textmining": 0,
"combined_score": 833
},
{
"protein2": "8022.A0A060XM30",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060XEI7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 135,
"combined_score": 843
},
{
"protein2": "8022.A0A060YZH2",
"neighborhood": 147,
"fusion": 0,
"cooccurence": 0,
"coexpression": 127,
"experimental": 100,
"database": 832,
"textmining": 211,
"combined_score": 894
},
{
"protein2": "8022.A0A060XR98",
"neighborhood": 147,
"fusion": 0,
"cooccurence": 0,
"coexpression": 127,
"experimental": 100,
"database": 534,
"textmining": 211,
"combined_score": 708
},
{
"protein2": "8022.A0A060WTF2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 44,
"combined_score": 825
},
{
"protein2": "8022.A0A060ZCK2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 829,
"textmining": 47,
"combined_score": 830
},
{
"protein2": "8022.A0A060XEP9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 167,
"combined_score": 847
},
{
"protein2": "8022.A0A060X5K2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 772,
"textmining": 112,
"combined_score": 789
},
{
"protein2": "8022.A0A060XI36",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 357,
"database": 602,
"textmining": 235,
"combined_score": 792
},
{
"protein2": "8022.A0A060XT39",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060WDQ0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 44,
"combined_score": 825
},
{
"protein2": "8022.A0A060VU79",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 323,
"combined_score": 889
},
{
"protein2": "8022.A0A060W6W8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 834,
"textmining": 89,
"combined_score": 842
},
{
"protein2": "8022.A0A060WCJ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 167,
"combined_score": 864
},
{
"protein2": "8022.A0A060Z9W8",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 84,
"database": 827,
"textmining": 132,
"combined_score": 852
},
{
"protein2": "8022.A0A060X101",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060WK44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 835
},
{
"protein2": "8022.A0A060WAZ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 276,
"combined_score": 869
},
{
"protein2": "8022.A0A060ZFN7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 782,
"textmining": 112,
"combined_score": 798
},
{
"protein2": "8022.A0A060XNK8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 135,
"combined_score": 843
},
{
"protein2": "8022.A0A060Z1S9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 115,
"combined_score": 838
},
{
"protein2": "8022.A0A060WE92",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 835
},
{
"protein2": "8022.A0A060Z3A6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 204,
"coexpression": 0,
"experimental": 0,
"database": 831,
"textmining": 0,
"combined_score": 859
},
{
"protein2": "8022.A0A060Z2V6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 44,
"combined_score": 832
},
{
"protein2": "8022.A0A060WG53",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 84,
"database": 827,
"textmining": 132,
"combined_score": 852
},
{
"protein2": "8022.A0A060VXV4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060XE36",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 748
},
{
"protein2": "8022.A0A060X9R9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 118,
"database": 654,
"textmining": 143,
"combined_score": 715
},
{
"protein2": "8022.A0A060Y5Z4",
"neighborhood": 114,
"fusion": 0,
"cooccurence": 0,
"coexpression": 98,
"experimental": 0,
"database": 592,
"textmining": 230,
"combined_score": 715
},
{
"protein2": "8022.A0A060XTV7",
"neighborhood": 42,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 212,
"combined_score": 856
},
{
"protein2": "8022.A0A060YCG4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 748
},
{
"protein2": "8022.A0A060XN93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 86,
"combined_score": 833
},
{
"protein2": "8022.A0A060X754",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 357,
"database": 602,
"textmining": 235,
"combined_score": 792
},
{
"protein2": "8022.A0A060W3X0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 118,
"database": 654,
"textmining": 143,
"combined_score": 715
},
{
"protein2": "8022.A0A060X5H9",
"neighborhood": 101,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 148,
"combined_score": 846
},
{
"protein2": "8022.A0A060YK16",
"neighborhood": 63,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 165,
"database": 824,
"textmining": 115,
"combined_score": 864
},
{
"protein2": "8022.A0A060X1Q1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 224,
"combined_score": 864
},
{
"protein2": "8022.A0A060VWE7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 835
},
{
"protein2": "8022.A0A060X8I3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 357,
"database": 602,
"textmining": 235,
"combined_score": 792
},
{
"protein2": "8022.A0A060VWG7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 357,
"database": 602,
"textmining": 235,
"combined_score": 792
},
{
"protein2": "8022.A0A060ZF19",
"neighborhood": 63,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 165,
"database": 824,
"textmining": 115,
"combined_score": 864
},
{
"protein2": "8022.A0A060WWB8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 47,
"combined_score": 828
},
{
"protein2": "8022.A0A060W780",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 151,
"combined_score": 861
},
{
"protein2": "8022.A0A060VY33",
"neighborhood": 42,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 212,
"combined_score": 856
},
{
"protein2": "8022.A0A060WAH0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 74,
"coexpression": 0,
"experimental": 158,
"database": 844,
"textmining": 137,
"combined_score": 881
},
{
"protein2": "8022.A0A060VYJ7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 782,
"textmining": 112,
"combined_score": 798
},
{
"protein2": "8022.A0A060YPN4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 43,
"combined_score": 832
},
{
"protein2": "8022.A0A060Y3S3",
"neighborhood": 101,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 125,
"combined_score": 856
},
{
"protein2": "8022.A0A060ZEA0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 782,
"textmining": 112,
"combined_score": 798
},
{
"protein2": "8022.A0A060WKI9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 834,
"textmining": 89,
"combined_score": 842
},
{
"protein2": "8022.A0A060WAM9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 835
},
{
"protein2": "8022.A0A060Z178",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 44,
"combined_score": 825
},
{
"protein2": "8022.A0A060Y525",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 748
},
{
"protein2": "8022.A0A060XJE3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 834,
"textmining": 89,
"combined_score": 842
},
{
"protein2": "8022.A0A060WXJ9",
"neighborhood": 101,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 148,
"combined_score": 846
},
{
"protein2": "8022.A0A060XBF4",
"neighborhood": 101,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 148,
"combined_score": 846
},
{
"protein2": "8022.A0A060YNP0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 357,
"database": 602,
"textmining": 235,
"combined_score": 792
},
{
"protein2": "8022.A0A060Y209",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 79,
"coexpression": 0,
"experimental": 0,
"database": 831,
"textmining": 0,
"combined_score": 837
},
{
"protein2": "8022.A0A060XZG5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 135,
"combined_score": 843
},
{
"protein2": "8022.A0A060WMA0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 44,
"combined_score": 825
},
{
"protein2": "8022.A0A060YP76",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 752
},
{
"protein2": "8022.A0A060XZ81",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 151,
"combined_score": 861
},
{
"protein2": "8022.A0A060YCR0",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060VWY0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 118,
"database": 827,
"textmining": 143,
"combined_score": 857
},
{
"protein2": "8022.A0A060XQT7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 834,
"textmining": 86,
"combined_score": 841
},
{
"protein2": "8022.A0A060W3M6",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060YLF9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 44,
"combined_score": 825
},
{
"protein2": "8022.A0A060X659",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 357,
"database": 602,
"textmining": 235,
"combined_score": 792
},
{
"protein2": "8022.A0A060XN56",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 779,
"textmining": 86,
"combined_score": 789
},
{
"protein2": "8022.A0A060X1J7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 86,
"combined_score": 835
},
{
"protein2": "8022.A0A060Y7U0",
"neighborhood": 139,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 232,
"database": 534,
"textmining": 180,
"combined_score": 717
},
{
"protein2": "8022.A0A060X836",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 167,
"combined_score": 847
},
{
"protein2": "8022.A0A060WCZ0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 276,
"combined_score": 869
},
{
"protein2": "8022.A0A060XI24",
"neighborhood": 101,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 148,
"combined_score": 846
},
{
"protein2": "8022.A0A060VYB1",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060XCL6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 834,
"textmining": 86,
"combined_score": 841
},
{
"protein2": "8022.A0A060Z8E6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 86,
"combined_score": 833
},
{
"protein2": "8022.A0A060YWG6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 135,
"combined_score": 843
},
{
"protein2": "8022.A0A060Z769",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060YPX7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060XJF5",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 157,
"combined_score": 848
},
{
"protein2": "8022.A0A060VML4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 844,
"textmining": 164,
"combined_score": 864
},
{
"protein2": "8022.A0A060Y022",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 86,
"combined_score": 833
},
{
"protein2": "8022.A0A060YG60",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 74,
"combined_score": 795
},
{
"protein2": "8022.A0A060YR49",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 115,
"combined_score": 838
},
{
"protein2": "8022.A0A060WGS1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 748
},
{
"protein2": "8022.A0A060X8F2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 118,
"database": 827,
"textmining": 143,
"combined_score": 857
},
{
"protein2": "8022.A0A060W5A1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 839,
"textmining": 151,
"combined_score": 857
},
{
"protein2": "8022.A0A060W2M5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 118,
"database": 654,
"textmining": 143,
"combined_score": 715
}
] |
A0A060Y7B7
|
Alpha-2B adrenergic receptor (Alpha-2B adrenoreceptor)
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 475
|
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
|
MAAAPKVTCLSAPGVNVITNLNLSVTTGSAPYYNQTALRIPPYSREATALFAMAITLMMILTIVGNILVIIAVLTSRSLHGPQNLFLVSLAAADILVATLIIPFSLANELQGYWAFRSLWCEIYLALDVFFCTSSIAHLCAISLDRYLSISRPVSYGIQRTPARIKAAIVVVWLLSAVISFPPLLSLDKSKGGVEVCELNNERWYILYSTIGSFFAPCLIMIGVYIRIYQIAKQHTRCLPGEKPNPNKSPGNMSSNPPTNPTPPSPGPAKSQPQTSLPNPVPTSPQPTSPTVALSLTLLSPDSQHEETHRQGEIQEEKHRDTPNDDSFSSGSEAETRGRGKGGRGGGKGTVKNNGGSKSGGAPLSSLTSHEAKNTPQATPMSRRRAMVNREKRFTFVLAVVIGVFVICWFPFFFSYSLKAIFPETCLVPAPLFTFFFWIGYCNSCLNPVIYTIFNQDFRKAFKKILCRDTKGTFF
|
[
"GO:0051716",
"GO:0051602",
"GO:0009628",
"GO:0009987",
"GO:0051952",
"GO:0065007",
"GO:0023052",
"GO:1903530",
"GO:0032811",
"GO:0033604",
"GO:0051046",
"GO:0051049",
"GO:0051051",
"GO:0008150",
"GO:0071875",
"GO:0050896",
"GO:0050789",
"GO:0014060",
"GO:0051953",
"GO:0050433",
"GO:0048523",
"GO:0048519",
"GO:0007186",
"GO:0051048",
"GO:0032879",
"GO:1903531",
"GO:0007154",
"GO:0007165",
"GO:0050794"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0023052",
"GO:0050896",
"GO:0050789",
"GO:0048519",
"GO:0051716",
"GO:0009628",
"GO:0051051",
"GO:0048523",
"GO:0032879",
"GO:0007154",
"GO:0007165",
"GO:0050794",
"GO:0051602",
"GO:1903530",
"GO:0051049",
"GO:0051953",
"GO:0007186",
"GO:0051048",
"GO:1903531",
"GO:0051952",
"GO:0033604",
"GO:0051046",
"GO:0071875",
"GO:0050433",
"GO:0032811",
"GO:0014060"
] | null | null |
[
"IPR002233",
"IPR000276",
"IPR017452"
] |
af_db/AF-A0A060Y7B7-F1-model_v4.cif.gz
|
8022.A0A060Y7B7
|
[
"8022.A0A060WHA4",
"8022.A0A060WGC3",
"8022.A0A060Y8H5",
"8022.A0A060Y2Z0",
"8022.Q7SZV5",
"8022.A0A060YR57",
"8022.A0A060XSB8",
"8022.A0A060XN60",
"8022.A0A060Z6I0",
"8022.C1BH40",
"8022.A0A060Y1H7",
"8022.A0A060Z1D1",
"8022.A0A060Z6E2",
"8022.A0A060WMN1",
"8022.A0A060WEW9",
"8022.A0A060XPS3",
"8022.A0A060WL89",
"8022.A0A060VPZ9",
"8022.A0A060WVZ9",
"8022.A0A060YP44",
"8022.A0A060XRQ9",
"8022.A0A060W8V2",
"8022.A0A060X2G9",
"8022.A0A060ZAK0",
"8022.A0A060WXC1",
"8022.A0A060XVD9",
"8022.A0A060XC17"
] |
[
{
"protein2": "8022.A0A060WHA4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 155,
"experimental": 267,
"database": 571,
"textmining": 86,
"combined_score": 724
},
{
"protein2": "8022.A0A060WGC3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060Y8H5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 608,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060Y2Z0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.Q7SZV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 387,
"database": 568,
"textmining": 86,
"combined_score": 736
},
{
"protein2": "8022.A0A060YR57",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060XSB8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060XN60",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 572,
"textmining": 0,
"combined_score": 709
},
{
"protein2": "8022.A0A060Z6I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 523,
"textmining": 88,
"combined_score": 716
},
{
"protein2": "8022.C1BH40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 626,
"database": 567,
"textmining": 0,
"combined_score": 833
},
{
"protein2": "8022.A0A060Y1H7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060Z1D1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 626,
"database": 567,
"textmining": 0,
"combined_score": 833
},
{
"protein2": "8022.A0A060Z6E2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060WMN1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060WEW9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060XPS3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060WL89",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 604,
"textmining": 0,
"combined_score": 733
},
{
"protein2": "8022.A0A060VPZ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 572,
"textmining": 0,
"combined_score": 709
},
{
"protein2": "8022.A0A060WVZ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060YP44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 523,
"textmining": 88,
"combined_score": 716
},
{
"protein2": "8022.A0A060XRQ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060W8V2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 608,
"textmining": 0,
"combined_score": 736
},
{
"protein2": "8022.A0A060X2G9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060ZAK0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 89,
"combined_score": 751
},
{
"protein2": "8022.A0A060WXC1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 63,
"combined_score": 708
},
{
"protein2": "8022.A0A060XVD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 291,
"database": 783,
"textmining": 0,
"combined_score": 839
},
{
"protein2": "8022.A0A060XC17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 571,
"textmining": 0,
"combined_score": 708
}
] |
A0A060YD78
|
CARD domain-containing protein
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 199
| null |
MDSWCITDEDMAEVKKEALERLRPYLCEKLVADRHLDYLRSRRVLTRDDAEDICCSKKTGRMLDYLAENPRGLDYLVESICRVRTKDFVIGKITNEVEVVKMERREAAILSAAGSSSPVCICKERTPFVSLQSGSSDAQSIQTSLSNSEDKWGQNEASFSWSALPEGVSVSSLHSLPKPGEQGAPSVPLEDNEPGTLRV
|
[
"GO:0048583",
"GO:1901222",
"GO:0009967",
"GO:1901224",
"GO:0023051",
"GO:0010647",
"GO:0023056",
"GO:0065007",
"GO:1902533",
"GO:0048518",
"GO:0009966",
"GO:0008150",
"GO:0050789",
"GO:0048584",
"GO:0010646",
"GO:1902531",
"GO:0050794",
"GO:0048522",
"GO:0099081",
"GO:0005856",
"GO:0140535",
"GO:0005622",
"GO:0043229",
"GO:0099513",
"GO:0043226",
"GO:0110165",
"GO:0043232",
"GO:0005575",
"GO:0005884",
"GO:0032449",
"GO:0015629",
"GO:0032991",
"GO:0043228",
"GO:0099512",
"GO:0099080",
"GO:0042803",
"GO:0042802",
"GO:0005488",
"GO:0003674",
"GO:0005515",
"GO:0046983"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0048518",
"GO:0050789",
"GO:0048583",
"GO:0023051",
"GO:0023056",
"GO:0048584",
"GO:0050794",
"GO:0048522",
"GO:0009967",
"GO:0010647",
"GO:0009966",
"GO:0010646",
"GO:1902533",
"GO:1902531",
"GO:1901222",
"GO:1901224"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0005515",
"GO:0042802",
"GO:0046983",
"GO:0042803"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0032991",
"GO:0140535",
"GO:0005622",
"GO:0043226",
"GO:0099080",
"GO:0099081",
"GO:0043229",
"GO:0032449",
"GO:0043228",
"GO:0043232",
"GO:0099512",
"GO:0005856",
"GO:0099513",
"GO:0005884",
"GO:0015629"
] |
[
"IPR033238",
"IPR001315",
"IPR011029"
] |
af_db/AF-A0A060YD78-F1-model_v4.cif.gz
|
8022.A0A060YD78
|
[
"8022.A0A060VPQ9",
"8022.A0A060YC11",
"8022.A0A060VMZ0",
"8022.A0A060ZAC5",
"8022.A0A060WHP4",
"8022.A0A060X3A7",
"8022.A0A060VPK7",
"8022.A0A060Z7Q1",
"8022.A0A060VSM2",
"8022.A0A060WPG0",
"8022.A0A060XEI8",
"8022.A0A060Y3W2",
"8022.A0A060XE22",
"8022.A0A060W2Y1",
"8022.A0A060YSP1",
"8022.A0A060X0B9",
"8022.A0A060YA72",
"8022.A0A060WWW9",
"8022.A0A060WFN4",
"8022.A0A060Z7S6",
"8022.A0A060Z9A4",
"8022.A0A060XMN7",
"8022.A0A060XWP0",
"8022.A0A060WGT0",
"8022.A0A060YN46",
"8022.A0A060WMM4",
"8022.A0A060X3D3",
"8022.A0A060YT60",
"8022.A0A060ZXZ7",
"8022.A0A060WVX3",
"8022.A0A060Y4P1",
"8022.A0A060YFT4",
"8022.A0A060Z681",
"8022.A0A060VN59",
"8022.A0A060X678",
"8022.A0A060Y0Y0",
"8022.A0A060X4V6",
"8022.A0A060YX93",
"8022.A0A060WDK2",
"8022.A0A060VW27",
"8022.A0A060YWL7",
"8022.A0A060W7T1",
"8022.A0A060WDS6",
"8022.A0A060WZ23",
"8022.A0A060XUA7",
"8022.A0A060WIC9",
"8022.A0A060XCU8",
"8022.A0A060XLZ6",
"8022.A0A060YFY3",
"8022.A0A060X3K2",
"8022.A0A060WR55",
"8022.A0A060YQJ2",
"8022.A0A060WGD6",
"8022.A0A060W010",
"8022.A0A060WH79",
"8022.A0A060Y8M4",
"8022.A0A060YMA8",
"8022.A0A060X7V7",
"8022.A0A060X4A4",
"8022.A0A060WE22",
"8022.A0A060YTI2",
"8022.A0A060WMC0",
"8022.A0A060Y599",
"8022.A0A060X4L3",
"8022.A0A060Y8P3",
"8022.A0A060WRE1",
"8022.A0A060XKG4",
"8022.A0A060WH36",
"8022.A0A060WTZ2",
"8022.A0A060XRP8",
"8022.A0A060XTA1",
"8022.A0A060W1A6",
"8022.A0A060XQK8",
"8022.A0A060X9J9",
"8022.A0A060YCY4",
"8022.A0A060YHN1",
"8022.A0A060YTB0",
"8022.A0A060X2Z7",
"8022.A0A060Y4X6",
"8022.A0A060YPE8",
"8022.A0A060YPV1",
"8022.A0A060WBE7",
"8022.A0A060XR59",
"8022.A0A060XMS2",
"8022.A0A060W620",
"8022.A0A060Y3L3",
"8022.A0A060XEQ9",
"8022.A0A060XTF4",
"8022.A0A060WSK7",
"8022.A0A060W9W2",
"8022.A0A060Y5J3",
"8022.A0A060Y4W6",
"8022.A0A060Y8T1",
"8022.A0A060XE11",
"8022.A0A060WUS8",
"8022.A0A060YBF2",
"8022.A0A061A6D5",
"8022.A0A060W9J5",
"8022.A0A060WNK3",
"8022.A0A060YTY7",
"8022.A0A060ZCG7",
"8022.A0A060VMS8",
"8022.A0A060WWY0",
"8022.A0A060VXV5",
"8022.A0A060Z2R2",
"8022.A0A060XV27",
"8022.A0A060YYR0",
"8022.A0A060ZCR8",
"8022.A0A060ZBY8",
"8022.A0A060YHR8"
] |
[
{
"protein2": "8022.A0A060VPQ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060YC11",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 450,
"combined_score": 842
},
{
"protein2": "8022.A0A060VMZ0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060ZAC5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060WHP4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 217,
"database": 824,
"textmining": 86,
"combined_score": 863
},
{
"protein2": "8022.A0A060X3A7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 217,
"database": 654,
"textmining": 86,
"combined_score": 730
},
{
"protein2": "8022.A0A060VPK7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060Z7Q1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 397,
"database": 619,
"textmining": 135,
"combined_score": 789
},
{
"protein2": "8022.A0A060VSM2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 341,
"database": 654,
"textmining": 107,
"combined_score": 778
},
{
"protein2": "8022.A0A060WPG0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 234,
"database": 572,
"textmining": 317,
"combined_score": 756
},
{
"protein2": "8022.A0A060XEI8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 712,
"database": 825,
"textmining": 411,
"combined_score": 967
},
{
"protein2": "8022.A0A060Y3W2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 112,
"combined_score": 746
},
{
"protein2": "8022.A0A060XE22",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 217,
"database": 654,
"textmining": 86,
"combined_score": 730
},
{
"protein2": "8022.A0A060W2Y1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 717,
"database": 825,
"textmining": 450,
"combined_score": 971
},
{
"protein2": "8022.A0A060YSP1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 397,
"database": 619,
"textmining": 135,
"combined_score": 789
},
{
"protein2": "8022.A0A060X0B9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 499,
"database": 785,
"textmining": 228,
"combined_score": 911
},
{
"protein2": "8022.A0A060YA72",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 185,
"database": 755,
"textmining": 320,
"combined_score": 856
},
{
"protein2": "8022.A0A060WWW9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 341,
"database": 654,
"textmining": 107,
"combined_score": 778
},
{
"protein2": "8022.A0A060WFN4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 751,
"database": 862,
"textmining": 489,
"combined_score": 981
},
{
"protein2": "8022.A0A060Z7S6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 397,
"database": 619,
"textmining": 135,
"combined_score": 789
},
{
"protein2": "8022.A0A060Z9A4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060XMN7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 185,
"database": 755,
"textmining": 320,
"combined_score": 856
},
{
"protein2": "8022.A0A060XWP0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 261,
"database": 506,
"textmining": 329,
"combined_score": 741
},
{
"protein2": "8022.A0A060WGT0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 751,
"database": 862,
"textmining": 489,
"combined_score": 981
},
{
"protein2": "8022.A0A060YN46",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 397,
"database": 619,
"textmining": 135,
"combined_score": 789
},
{
"protein2": "8022.A0A060WMM4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 261,
"database": 506,
"textmining": 308,
"combined_score": 733
},
{
"protein2": "8022.A0A060X3D3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 185,
"database": 824,
"textmining": 320,
"combined_score": 896
},
{
"protein2": "8022.A0A060YT60",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 712,
"database": 825,
"textmining": 411,
"combined_score": 967
},
{
"protein2": "8022.A0A060ZXZ7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 125,
"experimental": 363,
"database": 825,
"textmining": 505,
"combined_score": 945
},
{
"protein2": "8022.A0A060WVX3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 667,
"textmining": 167,
"combined_score": 713
},
{
"protein2": "8022.A0A060Y4P1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 217,
"database": 764,
"textmining": 86,
"combined_score": 816
},
{
"protein2": "8022.A0A060YFT4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 335,
"database": 570,
"textmining": 0,
"combined_score": 701
},
{
"protein2": "8022.A0A060Z681",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 889,
"database": 832,
"textmining": 505,
"combined_score": 989
},
{
"protein2": "8022.A0A060VN59",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060X678",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060Y0Y0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 764,
"textmining": 144,
"combined_score": 791
},
{
"protein2": "8022.A0A060X4V6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060YX93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 764,
"textmining": 0,
"combined_score": 765
},
{
"protein2": "8022.A0A060WDK2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 880,
"database": 841,
"textmining": 423,
"combined_score": 988
},
{
"protein2": "8022.A0A060VW27",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 341,
"database": 654,
"textmining": 107,
"combined_score": 778
},
{
"protein2": "8022.A0A060YWL7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 908,
"database": 827,
"textmining": 489,
"combined_score": 991
},
{
"protein2": "8022.A0A060W7T1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060WDS6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 175,
"database": 737,
"textmining": 246,
"combined_score": 822
},
{
"protein2": "8022.A0A060WZ23",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 335,
"database": 570,
"textmining": 0,
"combined_score": 701
},
{
"protein2": "8022.A0A060XUA7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 185,
"database": 755,
"textmining": 320,
"combined_score": 856
},
{
"protein2": "8022.A0A060WIC9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 764,
"textmining": 144,
"combined_score": 791
},
{
"protein2": "8022.A0A060XCU8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 217,
"database": 654,
"textmining": 86,
"combined_score": 730
},
{
"protein2": "8022.A0A060XLZ6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 185,
"database": 755,
"textmining": 320,
"combined_score": 856
},
{
"protein2": "8022.A0A060YFY3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 341,
"database": 654,
"textmining": 107,
"combined_score": 778
},
{
"protein2": "8022.A0A060X3K2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 824,
"textmining": 237,
"combined_score": 861
},
{
"protein2": "8022.A0A060WR55",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 397,
"database": 619,
"textmining": 135,
"combined_score": 789
},
{
"protein2": "8022.A0A060YQJ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060WGD6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 824,
"textmining": 230,
"combined_score": 859
},
{
"protein2": "8022.A0A060W010",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 880,
"database": 841,
"textmining": 423,
"combined_score": 988
},
{
"protein2": "8022.A0A060WH79",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 880,
"database": 862,
"textmining": 443,
"combined_score": 990
},
{
"protein2": "8022.A0A060Y8M4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060YMA8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060X7V7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 667,
"textmining": 167,
"combined_score": 713
},
{
"protein2": "8022.A0A060X4A4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060WE22",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 341,
"database": 654,
"textmining": 107,
"combined_score": 778
},
{
"protein2": "8022.A0A060YTI2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 449,
"combined_score": 842
},
{
"protein2": "8022.A0A060WMC0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 175,
"database": 737,
"textmining": 246,
"combined_score": 822
},
{
"protein2": "8022.A0A060Y599",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060X4L3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 217,
"database": 654,
"textmining": 86,
"combined_score": 730
},
{
"protein2": "8022.A0A060Y8P3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 217,
"database": 667,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060WRE1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 880,
"database": 836,
"textmining": 389,
"combined_score": 987
},
{
"protein2": "8022.A0A060XKG4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 185,
"database": 824,
"textmining": 320,
"combined_score": 896
},
{
"protein2": "8022.A0A060WH36",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 217,
"database": 764,
"textmining": 86,
"combined_score": 816
},
{
"protein2": "8022.A0A060WTZ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 880,
"database": 836,
"textmining": 389,
"combined_score": 987
},
{
"protein2": "8022.A0A060XRP8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 764,
"textmining": 150,
"combined_score": 792
},
{
"protein2": "8022.A0A060XTA1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 449,
"combined_score": 842
},
{
"protein2": "8022.A0A060W1A6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 499,
"database": 785,
"textmining": 228,
"combined_score": 911
},
{
"protein2": "8022.A0A060XQK8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060X9J9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060YCY4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 908,
"database": 827,
"textmining": 489,
"combined_score": 991
},
{
"protein2": "8022.A0A060YHN1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 185,
"database": 755,
"textmining": 320,
"combined_score": 856
},
{
"protein2": "8022.A0A060YTB0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 499,
"database": 785,
"textmining": 228,
"combined_score": 911
},
{
"protein2": "8022.A0A060X2Z7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 824,
"textmining": 237,
"combined_score": 861
},
{
"protein2": "8022.A0A060Y4X6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 217,
"database": 667,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060YPE8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 499,
"database": 824,
"textmining": 228,
"combined_score": 927
},
{
"protein2": "8022.A0A060YPV1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 499,
"database": 785,
"textmining": 228,
"combined_score": 911
},
{
"protein2": "8022.A0A060WBE7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 53,
"experimental": 254,
"database": 744,
"textmining": 108,
"combined_score": 817
},
{
"protein2": "8022.A0A060XR59",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060XMS2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060W620",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 175,
"database": 737,
"textmining": 246,
"combined_score": 822
},
{
"protein2": "8022.A0A060Y3L3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060XEQ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 234,
"database": 572,
"textmining": 317,
"combined_score": 756
},
{
"protein2": "8022.A0A060XTF4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060WSK7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 341,
"database": 654,
"textmining": 107,
"combined_score": 778
},
{
"protein2": "8022.A0A060W9W2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 449,
"combined_score": 842
},
{
"protein2": "8022.A0A060Y5J3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 217,
"database": 667,
"textmining": 86,
"combined_score": 740
},
{
"protein2": "8022.A0A060Y4W6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 261,
"database": 506,
"textmining": 308,
"combined_score": 733
},
{
"protein2": "8022.A0A060Y8T1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060XE11",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 450,
"combined_score": 842
},
{
"protein2": "8022.A0A060WUS8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 764,
"textmining": 0,
"combined_score": 765
},
{
"protein2": "8022.A0A060YBF2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 450,
"combined_score": 842
},
{
"protein2": "8022.A0A061A6D5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060W9J5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 112,
"combined_score": 746
},
{
"protein2": "8022.A0A060WNK3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 341,
"database": 654,
"textmining": 107,
"combined_score": 778
},
{
"protein2": "8022.A0A060YTY7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 341,
"database": 654,
"textmining": 107,
"combined_score": 778
},
{
"protein2": "8022.A0A060ZCG7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060VMS8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060WWY0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060VXV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 341,
"database": 654,
"textmining": 107,
"combined_score": 778
},
{
"protein2": "8022.A0A060Z2R2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 98,
"combined_score": 742
},
{
"protein2": "8022.A0A060XV27",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 458,
"database": 515,
"textmining": 112,
"combined_score": 746
},
{
"protein2": "8022.A0A060YYR0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 341,
"database": 654,
"textmining": 107,
"combined_score": 778
},
{
"protein2": "8022.A0A060ZCR8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 764,
"textmining": 150,
"combined_score": 792
},
{
"protein2": "8022.A0A060ZBY8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 397,
"database": 619,
"textmining": 135,
"combined_score": 789
},
{
"protein2": "8022.A0A060YHR8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 0,
"database": 667,
"textmining": 167,
"combined_score": 713
}
] |
A0A060YGE9
|
G-protein coupled receptors family 1 profile domain-containing protein
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 375
|
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}. Early endosome {ECO:0000256|ARBA:ARBA00004412}.
|
MPVYQGARCRTCFSQNEKMTTEFITDFTDYPTDNTDLDYDHWTQQCQKESNRHFRSWFMPTFYSLICFLGLVGNILVIGTYVYFNRLKTGTDVFLLSLSVADLLFVVSLPLWATNSMTEWVLGLFICKAMHTIYKVSFYSGMFLLASISVDRYFAISKAVSAHRHRSMAVFISKVTSVVIWVMALVFSVPEMSYTNISNKTCTPYTAGSDQVRVAIQVSQMVLGFVLPLLIMAFCYGAIVKTLCQARSFEKNKAIKVIFTLVAVFLLCQVPYNLVLLLTTLDAAKGGSKDCLYDNSLLYAADITQCLAFLRCCLNPFVYAFIGVKFRRDLLKLLKDLGCMSKERFFHTSQKFGHTYSFQGLLYWYYFLHLKTSKP
|
[
"GO:0006952",
"GO:0140546",
"GO:0009605",
"GO:0050896",
"GO:0009615",
"GO:0051607",
"GO:0051707",
"GO:0009607",
"GO:0006950",
"GO:0098542",
"GO:0008150",
"GO:0044419",
"GO:0043207",
"GO:0110165",
"GO:0005575",
"GO:0016020"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0044419",
"GO:0009605",
"GO:0051707",
"GO:0009607",
"GO:0006950",
"GO:0006952",
"GO:0009615",
"GO:0098542",
"GO:0043207",
"GO:0140546",
"GO:0051607"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0016020"
] |
[
"IPR050119",
"IPR000355",
"IPR001277",
"IPR000276",
"IPR017452"
] |
af_db/AF-A0A060YGE9-F1-model_v4.cif.gz
|
8022.A0A060YGE9
|
[
"8022.A0A060WB80",
"8022.A0A060Y0D9",
"8022.A0A060Y300",
"8022.A0A060Y3X6",
"8022.A0A060WRY3",
"8022.A0A060YK59",
"8022.A0A060W8I0",
"8022.A0A060XA34",
"8022.A0A060WZ17",
"8022.A0A060WZ98",
"8022.A0A060XGQ8",
"8022.Q64IC2",
"8022.A0A060Z480",
"8022.A0A060YR93",
"8022.A0A060WQA6",
"8022.A0A060WVZ9",
"8022.A0A060X2G9",
"8022.A0A060WUE4",
"8022.Q1G669",
"8022.A0A060XRQ9",
"8022.A0A060XVD9",
"8022.A0A060VTH0",
"8022.H1ZZ93",
"8022.A0A060WIW2",
"8022.A0A060W0Q4",
"8022.A0A060VTG0",
"8022.H1ZZ96",
"8022.A0A060WXC1",
"8022.A0A060W8T4",
"8022.A0A060XL04",
"8022.A0A060Y097",
"8022.A0A060WHG5",
"8022.A0A060YC25",
"8022.A0A060XF71",
"8022.A0A060WT98",
"8022.A0A060WGC3",
"8022.A0A060YA11",
"8022.A0A060WVB6",
"8022.A0A060YNV4",
"8022.A0A060WD73",
"8022.A0A060XSB8",
"8022.A0A060YBB6",
"8022.A0A060VST7",
"8022.A0A060YL85",
"8022.A0A060YH38",
"8022.A0A060Y1H7",
"8022.A0A060Y1Y5",
"8022.A0A060XPS3",
"8022.A0A060WMN1"
] |
[
{
"protein2": "8022.A0A060WB80",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 645,
"textmining": 506,
"combined_score": 817
},
{
"protein2": "8022.A0A060Y0D9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 188,
"database": 787,
"textmining": 92,
"combined_score": 829
},
{
"protein2": "8022.A0A060Y300",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 93,
"database": 747,
"textmining": 218,
"combined_score": 804
},
{
"protein2": "8022.A0A060Y3X6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 153,
"combined_score": 783
},
{
"protein2": "8022.A0A060WRY3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 87,
"combined_score": 766
},
{
"protein2": "8022.A0A060YK59",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 341,
"database": 569,
"textmining": 49,
"combined_score": 706
},
{
"protein2": "8022.A0A060W8I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 839,
"textmining": 86,
"combined_score": 846
},
{
"protein2": "8022.A0A060XA34",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 341,
"database": 569,
"textmining": 49,
"combined_score": 706
},
{
"protein2": "8022.A0A060WZ17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 202,
"database": 787,
"textmining": 276,
"combined_score": 870
},
{
"protein2": "8022.A0A060WZ98",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 319,
"database": 755,
"textmining": 51,
"combined_score": 827
},
{
"protein2": "8022.A0A060XGQ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 275,
"database": 787,
"textmining": 308,
"combined_score": 883
},
{
"protein2": "8022.Q64IC2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 188,
"database": 826,
"textmining": 62,
"combined_score": 855
},
{
"protein2": "8022.A0A060Z480",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 341,
"database": 569,
"textmining": 49,
"combined_score": 706
},
{
"protein2": "8022.A0A060YR93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 341,
"database": 569,
"textmining": 49,
"combined_score": 706
},
{
"protein2": "8022.A0A060WQA6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 787,
"textmining": 48,
"combined_score": 789
},
{
"protein2": "8022.A0A060WVZ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 0,
"combined_score": 701
},
{
"protein2": "8022.A0A060X2G9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 0,
"combined_score": 701
},
{
"protein2": "8022.A0A060WUE4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 87,
"combined_score": 766
},
{
"protein2": "8022.Q1G669",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 826,
"textmining": 175,
"combined_score": 850
},
{
"protein2": "8022.A0A060XRQ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 0,
"combined_score": 701
},
{
"protein2": "8022.A0A060XVD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 291,
"database": 783,
"textmining": 0,
"combined_score": 839
},
{
"protein2": "8022.A0A060VTH0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 787,
"textmining": 168,
"combined_score": 815
},
{
"protein2": "8022.H1ZZ93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 275,
"database": 787,
"textmining": 308,
"combined_score": 883
},
{
"protein2": "8022.A0A060WIW2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 426,
"database": 425,
"textmining": 222,
"combined_score": 720
},
{
"protein2": "8022.A0A060W0Q4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 341,
"database": 569,
"textmining": 49,
"combined_score": 706
},
{
"protein2": "8022.A0A060VTG0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 319,
"database": 755,
"textmining": 51,
"combined_score": 827
},
{
"protein2": "8022.H1ZZ96",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 787,
"textmining": 168,
"combined_score": 815
},
{
"protein2": "8022.A0A060WXC1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 0,
"combined_score": 701
},
{
"protein2": "8022.A0A060W8T4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 341,
"database": 569,
"textmining": 49,
"combined_score": 706
},
{
"protein2": "8022.A0A060XL04",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 188,
"database": 839,
"textmining": 403,
"combined_score": 916
},
{
"protein2": "8022.A0A060Y097",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 188,
"database": 787,
"textmining": 182,
"combined_score": 846
},
{
"protein2": "8022.A0A060WHG5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 341,
"database": 569,
"textmining": 49,
"combined_score": 706
},
{
"protein2": "8022.A0A060YC25",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 341,
"database": 569,
"textmining": 49,
"combined_score": 706
},
{
"protein2": "8022.A0A060XF71",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 93,
"database": 785,
"textmining": 234,
"combined_score": 837
},
{
"protein2": "8022.A0A060WT98",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 87,
"combined_score": 766
},
{
"protein2": "8022.A0A060WGC3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 0,
"combined_score": 701
},
{
"protein2": "8022.A0A060YA11",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 188,
"database": 839,
"textmining": 274,
"combined_score": 898
},
{
"protein2": "8022.A0A060WVB6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 72,
"experimental": 202,
"database": 826,
"textmining": 365,
"combined_score": 907
},
{
"protein2": "8022.A0A060YNV4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 93,
"database": 785,
"textmining": 234,
"combined_score": 837
},
{
"protein2": "8022.A0A060WD73",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 153,
"combined_score": 783
},
{
"protein2": "8022.A0A060XSB8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 0,
"combined_score": 701
},
{
"protein2": "8022.A0A060YBB6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 188,
"database": 826,
"textmining": 182,
"combined_score": 874
},
{
"protein2": "8022.A0A060VST7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 755,
"textmining": 153,
"combined_score": 783
},
{
"protein2": "8022.A0A060YL85",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 319,
"database": 755,
"textmining": 51,
"combined_score": 827
},
{
"protein2": "8022.A0A060YH38",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 787,
"textmining": 48,
"combined_score": 789
},
{
"protein2": "8022.A0A060Y1H7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 0,
"combined_score": 701
},
{
"protein2": "8022.A0A060Y1Y5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 93,
"database": 761,
"textmining": 0,
"combined_score": 773
},
{
"protein2": "8022.A0A060XPS3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 0,
"combined_score": 701
},
{
"protein2": "8022.A0A060WMN1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 564,
"textmining": 0,
"combined_score": 701
}
] |
A0A060ZZG4
|
Ig-like domain-containing protein
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 234
| null |
MCSFTFRLVDGGLMFLLLSLTRISAQREMSLNTTTISHYTESPCQLFDKYETTVTEGEALSLPAYRDLSELVWASVTEFTWYRNRTQELPSSEEERVHHHGPVLFFLPLLINDSDQYYTYWRKGADTCLIFVTEVIVVKAQPFDHSVLFNDISESAENIAIPCPDPVEKLCQDGKENLVWYKNFSLIPNESERNLWVYGASKADEGIYTCVCTWEHNGTVLNTSASRRLKIQGM
|
[
"GO:1901223",
"GO:0002764",
"GO:0031347",
"GO:0051641",
"GO:0009968",
"GO:0065007",
"GO:0034504",
"GO:0010648",
"GO:0023057",
"GO:0002831",
"GO:0032103",
"GO:0051179",
"GO:0045089",
"GO:0033365",
"GO:0048518",
"GO:0050776",
"GO:0008150",
"GO:0002758",
"GO:0045088",
"GO:0002757",
"GO:0050896",
"GO:0050789",
"GO:0048584",
"GO:0010646",
"GO:0002833",
"GO:0080134",
"GO:0002684",
"GO:0050794",
"GO:0009966",
"GO:0048583",
"GO:1901222",
"GO:0002221",
"GO:0051716",
"GO:0070727",
"GO:0002376",
"GO:0050778",
"GO:0032101",
"GO:0023051",
"GO:0009987",
"GO:0002682",
"GO:0023052",
"GO:0031349",
"GO:1902532",
"GO:0002253",
"GO:0002224",
"GO:0008104",
"GO:0033036",
"GO:0048523",
"GO:0048519",
"GO:0048585",
"GO:1902531",
"GO:0007154",
"GO:0007165",
"GO:0002218",
"GO:0005622",
"GO:0031090",
"GO:0043226",
"GO:0031967",
"GO:0016234",
"GO:0031965",
"GO:0005783",
"GO:0031975",
"GO:0005575",
"GO:0005635",
"GO:0016020",
"GO:0043231",
"GO:0043229",
"GO:0110165",
"GO:0005737",
"GO:0043227",
"GO:0012505",
"GO:0005634"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0051179",
"GO:0048518",
"GO:0050896",
"GO:0050789",
"GO:0002376",
"GO:0009987",
"GO:0023052",
"GO:0048519",
"GO:0051641",
"GO:0023057",
"GO:0048584",
"GO:0002684",
"GO:0050794",
"GO:0048583",
"GO:0051716",
"GO:0023051",
"GO:0002682",
"GO:0002253",
"GO:0033036",
"GO:0048523",
"GO:0048585",
"GO:0007154",
"GO:0007165",
"GO:0002764",
"GO:0009968",
"GO:0010648",
"GO:0002831",
"GO:0032103",
"GO:0050776",
"GO:0002757",
"GO:0010646",
"GO:0002833",
"GO:0080134",
"GO:0009966",
"GO:0070727",
"GO:0050778",
"GO:0032101",
"GO:0031349",
"GO:0002218",
"GO:0031347",
"GO:0045089",
"GO:0002758",
"GO:0045088",
"GO:1902532",
"GO:0008104",
"GO:1902531",
"GO:1901223",
"GO:0033365",
"GO:1901222",
"GO:0002221",
"GO:0034504",
"GO:0002224"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0031975",
"GO:0016020",
"GO:0005737",
"GO:0012505",
"GO:0031090",
"GO:0031967",
"GO:0016234",
"GO:0005783",
"GO:0005635",
"GO:0043229",
"GO:0043227",
"GO:0031965",
"GO:0043231",
"GO:0005634"
] |
[
"IPR036179",
"IPR013783",
"IPR015621"
] |
af_db/AF-A0A060ZZG4-F1-model_v4.cif.gz
|
8022.A0A060ZZG4
|
[
"8022.A0A060ZXZ7",
"8022.C1BEZ2",
"8022.A0A060WTK5",
"8022.A0A060WD93",
"8022.A0A060VYK6",
"8022.A0A061AEF4",
"8022.A0A060WVY3",
"8022.A0A060YRQ4",
"8022.A0A060YIW1",
"8022.A0A060YIQ8",
"8022.A0A060Z3R0",
"8022.A0A060YP34",
"8022.A0A060WQS0",
"8022.A0A060XXD6",
"8022.A0A060W2E3",
"8022.A0A060WBT7",
"8022.A0A060YNP8",
"8022.A0A060Z0U0",
"8022.A0A060X3S2",
"8022.A0A060WYH3"
] |
[
{
"protein2": "8022.A0A060ZXZ7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 322,
"database": 597,
"textmining": 359,
"combined_score": 815
},
{
"protein2": "8022.C1BEZ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 571,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060WTK5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 686,
"database": 787,
"textmining": 389,
"combined_score": 955
},
{
"protein2": "8022.A0A060WD93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 86,
"experimental": 929,
"database": 830,
"textmining": 505,
"combined_score": 993
},
{
"protein2": "8022.A0A060VYK6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 571,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A061AEF4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 0,
"database": 762,
"textmining": 133,
"combined_score": 789
},
{
"protein2": "8022.A0A060WVY3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 0,
"database": 778,
"textmining": 276,
"combined_score": 835
},
{
"protein2": "8022.A0A060YRQ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 571,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060YIW1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 322,
"database": 597,
"textmining": 264,
"combined_score": 781
},
{
"protein2": "8022.A0A060YIQ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 541,
"database": 787,
"textmining": 134,
"combined_score": 908
},
{
"protein2": "8022.A0A060Z3R0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 0,
"database": 762,
"textmining": 133,
"combined_score": 789
},
{
"protein2": "8022.A0A060YP34",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 0,
"database": 778,
"textmining": 276,
"combined_score": 835
},
{
"protein2": "8022.A0A060WQS0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 571,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060XXD6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 541,
"database": 787,
"textmining": 134,
"combined_score": 908
},
{
"protein2": "8022.A0A060W2E3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 571,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060WBT7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 0,
"database": 778,
"textmining": 276,
"combined_score": 835
},
{
"protein2": "8022.A0A060YNP8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 828,
"textmining": 494,
"combined_score": 939
},
{
"protein2": "8022.A0A060Z0U0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 686,
"database": 787,
"textmining": 389,
"combined_score": 955
},
{
"protein2": "8022.A0A060X3S2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 823,
"textmining": 391,
"combined_score": 887
},
{
"protein2": "8022.A0A060WYH3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 571,
"textmining": 86,
"combined_score": 727
}
] |
A0A0A7MA29
|
Prostaglandin E2 receptor EP4 subtype (Prostanoid EP4 receptor)
|
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function. {ECO:0000256|ARBA:ARBA00025493}.
|
Salmo salar (Atlantic salmon)
| 472
|
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
|
MSGMNNGTMTSGPREPTIPVIMFIFGVVGNVIAIVVLRKSRKEQKETTFYTLVCGLAVTDLLGTLLASPVTIATYVQGKWPGGESLCQYSGFILLFFFLVGLSIICAMSIERYLAINHAYFYNHYVDQRLAALTLAGIYISNVLFCALPAMGLGKVNKQFPGTWCFIDWRTNDSAHAAFSYMYAGVSSFLILATVICNVLVCGALIMMHKRFIRRTSLGTDQGGRIADLRRRRSFQRLAGAEIQMVILLIATSAVVLVCSIPLVLRVFVNQLSMVAFDAHSTPLEKNPDLHAIRIASINPILDPWIYILLRKTVLLKLVEKIKCLFCRMGCRGRGSGVRGQFHCGGEGHPNSSIVSRDSPSLVSRELREVISTSQTFLYLPEGTGGGSRGTGGEGRPSPPAVECSLLQDQQTPGGKGMQNDSKKGTLGPSISMRTDGTVDPSPLNRVPSVRKDKTLHVTFTDETLNLQEKCI
|
[
"GO:1901655",
"GO:0071379",
"GO:0065007",
"GO:0097305",
"GO:0032870",
"GO:0008150",
"GO:0042221",
"GO:1901654",
"GO:0050896",
"GO:0050789",
"GO:0019222",
"GO:0071310",
"GO:0033993",
"GO:0070887",
"GO:0010605",
"GO:0009719",
"GO:0034695",
"GO:0034694",
"GO:0051716",
"GO:0071495",
"GO:0060255",
"GO:0009987",
"GO:0071380",
"GO:1901700",
"GO:0097306",
"GO:0010033",
"GO:0048519",
"GO:1901701",
"GO:0009725",
"GO:0010629",
"GO:0010468",
"GO:0009892",
"GO:0071396",
"GO:0110165",
"GO:0005575",
"GO:0016020"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050896",
"GO:0050789",
"GO:0009987",
"GO:0048519",
"GO:0042221",
"GO:0019222",
"GO:0009719",
"GO:0051716",
"GO:0009892",
"GO:0070887",
"GO:0010605",
"GO:0071495",
"GO:0060255",
"GO:1901700",
"GO:0010033",
"GO:0009725",
"GO:0097305",
"GO:0032870",
"GO:1901654",
"GO:0071310",
"GO:0033993",
"GO:0034694",
"GO:1901701",
"GO:0010629",
"GO:0010468",
"GO:1901655",
"GO:0071379",
"GO:0034695",
"GO:0097306",
"GO:0071396",
"GO:0071380"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0016020"
] |
[
"IPR000276",
"IPR017452",
"IPR001758",
"IPR008365",
"IPR001244"
] |
af_db/AF-A0A0A7MA29-F1-model_v4.cif.gz
| null | null | null |
A0A060D574
|
Sodium/potassium-transporting ATPase subunit alpha
| null |
Salmo salar (Atlantic salmon)
| 875
|
Cell membrane, sarcolemma {ECO:0000256|ARBA:ARBA00004415}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004415}. Cell membrane {ECO:0000256|RuleBase:RU362084}; Multi-pass membrane protein {ECO:0000256|RuleBase:RU362084}.
|
KQMFGGFSMLLWTGALLCFLAYGIQAAMEDEPANDNLYLGVVLSAVVIVTGCFSYYQEAKSSKIMDSFKNLVPQQALVVRDGEKMNINAQQVVVGDLVEVKGGDRIPADLRIISASGCKVDNSSLTGESEPQTRTPDYSNDNPLETRNIAFFSTNCVEGTARGIVINTGDRTVMGRIATLASGLEVGRTPISIEIEHFIHIITGVAVFLGMSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGTSFDRSSATWAALARVAGLCNRAVFLAEQSGIPILKRDVAGDASESALLKCIELCCGSVQGMRDQYTKVAEIPFNSTNKYQLSVHLNKNEGESKHLLVMKGAPERILDRCSTILIQGKEQPLDDEMKDSFQNAYMELGGLGERVLGFCHFQLPDDQFAEGFQFDCEEVNFPTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNEVDPRDAKACVVHGGDLKDLSAEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSKTDKLVNERLISIAYGQIGMIQALAGFFTYFVILAENGFLPSRLLGIRVDWDNKFCNDLEDSYGQQWTYEQRKIVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMRNKILIFGLFEETALAAFL
|
[
"GO:0006970",
"GO:0050896",
"GO:0009628",
"GO:0009651",
"GO:0006950",
"GO:0008150",
"GO:0042538",
"GO:0006972",
"GO:0045178",
"GO:0009925",
"GO:0110165",
"GO:0016323",
"GO:0098590",
"GO:0071944",
"GO:0005575",
"GO:0016020",
"GO:0005886",
"GO:0015399",
"GO:0008556",
"GO:0008554",
"GO:0015079",
"GO:0140358",
"GO:0022890",
"GO:0005215",
"GO:0015662",
"GO:1901702",
"GO:0022853",
"GO:0042626",
"GO:0015075",
"GO:0005391",
"GO:0022857",
"GO:0015318",
"GO:0008324",
"GO:0140657",
"GO:0046873",
"GO:0015081",
"GO:0003674",
"GO:0019829",
"GO:0022804"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0009628",
"GO:0006950",
"GO:0006970",
"GO:0009651",
"GO:0006972",
"GO:0042538"
] |
[
"GO:0003674",
"GO:0005215",
"GO:0140657",
"GO:0042626",
"GO:0022857",
"GO:0140358",
"GO:1901702",
"GO:0015075",
"GO:0015318",
"GO:0019829",
"GO:0022804",
"GO:0015399",
"GO:0008556",
"GO:0008554",
"GO:0015079",
"GO:0022890",
"GO:0015662",
"GO:0022853",
"GO:0008324",
"GO:0015081",
"GO:0005391",
"GO:0046873"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0045178",
"GO:0071944",
"GO:0016020",
"GO:0009925",
"GO:0098590",
"GO:0005886",
"GO:0016323"
] |
[
"IPR006068",
"IPR023299",
"IPR018303",
"IPR023298",
"IPR008250",
"IPR050510",
"IPR036412",
"IPR023214",
"IPR005775",
"IPR001757",
"IPR044492"
] |
af_db/AF-A0A060D574-F1-model_v4.cif.gz
| null | null | null |
A0A060W139
|
Alpha-2A adrenergic receptor (Alpha-2A adrenoreceptor)
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 390
|
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
|
MGCDNLTNSNKTLPGRLPYTVQTSVPLTILVGILILLTVFGNVLVVIAVFTSRALRAPQNLFLVSLACADILVATLVMPFSLANELMGYWYFGQVWCEIYLALDVLFCTSSITHLCAISLDRYWSVTQAIEYNSKRTPRRIKCIVLFVWVLAAIISFPPLISMEKEGAKEEGPTCKINEEKWYIIFSSTASFFAPCVIMILVYVRIYQVAKNRTRAPPGERRRGNNNPDKSQRNREGGRDGVEEVNGIDVGEECSSSDGNENQCSIKMKLRKGKTKVSQVKLEDPSPKDYDAQQCVKVSRWKGRQNREKRFTFVLAVVMGVFVVCWFPFFFTYTLTAICESCCVPETLFNFFFWFGYCNSSLNPVIYTIFNNDFRRSFKKILCKKDRRGL
|
[
"GO:0051716",
"GO:0051602",
"GO:0009628",
"GO:0009987",
"GO:0051952",
"GO:0065007",
"GO:0023052",
"GO:1903530",
"GO:0032811",
"GO:0033604",
"GO:0051046",
"GO:0051049",
"GO:0051051",
"GO:0008150",
"GO:0071875",
"GO:0050896",
"GO:0050789",
"GO:0014060",
"GO:0051953",
"GO:0050433",
"GO:0048523",
"GO:0048519",
"GO:0007186",
"GO:0051048",
"GO:0032879",
"GO:1903531",
"GO:0007154",
"GO:0007165",
"GO:0050794"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0023052",
"GO:0050896",
"GO:0050789",
"GO:0048519",
"GO:0051716",
"GO:0009628",
"GO:0051051",
"GO:0048523",
"GO:0032879",
"GO:0007154",
"GO:0007165",
"GO:0050794",
"GO:0051602",
"GO:1903530",
"GO:0051049",
"GO:0051953",
"GO:0007186",
"GO:0051048",
"GO:1903531",
"GO:0051952",
"GO:0033604",
"GO:0051046",
"GO:0071875",
"GO:0050433",
"GO:0032811",
"GO:0014060"
] | null | null |
[
"IPR002233",
"IPR000276",
"IPR017452"
] |
af_db/AF-A0A060W139-F1-model_v4.cif.gz
|
8022.A0A060W139
|
[
"8022.A0A060ZAK0",
"8022.A0A060W8V2",
"8022.A0A060XVD9",
"8022.A0A060XC17",
"8022.A0A060WL89",
"8022.A0A060YP44",
"8022.A0A060Z6I0",
"8022.C1BH40",
"8022.A0A060WEW9",
"8022.A0A060Z6E2",
"8022.A0A060Z1D1",
"8022.A0A060Y8H5",
"8022.A0A060WHA4",
"8022.A0A060YR57",
"8022.A0A060Y2Z0",
"8022.Q7SZV5"
] |
[
{
"protein2": "8022.A0A060ZAK0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 416,
"database": 571,
"textmining": 89,
"combined_score": 751
},
{
"protein2": "8022.A0A060W8V2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 596,
"textmining": 0,
"combined_score": 728
},
{
"protein2": "8022.A0A060XVD9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 291,
"database": 783,
"textmining": 0,
"combined_score": 839
},
{
"protein2": "8022.A0A060XC17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 571,
"textmining": 0,
"combined_score": 708
},
{
"protein2": "8022.A0A060WL89",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 579,
"textmining": 0,
"combined_score": 716
},
{
"protein2": "8022.A0A060YP44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 523,
"textmining": 88,
"combined_score": 716
},
{
"protein2": "8022.A0A060Z6I0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 401,
"database": 523,
"textmining": 88,
"combined_score": 716
},
{
"protein2": "8022.C1BH40",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 626,
"database": 523,
"textmining": 0,
"combined_score": 816
},
{
"protein2": "8022.A0A060WEW9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 579,
"textmining": 0,
"combined_score": 716
},
{
"protein2": "8022.A0A060Z6E2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 579,
"textmining": 0,
"combined_score": 716
},
{
"protein2": "8022.A0A060Z1D1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 626,
"database": 523,
"textmining": 0,
"combined_score": 816
},
{
"protein2": "8022.A0A060Y8H5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 349,
"database": 596,
"textmining": 0,
"combined_score": 725
},
{
"protein2": "8022.A0A060WHA4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 149,
"experimental": 267,
"database": 571,
"textmining": 86,
"combined_score": 722
},
{
"protein2": "8022.A0A060YR57",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 579,
"textmining": 0,
"combined_score": 716
},
{
"protein2": "8022.A0A060Y2Z0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 355,
"database": 579,
"textmining": 0,
"combined_score": 716
},
{
"protein2": "8022.Q7SZV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 387,
"database": 568,
"textmining": 86,
"combined_score": 736
}
] |
A0A060WMZ6
|
TIR domain-containing protein
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 230
| null |
MGLCVVLLLFFLLAAVAVKVFDIDLALLFRGVFKCCGRSEDGKVYDAYVVYQMDGLDQEREEKVYHFVSIVLPTVLEKKCGFRLFIHGRDDLPGEDNMELVEDCMRLSRRLIVILTPSSSTWSGSGGQGSCGQWGYSSSLTTAGDYDCQVGLLQALVHSEMNVILIQLGDMGEGGYTHLPPGLQHLVRKSAPLMWHEGRRGSTLPNSSFWKRVRYMMPWPRSTSFDNQLI
|
[
"GO:1901223",
"GO:0002764",
"GO:0031347",
"GO:0051641",
"GO:0009968",
"GO:0065007",
"GO:0034504",
"GO:0010648",
"GO:0023057",
"GO:0002831",
"GO:0032103",
"GO:0051179",
"GO:0045089",
"GO:0033365",
"GO:0048518",
"GO:0050776",
"GO:0008150",
"GO:0002758",
"GO:0045088",
"GO:0002757",
"GO:0050896",
"GO:0050789",
"GO:0048584",
"GO:0010646",
"GO:0002833",
"GO:0080134",
"GO:0002684",
"GO:0050794",
"GO:0009966",
"GO:0048583",
"GO:1901222",
"GO:0002221",
"GO:0051716",
"GO:0070727",
"GO:0002376",
"GO:0050778",
"GO:0032101",
"GO:0023051",
"GO:0009987",
"GO:0002682",
"GO:0023052",
"GO:0031349",
"GO:1902532",
"GO:0002253",
"GO:0002224",
"GO:0008104",
"GO:0033036",
"GO:0048523",
"GO:0048519",
"GO:0048585",
"GO:1902531",
"GO:0007154",
"GO:0007165",
"GO:0002218",
"GO:0005622",
"GO:0031090",
"GO:0043226",
"GO:0031967",
"GO:0016234",
"GO:0031965",
"GO:0005783",
"GO:0031975",
"GO:0005575",
"GO:0005635",
"GO:0016020",
"GO:0043231",
"GO:0043229",
"GO:0110165",
"GO:0005737",
"GO:0043227",
"GO:0012505",
"GO:0005634"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0051179",
"GO:0048518",
"GO:0050896",
"GO:0050789",
"GO:0002376",
"GO:0009987",
"GO:0023052",
"GO:0048519",
"GO:0051641",
"GO:0023057",
"GO:0048584",
"GO:0002684",
"GO:0050794",
"GO:0048583",
"GO:0051716",
"GO:0023051",
"GO:0002682",
"GO:0002253",
"GO:0033036",
"GO:0048523",
"GO:0048585",
"GO:0007154",
"GO:0007165",
"GO:0002764",
"GO:0009968",
"GO:0010648",
"GO:0002831",
"GO:0032103",
"GO:0050776",
"GO:0002757",
"GO:0010646",
"GO:0002833",
"GO:0080134",
"GO:0009966",
"GO:0070727",
"GO:0050778",
"GO:0032101",
"GO:0031349",
"GO:0002218",
"GO:0031347",
"GO:0045089",
"GO:0002758",
"GO:0045088",
"GO:1902532",
"GO:0008104",
"GO:1902531",
"GO:1901223",
"GO:0033365",
"GO:1901222",
"GO:0002221",
"GO:0034504",
"GO:0002224"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0031975",
"GO:0016020",
"GO:0005737",
"GO:0012505",
"GO:0031090",
"GO:0031967",
"GO:0016234",
"GO:0005783",
"GO:0005635",
"GO:0043229",
"GO:0043227",
"GO:0031965",
"GO:0043231",
"GO:0005634"
] |
[
"IPR015621",
"IPR000157",
"IPR035897"
] |
af_db/AF-A0A060WMZ6-F1-model_v4.cif.gz
|
8022.A0A060WMZ6
|
[
"8022.A0A060W2E3",
"8022.A0A060WBT7",
"8022.A0A060XXD6",
"8022.A0A060YNP8",
"8022.A0A060Z0U0",
"8022.A0A060WYH3",
"8022.A0A060X3S2",
"8022.A0A060WTK5",
"8022.C1BEZ2",
"8022.A0A060ZXZ7",
"8022.A0A061AEF4",
"8022.A0A060WVY3",
"8022.A0A060VYK6",
"8022.A0A060WD93",
"8022.A0A060YIW1",
"8022.A0A060YIQ8",
"8022.A0A060YRQ4",
"8022.A0A060WQS0",
"8022.A0A060Z3R0",
"8022.A0A060YP34"
] |
[
{
"protein2": "8022.A0A060W2E3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 571,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060WBT7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 0,
"database": 778,
"textmining": 276,
"combined_score": 835
},
{
"protein2": "8022.A0A060XXD6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 541,
"database": 787,
"textmining": 134,
"combined_score": 908
},
{
"protein2": "8022.A0A060YNP8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 828,
"textmining": 494,
"combined_score": 939
},
{
"protein2": "8022.A0A060Z0U0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 686,
"database": 787,
"textmining": 389,
"combined_score": 955
},
{
"protein2": "8022.A0A060WYH3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 571,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060X3S2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 823,
"textmining": 391,
"combined_score": 887
},
{
"protein2": "8022.A0A060WTK5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 686,
"database": 787,
"textmining": 389,
"combined_score": 955
},
{
"protein2": "8022.C1BEZ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 571,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060ZXZ7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 322,
"database": 597,
"textmining": 359,
"combined_score": 815
},
{
"protein2": "8022.A0A061AEF4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 0,
"database": 762,
"textmining": 133,
"combined_score": 789
},
{
"protein2": "8022.A0A060WVY3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 0,
"database": 778,
"textmining": 276,
"combined_score": 835
},
{
"protein2": "8022.A0A060VYK6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 571,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060WD93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 86,
"experimental": 929,
"database": 830,
"textmining": 505,
"combined_score": 993
},
{
"protein2": "8022.A0A060YIW1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 322,
"database": 597,
"textmining": 264,
"combined_score": 781
},
{
"protein2": "8022.A0A060YIQ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 541,
"database": 787,
"textmining": 134,
"combined_score": 908
},
{
"protein2": "8022.A0A060YRQ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 571,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060WQS0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 362,
"database": 571,
"textmining": 86,
"combined_score": 727
},
{
"protein2": "8022.A0A060Z3R0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 0,
"database": 762,
"textmining": 133,
"combined_score": 789
},
{
"protein2": "8022.A0A060YP34",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 0,
"database": 778,
"textmining": 276,
"combined_score": 835
}
] |
A0A060XAF0
|
Fructose-1,6-bisphosphatase 1 (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 1) (Liver FBPase)
|
Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations, acting as a rate-limiting enzyme in gluconeogenesis. Plays a role in regulating glucose sensing and insulin secretion of pancreatic beta-cells. Appears to modulate glycerol gluconeogenesis in liver. Important regulator of appetite and adiposity; increased expression of the protein in liver after nutrient excess increases circulating satiety hormones and reduces appetite-stimulating neuropeptides and thus seems to provide a feedback mechanism to limit weight gain. {ECO:0000256|ARBA:ARBA00037308}.
|
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 337
| null |
MSERCAFDTNVVTLTRFVQEEGRKAKGTGELTTLLNSICTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDVLSNDMVINMIKSSFTSCVLVSEENERALIVEPEKRGKYIVCFDPLDGSSNIDCLVSIGTIFAIYRKTTDDEPNEKDALQSGRHIVAAGYALYGSATMMVLSTGQGVNCFMLDPSIGEFILTDKDVKIKKRGKIYSLNEGYAQHFYPDITEYLKKKKYPEDGSAPYGGRYVGSMVADVHRTLVYGGIFLYPANVKSPKGKLRLLYECNPMSFIIEQAGGMATTGEMNVLDIKPENIHQRVPVVLGSPEDVQEYIAIYKKTRM
|
[
"GO:0050896",
"GO:0009743",
"GO:0010033",
"GO:1901700",
"GO:0034284",
"GO:0009749",
"GO:0008150",
"GO:0042221",
"GO:0009746",
"GO:0019203",
"GO:0042578",
"GO:0042132",
"GO:0003824",
"GO:0016788",
"GO:0003674",
"GO:0016791",
"GO:0050308",
"GO:0016787"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0042221",
"GO:0010033",
"GO:1901700",
"GO:0009743",
"GO:0034284",
"GO:0009746",
"GO:0009749"
] |
[
"GO:0003674",
"GO:0003824",
"GO:0016787",
"GO:0016788",
"GO:0042578",
"GO:0016791",
"GO:0019203",
"GO:0050308",
"GO:0042132"
] | null |
[
"IPR044015",
"IPR000146",
"IPR033391",
"IPR028343",
"IPR020548"
] |
af_db/AF-A0A060XAF0-F1-model_v4.cif.gz
|
8022.A0A060XAF0
|
[
"8022.A0A060VZM1",
"8022.A0A060YS35",
"8022.A0A060YAR4",
"8022.A0A060XD08",
"8022.A0A060Y6E6",
"8022.A0A060Y974",
"8022.A0A060X6R6",
"8022.A0A060X6L1",
"8022.A0A060Y2F6",
"8022.A0A060XIP8",
"8022.A0A060WDZ2",
"8022.A0A060WWX4",
"8022.A0A060VUG3",
"8022.A0A060YIC2",
"8022.A0A060XFI2",
"8022.A0A060YAI9",
"8022.A0A060YDE0",
"8022.A0A060Z098",
"8022.A0A060XE19",
"8022.A0A060X7X1",
"8022.A0A060WET7",
"8022.A0A060YQT4",
"8022.A0A060VNR1",
"8022.A0A060Y0E2",
"8022.A0A060WKY9",
"8022.A0A060Y572",
"8022.A0A060XQD6",
"8022.A0A060Z8Y1",
"8022.A0A060Y5A1",
"8022.A0A060XH89",
"8022.A0A060WBE2",
"8022.A0A060VU68",
"8022.A0A060YAU7",
"8022.A0A060W078",
"8022.A0A060VXB7",
"8022.A0A060XXJ7",
"8022.A0A060VVS9",
"8022.A0A060VTT5",
"8022.A0A060VPT7",
"8022.A0A060XP04",
"8022.A0A060X0C8",
"8022.A0A060VW41",
"8022.A0A060YIV6",
"8022.A0A060Z666",
"8022.A0A060W1Q7",
"8022.A0A060XV20",
"8022.A0A060YVM5",
"8022.A0A060WTE4",
"8022.A0A060Y149",
"8022.A0A060XRV8",
"8022.A0A060Z9H8",
"8022.A0A060VNK8",
"8022.A0A060Z2V0",
"8022.A0A060XPQ5",
"8022.A0A060YHN8",
"8022.A0A060VMK2",
"8022.A0A060WHT6",
"8022.A0A060WEA8",
"8022.A0A060Z5H7",
"8022.A0A060VPR7",
"8022.A0A060Z2Q3",
"8022.A0A060X554",
"8022.A0A060WTT7",
"8022.A0A060XDI7",
"8022.A0A060WUD2",
"8022.A0A060WKL9",
"8022.A0A060Z1V4",
"8022.A0A060WN66",
"8022.A0A060YVQ1",
"8022.A0A060X451",
"8022.A0A060Z1R4",
"8022.A0A060WD05",
"8022.A0A060X3G2",
"8022.A0A060YBF1",
"8022.A0A060XQG3",
"8022.A0A060YKF3",
"8022.A0A060ZEY9",
"8022.A0A060XNA5",
"8022.A0A060WZJ0",
"8022.A0A060VWF5",
"8022.A0A060Y609",
"8022.A0A060WDJ5",
"8022.A0A060X713",
"8022.A0A060Y1A1",
"8022.A0A060WI24",
"8022.A0A060W743",
"8022.A0A060Y3N4",
"8022.A0A060WV51",
"8022.A0A060WFB8",
"8022.A0A060X7J3",
"8022.A0A060Z2J6",
"8022.A0A060X567",
"8022.A0A060XB28",
"8022.A0A060X323",
"8022.A0A060YEC4",
"8022.A0A060VYV2",
"8022.A0A060X0T4",
"8022.A0A060VVE5",
"8022.A0A060Z6C0",
"8022.A0A060XEE3",
"8022.A0A060X7Z0",
"8022.A0A060X7A0",
"8022.A0A060YTU9",
"8022.A0A060YSX6",
"8022.A0A060W9M9",
"8022.A0A060YVM7",
"8022.A0A060YZW8",
"8022.A0A060Z7Y7",
"8022.A0A060YGA7",
"8022.A0A060YK26",
"8022.A0A060YKK6",
"8022.A0A060XVB1",
"8022.A0A060YV08",
"8022.A0A060XEX5",
"8022.A0A060W0T4",
"8022.A0A060W458",
"8022.A0A060XBK0",
"8022.A0A060X2I1",
"8022.A0A060Y7I6",
"8022.A0A060XY35",
"8022.A0A060VZK5",
"8022.A0A060XTV2",
"8022.A0A060WV84",
"8022.A0A060W147",
"8022.A0A060XZ30",
"8022.A0A060XFS1",
"8022.A0A060ZB08",
"8022.A0A060ZAC2",
"8022.A0A060YFA3",
"8022.A0A060Y3Q3",
"8022.A0A060WUI1",
"8022.A0A060YLD3",
"8022.A0A060WBZ8",
"8022.A0A060X1D5",
"8022.A0A060W2P0",
"8022.A0A060Z8F9",
"8022.A0A060XQL0",
"8022.A0A060Z973",
"8022.A0A060Y6U5",
"8022.A0A060WAF6",
"8022.A0A060YW82",
"8022.A0A060YYC4",
"8022.A0A060WN41",
"8022.A0A060XHN5",
"8022.A0A060WBT3",
"8022.A0A060WHB9",
"8022.A0A060WVQ0",
"8022.A0A060VVL9",
"8022.A0A060X8A4",
"8022.A0A060WPX1",
"8022.A0A060X816",
"8022.A0A060ZPA8",
"8022.A0A060X6V3",
"8022.A0A060X1J6",
"8022.A0A060X807",
"8022.A0A060Y9T0",
"8022.A0A060VXR5",
"8022.A0A060VVZ9"
] |
[
{
"protein2": "8022.A0A060VZM1",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060YS35",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 816,
"textmining": 308,
"combined_score": 923
},
{
"protein2": "8022.A0A060YAR4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 75,
"experimental": 0,
"database": 670,
"textmining": 378,
"combined_score": 793
},
{
"protein2": "8022.A0A060XD08",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 825,
"textmining": 308,
"combined_score": 926
},
{
"protein2": "8022.A0A060Y6E6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 830,
"textmining": 44,
"combined_score": 830
},
{
"protein2": "8022.A0A060Y974",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 816,
"textmining": 186,
"combined_score": 848
},
{
"protein2": "8022.A0A060X6R6",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060X6L1",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 568,
"textmining": 411,
"combined_score": 738
},
{
"protein2": "8022.A0A060Y2F6",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 277,
"database": 706,
"textmining": 325,
"combined_score": 861
},
{
"protein2": "8022.A0A060XIP8",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060WDZ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 352,
"combined_score": 875
},
{
"protein2": "8022.A0A060WWX4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 80,
"experimental": 0,
"database": 670,
"textmining": 309,
"combined_score": 771
},
{
"protein2": "8022.A0A060VUG3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 352,
"combined_score": 875
},
{
"protein2": "8022.A0A060YIC2",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 261,
"combined_score": 853
},
{
"protein2": "8022.A0A060XFI2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 155,
"database": 816,
"textmining": 0,
"combined_score": 837
},
{
"protein2": "8022.A0A060YAI9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 746,
"database": 0,
"textmining": 309,
"combined_score": 816
},
{
"protein2": "8022.A0A060YDE0",
"neighborhood": 175,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 0,
"database": 830,
"textmining": 505,
"combined_score": 931
},
{
"protein2": "8022.A0A060Z098",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060XE19",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 654,
"textmining": 225,
"combined_score": 746
},
{
"protein2": "8022.A0A060X7X1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 654,
"textmining": 225,
"combined_score": 746
},
{
"protein2": "8022.A0A060WET7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 153,
"database": 829,
"textmining": 0,
"combined_score": 848
},
{
"protein2": "8022.A0A060YQT4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 51,
"experimental": 0,
"database": 736,
"textmining": 123,
"combined_score": 761
},
{
"protein2": "8022.A0A060VNR1",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 825,
"textmining": 186,
"combined_score": 856
},
{
"protein2": "8022.A0A060Y0E2",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060WKY9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 738,
"database": 0,
"textmining": 338,
"combined_score": 819
},
{
"protein2": "8022.A0A060Y572",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 137,
"experimental": 0,
"database": 816,
"textmining": 379,
"combined_score": 893
},
{
"protein2": "8022.A0A060XQD6",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060Z8Y1",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 825,
"textmining": 308,
"combined_score": 926
},
{
"protein2": "8022.A0A060Y5A1",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060XH89",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 715,
"database": 0,
"textmining": 326,
"combined_score": 799
},
{
"protein2": "8022.A0A060WBE2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 827,
"textmining": 275,
"combined_score": 879
},
{
"protein2": "8022.A0A060VU68",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 352,
"combined_score": 875
},
{
"protein2": "8022.A0A060YAU7",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 137,
"experimental": 0,
"database": 816,
"textmining": 379,
"combined_score": 893
},
{
"protein2": "8022.A0A060W078",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 738,
"database": 0,
"textmining": 338,
"combined_score": 819
},
{
"protein2": "8022.A0A060VXB7",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 825,
"textmining": 186,
"combined_score": 856
},
{
"protein2": "8022.A0A060XXJ7",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 349,
"combined_score": 751
},
{
"protein2": "8022.A0A060VVS9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 783,
"textmining": 199,
"combined_score": 818
},
{
"protein2": "8022.A0A060VTT5",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060VPT7",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 277,
"database": 706,
"textmining": 325,
"combined_score": 861
},
{
"protein2": "8022.A0A060XP04",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 760,
"textmining": 186,
"combined_score": 802
},
{
"protein2": "8022.A0A060X0C8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 654,
"textmining": 225,
"combined_score": 746
},
{
"protein2": "8022.A0A060VW41",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 75,
"experimental": 0,
"database": 670,
"textmining": 378,
"combined_score": 793
},
{
"protein2": "8022.A0A060YIV6",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 261,
"combined_score": 853
},
{
"protein2": "8022.A0A060Z666",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 816,
"textmining": 186,
"combined_score": 848
},
{
"protein2": "8022.A0A060W1Q7",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 261,
"combined_score": 880
},
{
"protein2": "8022.A0A060XV20",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 277,
"database": 706,
"textmining": 325,
"combined_score": 861
},
{
"protein2": "8022.A0A060YVM5",
"neighborhood": 166,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 827,
"textmining": 451,
"combined_score": 922
},
{
"protein2": "8022.A0A060WTE4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 220,
"combined_score": 788
},
{
"protein2": "8022.A0A060Y149",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 0,
"database": 736,
"textmining": 123,
"combined_score": 768
},
{
"protein2": "8022.A0A060XRV8",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 137,
"experimental": 0,
"database": 816,
"textmining": 379,
"combined_score": 893
},
{
"protein2": "8022.A0A060Z9H8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060VNK8",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 261,
"combined_score": 880
},
{
"protein2": "8022.A0A060Z2V0",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 825,
"textmining": 186,
"combined_score": 856
},
{
"protein2": "8022.A0A060XPQ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 715,
"database": 0,
"textmining": 326,
"combined_score": 799
},
{
"protein2": "8022.A0A060YHN8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 654,
"textmining": 225,
"combined_score": 746
},
{
"protein2": "8022.A0A060VMK2",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 816,
"textmining": 308,
"combined_score": 923
},
{
"protein2": "8022.A0A060WHT6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 80,
"experimental": 0,
"database": 670,
"textmining": 309,
"combined_score": 771
},
{
"protein2": "8022.A0A060WEA8",
"neighborhood": 51,
"fusion": 0,
"cooccurence": 0,
"coexpression": 137,
"experimental": 0,
"database": 816,
"textmining": 379,
"combined_score": 893
},
{
"protein2": "8022.A0A060Z5H7",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060VPR7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 220,
"combined_score": 788
},
{
"protein2": "8022.A0A060Z2Q3",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060X554",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 568,
"textmining": 411,
"combined_score": 738
},
{
"protein2": "8022.A0A060WTT7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 785,
"textmining": 0,
"combined_score": 787
},
{
"protein2": "8022.A0A060XDI7",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 825,
"textmining": 186,
"combined_score": 856
},
{
"protein2": "8022.A0A060WUD2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 785,
"textmining": 0,
"combined_score": 787
},
{
"protein2": "8022.A0A060WKL9",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060Z1V4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 783,
"textmining": 199,
"combined_score": 818
},
{
"protein2": "8022.A0A060WN66",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 785,
"textmining": 0,
"combined_score": 787
},
{
"protein2": "8022.A0A060YVQ1",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060X451",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 568,
"textmining": 411,
"combined_score": 738
},
{
"protein2": "8022.A0A060Z1R4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 51,
"experimental": 0,
"database": 736,
"textmining": 123,
"combined_score": 761
},
{
"protein2": "8022.A0A060WD05",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 827,
"textmining": 275,
"combined_score": 879
},
{
"protein2": "8022.A0A060X3G2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 80,
"experimental": 0,
"database": 670,
"textmining": 309,
"combined_score": 771
},
{
"protein2": "8022.A0A060YBF1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 51,
"experimental": 0,
"database": 736,
"textmining": 123,
"combined_score": 761
},
{
"protein2": "8022.A0A060XQG3",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060YKF3",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 261,
"combined_score": 853
},
{
"protein2": "8022.A0A060ZEY9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 0,
"database": 736,
"textmining": 123,
"combined_score": 768
},
{
"protein2": "8022.A0A060XNA5",
"neighborhood": 49,
"fusion": 0,
"cooccurence": 0,
"coexpression": 866,
"experimental": 0,
"database": 0,
"textmining": 519,
"combined_score": 933
},
{
"protein2": "8022.A0A060WZJ0",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 220,
"combined_score": 852
},
{
"protein2": "8022.A0A060VWF5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 75,
"experimental": 0,
"database": 670,
"textmining": 378,
"combined_score": 793
},
{
"protein2": "8022.A0A060Y609",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 220,
"combined_score": 852
},
{
"protein2": "8022.A0A060WDJ5",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 261,
"combined_score": 880
},
{
"protein2": "8022.A0A060X713",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 816,
"textmining": 220,
"combined_score": 852
},
{
"protein2": "8022.A0A060Y1A1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 746,
"database": 0,
"textmining": 309,
"combined_score": 816
},
{
"protein2": "8022.A0A060WI24",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 261,
"combined_score": 880
},
{
"protein2": "8022.A0A060W743",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 832,
"textmining": 366,
"combined_score": 888
},
{
"protein2": "8022.A0A060Y3N4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060WV51",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 654,
"textmining": 225,
"combined_score": 746
},
{
"protein2": "8022.A0A060WFB8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 832,
"textmining": 225,
"combined_score": 876
},
{
"protein2": "8022.A0A060X7J3",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060Z2J6",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060X567",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 825,
"textmining": 186,
"combined_score": 856
},
{
"protein2": "8022.A0A060XB28",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 660,
"textmining": 276,
"combined_score": 813
},
{
"protein2": "8022.A0A060X323",
"neighborhood": 151,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 277,
"database": 706,
"textmining": 325,
"combined_score": 861
},
{
"protein2": "8022.A0A060YEC4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 665,
"database": 0,
"textmining": 309,
"combined_score": 758
},
{
"protein2": "8022.A0A060VYV2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 665,
"database": 0,
"textmining": 309,
"combined_score": 758
},
{
"protein2": "8022.A0A060X0T4",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060VVE5",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 772,
"textmining": 276,
"combined_score": 874
},
{
"protein2": "8022.A0A060Z6C0",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 261,
"combined_score": 880
},
{
"protein2": "8022.A0A060XEE3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 738,
"database": 0,
"textmining": 338,
"combined_score": 819
},
{
"protein2": "8022.A0A060X7Z0",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 261,
"combined_score": 853
},
{
"protein2": "8022.A0A060X7A0",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060YTU9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 831,
"textmining": 0,
"combined_score": 832
},
{
"protein2": "8022.A0A060YSX6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 155,
"database": 816,
"textmining": 0,
"combined_score": 837
},
{
"protein2": "8022.A0A060W9M9",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 825,
"textmining": 261,
"combined_score": 880
},
{
"protein2": "8022.A0A060YVM7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 220,
"combined_score": 788
},
{
"protein2": "8022.A0A060YZW8",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 76,
"experimental": 0,
"database": 652,
"textmining": 277,
"combined_score": 750
},
{
"protein2": "8022.A0A060Z7Y7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 654,
"textmining": 225,
"combined_score": 746
},
{
"protein2": "8022.A0A060YGA7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 785,
"textmining": 0,
"combined_score": 787
},
{
"protein2": "8022.A0A060YK26",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060YKK6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 779,
"textmining": 391,
"combined_score": 861
},
{
"protein2": "8022.A0A060XVB1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060YV08",
"neighborhood": 166,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 827,
"textmining": 451,
"combined_score": 922
},
{
"protein2": "8022.A0A060XEX5",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 772,
"textmining": 276,
"combined_score": 874
},
{
"protein2": "8022.A0A060W0T4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060W458",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 256,
"database": 556,
"textmining": 279,
"combined_score": 751
},
{
"protein2": "8022.A0A060XBK0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060X2I1",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060Y7I6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060XY35",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 825,
"textmining": 308,
"combined_score": 926
},
{
"protein2": "8022.A0A060VZK5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 783,
"textmining": 199,
"combined_score": 818
},
{
"protein2": "8022.A0A060XTV2",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 256,
"database": 556,
"textmining": 279,
"combined_score": 751
},
{
"protein2": "8022.A0A060WV84",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 772,
"textmining": 276,
"combined_score": 874
},
{
"protein2": "8022.A0A060W147",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060XZ30",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 785,
"textmining": 261,
"combined_score": 853
},
{
"protein2": "8022.A0A060XFS1",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060ZB08",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 825,
"textmining": 186,
"combined_score": 856
},
{
"protein2": "8022.A0A060ZAC2",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 816,
"textmining": 308,
"combined_score": 923
},
{
"protein2": "8022.A0A060YFA3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 0,
"database": 736,
"textmining": 123,
"combined_score": 768
},
{
"protein2": "8022.A0A060Y3Q3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 665,
"database": 0,
"textmining": 309,
"combined_score": 758
},
{
"protein2": "8022.A0A060WUI1",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 772,
"textmining": 276,
"combined_score": 874
},
{
"protein2": "8022.A0A060YLD3",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 827,
"textmining": 276,
"combined_score": 904
},
{
"protein2": "8022.A0A060WBZ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 832,
"textmining": 225,
"combined_score": 876
},
{
"protein2": "8022.A0A060X1D5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 654,
"textmining": 225,
"combined_score": 746
},
{
"protein2": "8022.A0A060W2P0",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 827,
"textmining": 186,
"combined_score": 857
},
{
"protein2": "8022.A0A060Z8F9",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 366,
"experimental": 0,
"database": 816,
"textmining": 308,
"combined_score": 923
},
{
"protein2": "8022.A0A060XQL0",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 256,
"database": 556,
"textmining": 279,
"combined_score": 751
},
{
"protein2": "8022.A0A060Z973",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 0,
"database": 785,
"textmining": 0,
"combined_score": 787
},
{
"protein2": "8022.A0A060Y6U5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 830,
"textmining": 0,
"combined_score": 845
},
{
"protein2": "8022.A0A060WAF6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 602,
"textmining": 275,
"combined_score": 722
},
{
"protein2": "8022.A0A060YW82",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 90,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 720
},
{
"protein2": "8022.A0A060YYC4",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 816,
"textmining": 186,
"combined_score": 848
},
{
"protein2": "8022.A0A060WN41",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 654,
"textmining": 225,
"combined_score": 746
},
{
"protein2": "8022.A0A060XHN5",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 772,
"textmining": 276,
"combined_score": 874
},
{
"protein2": "8022.A0A060WBT3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 155,
"database": 816,
"textmining": 0,
"combined_score": 837
},
{
"protein2": "8022.A0A060WHB9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 654,
"textmining": 225,
"combined_score": 746
},
{
"protein2": "8022.A0A060WVQ0",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 827,
"textmining": 276,
"combined_score": 904
},
{
"protein2": "8022.A0A060VVL9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 783,
"textmining": 199,
"combined_score": 818
},
{
"protein2": "8022.A0A060X8A4",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060WPX1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 665,
"database": 0,
"textmining": 309,
"combined_score": 758
},
{
"protein2": "8022.A0A060X816",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060ZPA8",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060X6V3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 0,
"database": 654,
"textmining": 225,
"combined_score": 746
},
{
"protein2": "8022.A0A060X1J6",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 0,
"database": 625,
"textmining": 243,
"combined_score": 710
},
{
"protein2": "8022.A0A060X807",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 746,
"database": 0,
"textmining": 309,
"combined_score": 816
},
{
"protein2": "8022.A0A060Y9T0",
"neighborhood": 45,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 816,
"textmining": 186,
"combined_score": 848
},
{
"protein2": "8022.A0A060VXR5",
"neighborhood": 52,
"fusion": 0,
"cooccurence": 0,
"coexpression": 138,
"experimental": 0,
"database": 652,
"textmining": 185,
"combined_score": 737
},
{
"protein2": "8022.A0A060VVZ9",
"neighborhood": 91,
"fusion": 0,
"cooccurence": 0,
"coexpression": 161,
"experimental": 158,
"database": 772,
"textmining": 276,
"combined_score": 874
}
] |
A0A060XFW6
|
Histidine kinase/HSP90-like ATPase domain-containing protein
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 773
| null |
MDTSAQSNTQEGIKISEIPFYFPASESRGDLRYWQHFIQEKSTEQIKMPEEMRQEEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPTKLDNGKELKIDVIPNVEERTLTLIDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAERVTVITKHNDDEQYIWESSAGGSFTVKVDTGEPMLRGTKVILHMKEDQTEYVEEKRVKEVVKKHSQFIGYPITLFVEKEREKEISDDEAEEEEKAEKEEKEEKEAEDKPKIEDVGSDDEEDSKDKDKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITMEEYGEFYKSLTNDWEEHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCEELIPEYLNFVRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCMELFGELAEDRENYNKFYDGFSKNLKLGIHEDSQNRKKLSELLRYHSSQSGDELTSLTEYLTRMKDNQKSIYYITGESKDQVANSAFVERVRKRGFEVLYMTEPIDEYCVQQLKEFDGKTLVSVTKEGLELPEDEEEKKKMDEDKTKFENLCKLMKEILDKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKADLDKNDKAVKDLVILLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGIDDDEVIPEEPTSAPAPDEIPPLEGDDDASRMEEVD
|
[
"GO:0043627",
"GO:0009719",
"GO:0050896",
"GO:0042221",
"GO:0008150",
"GO:0010033",
"GO:0009725",
"GO:0005622",
"GO:0043229",
"GO:0043226",
"GO:0110165",
"GO:0005737",
"GO:0005575",
"GO:0043227",
"GO:0005634",
"GO:0043231"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0009719",
"GO:0042221",
"GO:0010033",
"GO:0009725",
"GO:0043627"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0005737",
"GO:0043229",
"GO:0043227",
"GO:0043231",
"GO:0005634"
] |
[
"IPR036890",
"IPR003594",
"IPR019805",
"IPR037196",
"IPR001404",
"IPR020575",
"IPR020568"
] |
af_db/AF-A0A060XFW6-F1-model_v4.cif.gz
|
8022.A0A060XFW6
|
[
"8022.A0A060YVZ8",
"8022.A0A060XPD1",
"8022.A0A060YJ56",
"8022.A0A060Y8C8",
"8022.A0A060XDA6",
"8022.A0A060WLY5",
"8022.A0A060WDB5",
"8022.A0A060W9K2",
"8022.A0A060X045",
"8022.A0A060WWJ0",
"8022.A0A060XT88",
"8022.A0A060YN29",
"8022.A0A060YN11",
"8022.A0A060W4Z4",
"8022.A0A060VPQ2",
"8022.A0A060X6P0",
"8022.A0A060WIX5",
"8022.A0A060WG53",
"8022.A0A060XJ59",
"8022.A0A060ZHH4",
"8022.A0A060W9K4",
"8022.A0A060WZS5",
"8022.A0A060Y0C6",
"8022.A0A060XKB8",
"8022.A0A060W4C3",
"8022.A0A060ZAW0",
"8022.A0A060Y172",
"8022.A0A060YK54",
"8022.A0A060ZG95",
"8022.A0A060YGW4",
"8022.A0A060XKC3",
"8022.A0A060VP33",
"8022.A0A060X3Q0",
"8022.A0A060Y737",
"8022.A0A060YIV9",
"8022.A0A060XER7",
"8022.A0A060YT34",
"8022.A0A060YFZ6",
"8022.A0A060XQ11",
"8022.A0A060WET1",
"8022.A0A060XPT8",
"8022.A0A060Y9R6",
"8022.A0A060VW75",
"8022.A0A060X924",
"8022.A0A060W5A4",
"8022.A0A060Y0Y6",
"8022.A0A060YAW5",
"8022.A0A060Z9W8",
"8022.A0A060X7C9",
"8022.A0A060Z2T4",
"8022.A0A060WIQ5",
"8022.A0A060W8B2",
"8022.A0A060YBV5",
"8022.A0A060X3H7",
"8022.A0A060WFG1",
"8022.A0A060YT33",
"8022.A0A060WKX6",
"8022.A0A060WIX3",
"8022.A0A060YJZ7",
"8022.A0A060XXY2",
"8022.A0A060Y7Y9",
"8022.A0A060XIQ6",
"8022.A0A060XRA2",
"8022.A0A060WHU5",
"8022.A0A060VXN4",
"8022.A0A060XAR9",
"8022.A0A060XVH3",
"8022.A0A060Y0G1",
"8022.A0A060W0X7",
"8022.A0A060WQT0",
"8022.A0A060X2J6",
"8022.A0A060XIH3",
"8022.A0A060WMD2",
"8022.A0A060X483",
"8022.A0A060WZ00",
"8022.A0A060YN57",
"8022.A0A060X9Q4",
"8022.A0A060XID6",
"8022.A0A060Y1G5",
"8022.A0A060XWL9",
"8022.A0A060XKH1",
"8022.A0A060W1A6",
"8022.C1BFD3",
"8022.A0A060WGH6",
"8022.A0A060WIM8",
"8022.A0A060W5H0",
"8022.A0A060VTU3",
"8022.A0A060XT73",
"8022.A0A060YNP1",
"8022.A0A060WR23",
"8022.A0A060YRY2",
"8022.A0A060Y265",
"8022.A0A060YDR5",
"8022.A0A060YHQ7",
"8022.A0A060W3L2",
"8022.A0A060XI54",
"8022.A0A060WW29",
"8022.A0A060X881",
"8022.A0A060WPZ6",
"8022.A0A060Y842",
"8022.A0A060Z4C3",
"8022.A0A060WLD4",
"8022.A0A060Z4M3",
"8022.A0A060YBU0",
"8022.A0A060YMV4",
"8022.A0A060W6U8",
"8022.A0A060VUX6",
"8022.A0A060WT07",
"8022.A0A060XAW7",
"8022.A0A060WWH4",
"8022.A0A060WNH4",
"8022.A0A060WNW6",
"8022.A0A060WIM0",
"8022.A0A060WRM4",
"8022.A0A060YNK9",
"8022.A0A060XBL7",
"8022.A0A060XSH9",
"8022.A0A060XPN2",
"8022.A0A060WKN9",
"8022.A0A060X1N4",
"8022.C1BG62",
"8022.A0A060X8B1",
"8022.A0A060YP71",
"8022.A0A060XBJ4",
"8022.A0A060Z7B1",
"8022.A0A060VSJ9",
"8022.A0A060WFI2",
"8022.A0A060XR67",
"8022.A0A060W1U9",
"8022.A0A060XBN4",
"8022.A0A060YSJ4",
"8022.A0A060YZ22",
"8022.A0A060VYB4",
"8022.A0A060WN02",
"8022.A0A060X1R9",
"8022.A0A060XG31",
"8022.A0A060Y8T5",
"8022.A0A060YPV1",
"8022.A0A060WET2",
"8022.A0A060X011",
"8022.A0A060W9A6",
"8022.A0A060ZU15",
"8022.A0A060WSW3",
"8022.A0A060X5C5",
"8022.A0A060WIJ5",
"8022.A0A060Y1M3",
"8022.A0A060Y1T3",
"8022.A0A060VTD2",
"8022.A0A060YVG1",
"8022.A0A060X996",
"8022.A0A060Y0S7",
"8022.A0A060WT46",
"8022.A0A060VVY9",
"8022.A0A060WTE7",
"8022.A0A060WZ23",
"8022.A0A060Y2D4",
"8022.A0A060WME3",
"8022.A0A060YQ33",
"8022.A0A060Z0S6",
"8022.A0A060YLY2",
"8022.A0A060X1K0",
"8022.A0A060VTJ4",
"8022.A0A060YT46",
"8022.A0A060XRY9",
"8022.A0A060WXS1",
"8022.A0A060X0G4",
"8022.A0A060WS71",
"8022.A0A060YVB4",
"8022.A0A060WZ37",
"8022.A0A060Y6Y0",
"8022.A0A060YEB2",
"8022.A0A060WU94",
"8022.A0A060WTK7",
"8022.A0A060WES3",
"8022.A0A060YGJ9",
"8022.A0A060VP96",
"8022.A0A060WKD4",
"8022.A0A060W5D0",
"8022.A0A060Z3A5",
"8022.A0A060W9Q2",
"8022.A0A060YBC7",
"8022.A0A060X8W2",
"8022.A0A060YDZ8",
"8022.A0A060ZJV2",
"8022.A0A061A6Z5",
"8022.A0A060XVG3",
"8022.A0A060XVX5",
"8022.A0A060XVV6",
"8022.A0A060XNA7",
"8022.C1BG90",
"8022.A0A060XFQ8",
"8022.A0A060X6R7",
"8022.A0A060X5Q3",
"8022.A0A060WUJ2",
"8022.A0A060XRF4",
"8022.A0A060XV15",
"8022.A0A060WHY1",
"8022.A0A060Y668",
"8022.A0A060WDE0",
"8022.A0A060X0K1",
"8022.A0A060VMS2",
"8022.A0A060YP00",
"8022.A0A060X7R3",
"8022.A0A060WSJ3",
"8022.A0A060XRB2",
"8022.A0A060Y2M8",
"8022.A0A060XIH9",
"8022.A0A060Z3P3",
"8022.A0A060YC16",
"8022.A0A060XRN9",
"8022.A0A060WJV4",
"8022.A0A060VXZ3",
"8022.A0A060XLB8",
"8022.A0A060XKL0",
"8022.A0A060VSV9",
"8022.A0A060WIW0",
"8022.A0A060X8I2",
"8022.A0A060WX48",
"8022.A0A060XM16",
"8022.A0A060X0B9",
"8022.A0A060XFQ3",
"8022.A0A060XWV3",
"8022.A0A060X2Y0",
"8022.A0A060WZJ2",
"8022.A0A060WXM8",
"8022.A0A060WKE4",
"8022.A0A060ZIZ8",
"8022.A0A060XG86",
"8022.A0A061ADP7",
"8022.A0A060WQ48",
"8022.A0A060XSP1",
"8022.A0A060W1W2",
"8022.A0A060XX32",
"8022.A0A060Y8X7",
"8022.A0A060ZEP6",
"8022.A0A060Y0I2",
"8022.A0A060YP66",
"8022.A0A060XQN1",
"8022.A0A060XYC7",
"8022.A0A060XS96",
"8022.A0A060W5B2",
"8022.A0A060X173",
"8022.A0A060YBS9",
"8022.A0A060XI31",
"8022.A0A060XPW0",
"8022.A0A060YHY9",
"8022.A0A060X7A6",
"8022.A0A060X795",
"8022.A0A060YYJ1",
"8022.A0A060YN23",
"8022.A0A060XXH3",
"8022.A0A060WP57",
"8022.A0A060XQG8",
"8022.A0A060VYX8",
"8022.A0A060WBD3",
"8022.A0A060WWC7",
"8022.A0A060YX95",
"8022.A0A060Y956",
"8022.A0A060VU47",
"8022.A0A060W321",
"8022.A0A060Y4J9",
"8022.A0A060WZL8",
"8022.A0A060WCV3",
"8022.Q9PT09",
"8022.A0A060YAV2",
"8022.A0A060YSP2",
"8022.A0A060VWL5",
"8022.A0A060VTB1",
"8022.A0A060Z671",
"8022.A0A060X9N1",
"8022.A0A060XLH8",
"8022.A0A060XTM1",
"8022.A0A060WS21",
"8022.A0A060X6P4",
"8022.A0A060WGQ7",
"8022.A0A060XKZ0",
"8022.A0A060X747",
"8022.A0A060VZB1",
"8022.A0A060WF01",
"8022.A0A060Z3H2",
"8022.A0A060WC37",
"8022.A0A060Z2Q6",
"8022.A0A060WGA5",
"8022.A0A060Y0Z6",
"8022.A0A060XU63",
"8022.A0A060YC57",
"8022.A0A060WW88",
"8022.A0A060X0I3",
"8022.A0A060VTX5",
"8022.A0A060ZHR8",
"8022.A0A060YNU6",
"8022.A0A060WZL3",
"8022.A0A060X925",
"8022.A0A060X100",
"8022.A0A060X3D1",
"8022.A0A060Z5F3",
"8022.A0A060WM62",
"8022.A0A060YC34",
"8022.A0A060XMU7",
"8022.A0A060VZD9",
"8022.A0A060XUR0",
"8022.A0A060VUJ1",
"8022.A0A060VN15",
"8022.A0A060VNA2",
"8022.A0A060YTQ4",
"8022.A0A060YCE9",
"8022.A0A060WLB7",
"8022.A0A060WS33",
"8022.A0A060YL26",
"8022.A0A060Z011",
"8022.A0A060XVP2",
"8022.A0A060YZM3",
"8022.A0A060Z608",
"8022.A0A060X833",
"8022.A0A060W2P2",
"8022.A0A060XS93",
"8022.A0A060XU96",
"8022.A0A060Z5T3",
"8022.A0A060YKD2",
"8022.A0A060W590",
"8022.A0A060XLI5",
"8022.A0A060XFZ8",
"8022.A0A060W9R5",
"8022.A0A060Z753",
"8022.A0A060WWK9",
"8022.A0A060WVU0",
"8022.A0A060VTX8",
"8022.A0A060YIJ4",
"8022.A0A060YS73",
"8022.A0A060XT19",
"8022.A0A060WQJ1",
"8022.A0A060XUV0",
"8022.A0A060YJ53",
"8022.A0A060X1H7",
"8022.A0A060Z1D6",
"8022.A0A060WTV3",
"8022.A0A061A939",
"8022.A0A060W511",
"8022.A0A060XMQ8",
"8022.A0A060X313",
"8022.A0A060XZQ6",
"8022.A0A060X5S5",
"8022.A0A060YDB5",
"8022.A0A060XV60",
"8022.A0A060Y5M1",
"8022.A0A060XF94",
"8022.A0A060WTC8",
"8022.A0A060X621",
"8022.A0A060WE23",
"8022.A0A060Y0A6",
"8022.A0A060X0Z3",
"8022.A0A060XLX9",
"8022.A0A060VUI9",
"8022.A0A060Z698",
"8022.A0A060XH83",
"8022.A0A060WPC3",
"8022.A0A060WDF7",
"8022.A0A060XFF6",
"8022.A0A060WMF6",
"8022.A0A060WT77",
"8022.A0A060XH19",
"8022.A0A060YGX2",
"8022.A0A060YJ10",
"8022.A0A060YPZ8",
"8022.A0A060YQ01",
"8022.A0A060XKP9",
"8022.A0A060WJQ6",
"8022.A0A060W549",
"8022.A0A060XMD3",
"8022.A0A060XQK3",
"8022.A0A060YIG6",
"8022.A0A060X8Y7",
"8022.A0A060YQ36",
"8022.A0A060X0Y4",
"8022.A0A060XKV5",
"8022.A0A060ZGX8",
"8022.A0A060VRH7",
"8022.A0A060XTG2",
"8022.A0A060WQ49",
"8022.A0A060YDJ4",
"8022.A0A060Z3C0",
"8022.A0A060YPE8",
"8022.A0A060WU49",
"8022.A0A060YTB0",
"8022.A0A060Y7X2",
"8022.A0A060X189",
"8022.A0A060VZ05",
"8022.A0A060YG86",
"8022.A0A060XFD4",
"8022.A0A060WTN3",
"8022.O93245",
"8022.A0A060VPK1",
"8022.A0A060Z6H0",
"8022.A0A060XMQ9",
"8022.A0A060XN97",
"8022.A0A060XAD4",
"8022.A0A060Z048",
"8022.A0A060YXQ1",
"8022.A0A060WE12",
"8022.A0A060X0B5",
"8022.A0A060W593",
"8022.A0A060XL01",
"8022.A0A060VNI0",
"8022.A0A060YMA6",
"8022.A0A060ZAX5",
"8022.A0A060VM58",
"8022.A0A060WTG9",
"8022.A0A060Z269",
"8022.A0A060XH10",
"8022.A0A060W0Z6",
"8022.A0A060XU67",
"8022.A0A060YFC5",
"8022.A0A060XC97",
"8022.A0A060WFL5",
"8022.A0A060YDC6",
"8022.A0A060W3W8",
"8022.A0A060Y9Q0",
"8022.A0A061AD99",
"8022.A0A060Y028",
"8022.A0A060X8R3",
"8022.A0A060W2L4",
"8022.A0A060Y887",
"8022.A0A060X2T0",
"8022.A0A060YYY0",
"8022.A0A060YXU2",
"8022.A0A060XYX3",
"8022.A0A060YL36",
"8022.A0A060XXQ2",
"8022.A0A060YTF9",
"8022.A0A060YB73",
"8022.A0A060Y544",
"8022.A0A060YGK7",
"8022.A0A060Z192",
"8022.A0A060VNG5",
"8022.A0A060YDW3",
"8022.A0A060YDC0",
"8022.A0A060W6N9",
"8022.A0A060Z3A1",
"8022.A0A060VR91",
"8022.A0A060WRN7",
"8022.A0A060XY82",
"8022.A0A060Y386",
"8022.A0A060XUE1",
"8022.A0A060VVC5",
"8022.A0A060WKB0",
"8022.A0A060W7T8",
"8022.A0A060ZDS2",
"8022.A0A061AF65",
"8022.A0A060XS17",
"8022.A0A060ZHH3",
"8022.A0A060ZGE1",
"8022.A0A060Y3A3",
"8022.A0A060X691",
"8022.A0A060W5Y1",
"8022.A0A060XPD8",
"8022.A0A060W7A6",
"8022.A0A060XUA5",
"8022.A0A060XI97",
"8022.A0A060VMW3",
"8022.A0A060XL60",
"8022.A0A060WI07",
"8022.A0A061AFA1",
"8022.A0A060Z858",
"8022.A0A060XJK9",
"8022.A0A060WZC6",
"8022.A0A061A773",
"8022.A0A060YQQ2",
"8022.A0A060VSN0",
"8022.A0A060Y7A8",
"8022.A0A060WD16",
"8022.A0A060XQ05",
"8022.A0A060ZCJ0",
"8022.A0A060YUG1",
"8022.A0A060Z5L0",
"8022.A0A060WZP5",
"8022.A0A060W187",
"8022.A0A060ZC75",
"8022.A0A060XJW3",
"8022.A0A060Z216",
"8022.A0A060WN55",
"8022.A0A060XH67",
"8022.A0A060VQQ6",
"8022.A0A060XYL7",
"8022.A0A060Y4G5",
"8022.A0A060YV64",
"8022.A0A060XHR4",
"8022.A0A060XHX0",
"8022.A0A060X2P2",
"8022.A0A060YDW9",
"8022.A0A060XTQ9",
"8022.A0A060X382",
"8022.A0A060W9T8",
"8022.A0A060WI90",
"8022.A0A060X462",
"8022.A0A060Z793",
"8022.A0A060YFT4"
] |
[
{
"protein2": "8022.A0A060YVZ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 863,
"database": 736,
"textmining": 345,
"combined_score": 974
},
{
"protein2": "8022.A0A060XPD1",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 239,
"database": 560,
"textmining": 196,
"combined_score": 709
},
{
"protein2": "8022.A0A060YJ56",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 422,
"textmining": 184,
"combined_score": 773
},
{
"protein2": "8022.A0A060Y8C8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 749,
"database": 431,
"textmining": 228,
"combined_score": 883
},
{
"protein2": "8022.A0A060XDA6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 573,
"textmining": 85,
"combined_score": 724
},
{
"protein2": "8022.A0A060WLY5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 551,
"textmining": 110,
"combined_score": 860
},
{
"protein2": "8022.A0A060WDB5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060W9K2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 501,
"experimental": 672,
"database": 594,
"textmining": 312,
"combined_score": 949
},
{
"protein2": "8022.A0A060X045",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 203,
"experimental": 704,
"database": 569,
"textmining": 231,
"combined_score": 911
},
{
"protein2": "8022.A0A060WWJ0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 414,
"database": 566,
"textmining": 86,
"combined_score": 747
},
{
"protein2": "8022.A0A060XT88",
"neighborhood": 48,
"fusion": 0,
"cooccurence": 0,
"coexpression": 192,
"experimental": 311,
"database": 430,
"textmining": 182,
"combined_score": 707
},
{
"protein2": "8022.A0A060YN29",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 551,
"textmining": 110,
"combined_score": 860
},
{
"protein2": "8022.A0A060YN11",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 551,
"textmining": 110,
"combined_score": 860
},
{
"protein2": "8022.A0A060W4Z4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060VPQ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060X6P0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 673,
"database": 0,
"textmining": 350,
"combined_score": 778
},
{
"protein2": "8022.A0A060WIX5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 494,
"textmining": 151,
"combined_score": 821
},
{
"protein2": "8022.A0A060WG53",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 121,
"combined_score": 836
},
{
"protein2": "8022.A0A060XJ59",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060ZHH4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 749,
"database": 431,
"textmining": 228,
"combined_score": 883
},
{
"protein2": "8022.A0A060W9K4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 573,
"textmining": 85,
"combined_score": 724
},
{
"protein2": "8022.A0A060WZS5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 839,
"textmining": 75,
"combined_score": 895
},
{
"protein2": "8022.A0A060Y0C6",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 751,
"database": 333,
"textmining": 309,
"combined_score": 880
},
{
"protein2": "8022.A0A060XKB8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 414,
"database": 566,
"textmining": 86,
"combined_score": 747
},
{
"protein2": "8022.A0A060W4C3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 662,
"database": 736,
"textmining": 237,
"combined_score": 925
},
{
"protein2": "8022.A0A060ZAW0",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060Y172",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 752,
"experimental": 892,
"database": 639,
"textmining": 406,
"combined_score": 993
},
{
"protein2": "8022.A0A060YK54",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 863,
"database": 736,
"textmining": 345,
"combined_score": 974
},
{
"protein2": "8022.A0A060ZG95",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 571,
"textmining": 263,
"combined_score": 793
},
{
"protein2": "8022.A0A060YGW4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 291,
"experimental": 366,
"database": 335,
"textmining": 230,
"combined_score": 739
},
{
"protein2": "8022.A0A060XKC3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 824,
"textmining": 44,
"combined_score": 881
},
{
"protein2": "8022.A0A060VP33",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 112,
"combined_score": 728
},
{
"protein2": "8022.A0A060X3Q0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 745,
"database": 599,
"textmining": 206,
"combined_score": 911
},
{
"protein2": "8022.A0A060Y737",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 121,
"combined_score": 836
},
{
"protein2": "8022.A0A060YIV9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 662,
"database": 736,
"textmining": 237,
"combined_score": 925
},
{
"protein2": "8022.A0A060XER7",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 745,
"database": 333,
"textmining": 191,
"combined_score": 866
},
{
"protein2": "8022.A0A060YT34",
"neighborhood": 53,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 694,
"database": 81,
"textmining": 219,
"combined_score": 764
},
{
"protein2": "8022.A0A060YFZ6",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 216,
"combined_score": 751
},
{
"protein2": "8022.A0A060XQ11",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 464,
"experimental": 528,
"database": 0,
"textmining": 390,
"combined_score": 834
},
{
"protein2": "8022.A0A060WET1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 291,
"experimental": 366,
"database": 335,
"textmining": 230,
"combined_score": 739
},
{
"protein2": "8022.A0A060XPT8",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 126,
"combined_score": 723
},
{
"protein2": "8022.A0A060Y9R6",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 77,
"experimental": 472,
"database": 333,
"textmining": 211,
"combined_score": 713
},
{
"protein2": "8022.A0A060VW75",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 910,
"textmining": 44,
"combined_score": 939
},
{
"protein2": "8022.A0A060X924",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 398,
"textmining": 164,
"combined_score": 757
},
{
"protein2": "8022.A0A060W5A4",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 108,
"combined_score": 717
},
{
"protein2": "8022.A0A060Y0Y6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 662,
"database": 736,
"textmining": 237,
"combined_score": 925
},
{
"protein2": "8022.A0A060YAW5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 668,
"database": 537,
"textmining": 110,
"combined_score": 851
},
{
"protein2": "8022.A0A060Z9W8",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 121,
"combined_score": 836
},
{
"protein2": "8022.A0A060X7C9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 188,
"database": 598,
"textmining": 261,
"combined_score": 742
},
{
"protein2": "8022.A0A060Z2T4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 760,
"database": 602,
"textmining": 276,
"combined_score": 924
},
{
"protein2": "8022.A0A060WIQ5",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 317,
"experimental": 716,
"database": 481,
"textmining": 233,
"combined_score": 913
},
{
"protein2": "8022.A0A060W8B2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 885,
"database": 816,
"textmining": 375,
"combined_score": 985
},
{
"protein2": "8022.A0A060YBV5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 494,
"textmining": 151,
"combined_score": 821
},
{
"protein2": "8022.A0A060X3H7",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060WFG1",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 494,
"textmining": 151,
"combined_score": 821
},
{
"protein2": "8022.A0A060YT33",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 155,
"database": 736,
"textmining": 119,
"combined_score": 786
},
{
"protein2": "8022.A0A060WKX6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 910,
"textmining": 213,
"combined_score": 950
},
{
"protein2": "8022.A0A060WIX3",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 239,
"database": 560,
"textmining": 196,
"combined_score": 709
},
{
"protein2": "8022.A0A060YJZ7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 300,
"database": 590,
"textmining": 136,
"combined_score": 735
},
{
"protein2": "8022.A0A060XXY2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 537,
"textmining": 158,
"combined_score": 725
},
{
"protein2": "8022.A0A060Y7Y9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 910,
"textmining": 151,
"combined_score": 946
},
{
"protein2": "8022.A0A060XIQ6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 537,
"textmining": 158,
"combined_score": 725
},
{
"protein2": "8022.A0A060XRA2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060WHU5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 756,
"database": 431,
"textmining": 227,
"combined_score": 883
},
{
"protein2": "8022.A0A060VXN4",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 136,
"combined_score": 726
},
{
"protein2": "8022.A0A060XAR9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 745,
"database": 599,
"textmining": 206,
"combined_score": 911
},
{
"protein2": "8022.A0A060XVH3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 628,
"database": 418,
"textmining": 151,
"combined_score": 871
},
{
"protein2": "8022.A0A060Y0G1",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 239,
"database": 560,
"textmining": 196,
"combined_score": 709
},
{
"protein2": "8022.A0A060W0X7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 365,
"database": 499,
"textmining": 152,
"combined_score": 706
},
{
"protein2": "8022.A0A060WQT0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 576,
"textmining": 75,
"combined_score": 723
},
{
"protein2": "8022.A0A060X2J6",
"neighborhood": 113,
"fusion": 0,
"cooccurence": 0,
"coexpression": 376,
"experimental": 676,
"database": 428,
"textmining": 262,
"combined_score": 910
},
{
"protein2": "8022.A0A060XIH3",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 255,
"experimental": 468,
"database": 385,
"textmining": 308,
"combined_score": 811
},
{
"protein2": "8022.A0A060WMD2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 745,
"database": 599,
"textmining": 206,
"combined_score": 911
},
{
"protein2": "8022.A0A060X483",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 108,
"combined_score": 717
},
{
"protein2": "8022.A0A060WZ00",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 487,
"database": 352,
"textmining": 231,
"combined_score": 801
},
{
"protein2": "8022.A0A060YN57",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 650,
"database": 0,
"textmining": 222,
"combined_score": 716
},
{
"protein2": "8022.A0A060X9Q4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 749,
"database": 431,
"textmining": 228,
"combined_score": 883
},
{
"protein2": "8022.A0A060XID6",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 398,
"textmining": 131,
"combined_score": 748
},
{
"protein2": "8022.A0A060Y1G5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 317,
"experimental": 768,
"database": 609,
"textmining": 308,
"combined_score": 951
},
{
"protein2": "8022.A0A060XWL9",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 745,
"database": 333,
"textmining": 191,
"combined_score": 866
},
{
"protein2": "8022.A0A060XKH1",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 398,
"textmining": 184,
"combined_score": 763
},
{
"protein2": "8022.A0A060W1A6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 54,
"experimental": 410,
"database": 568,
"textmining": 216,
"combined_score": 785
},
{
"protein2": "8022.C1BFD3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 602,
"textmining": 269,
"combined_score": 701
},
{
"protein2": "8022.A0A060WGH6",
"neighborhood": 48,
"fusion": 0,
"cooccurence": 0,
"coexpression": 192,
"experimental": 311,
"database": 430,
"textmining": 182,
"combined_score": 707
},
{
"protein2": "8022.A0A060WIM8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 537,
"textmining": 158,
"combined_score": 725
},
{
"protein2": "8022.A0A060W5H0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 176,
"database": 608,
"textmining": 152,
"combined_score": 702
},
{
"protein2": "8022.A0A060VTU3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 475,
"database": 372,
"textmining": 356,
"combined_score": 851
},
{
"protein2": "8022.A0A060XT73",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 269,
"database": 823,
"textmining": 0,
"combined_score": 865
},
{
"protein2": "8022.A0A060YNP1",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060WR23",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 594,
"experimental": 362,
"database": 0,
"textmining": 140,
"combined_score": 761
},
{
"protein2": "8022.A0A060YRY2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 744,
"database": 572,
"textmining": 219,
"combined_score": 916
},
{
"protein2": "8022.A0A060Y265",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 628,
"database": 418,
"textmining": 151,
"combined_score": 871
},
{
"protein2": "8022.A0A060YDR5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 155,
"database": 816,
"textmining": 86,
"combined_score": 845
},
{
"protein2": "8022.A0A060YHQ7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 161,
"database": 698,
"textmining": 159,
"combined_score": 768
},
{
"protein2": "8022.A0A060W3L2",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 317,
"experimental": 716,
"database": 481,
"textmining": 233,
"combined_score": 913
},
{
"protein2": "8022.A0A060XI54",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060WW29",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 494,
"textmining": 151,
"combined_score": 821
},
{
"protein2": "8022.A0A060X881",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 573,
"textmining": 85,
"combined_score": 724
},
{
"protein2": "8022.A0A060WPZ6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 538,
"database": 434,
"textmining": 186,
"combined_score": 768
},
{
"protein2": "8022.A0A060Y842",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060Z4C3",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060WLD4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 578,
"database": 305,
"textmining": 88,
"combined_score": 709
},
{
"protein2": "8022.A0A060Z4M3",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 113,
"combined_score": 719
},
{
"protein2": "8022.A0A060YBU0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 288,
"database": 607,
"textmining": 97,
"combined_score": 725
},
{
"protein2": "8022.A0A060YMV4",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 745,
"database": 333,
"textmining": 191,
"combined_score": 866
},
{
"protein2": "8022.A0A060W6U8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 714,
"database": 0,
"textmining": 308,
"combined_score": 811
},
{
"protein2": "8022.A0A060VUX6",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 121,
"combined_score": 836
},
{
"protein2": "8022.A0A060WT07",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 681,
"database": 425,
"textmining": 213,
"combined_score": 898
},
{
"protein2": "8022.A0A060XAW7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 659,
"database": 525,
"textmining": 108,
"combined_score": 842
},
{
"protein2": "8022.A0A060WWH4",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060WNH4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060WNW6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 537,
"textmining": 158,
"combined_score": 725
},
{
"protein2": "8022.A0A060WIM0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 538,
"database": 434,
"textmining": 186,
"combined_score": 768
},
{
"protein2": "8022.A0A060WRM4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 546,
"database": 467,
"textmining": 86,
"combined_score": 759
},
{
"protein2": "8022.A0A060YNK9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 414,
"database": 566,
"textmining": 86,
"combined_score": 747
},
{
"protein2": "8022.A0A060XBL7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 659,
"database": 525,
"textmining": 108,
"combined_score": 842
},
{
"protein2": "8022.A0A060XSH9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 816,
"textmining": 134,
"combined_score": 838
},
{
"protein2": "8022.A0A060XPN2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 140,
"combined_score": 727
},
{
"protein2": "8022.A0A060WKN9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 551,
"textmining": 110,
"combined_score": 860
},
{
"protein2": "8022.A0A060X1N4",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 206,
"database": 827,
"textmining": 399,
"combined_score": 910
},
{
"protein2": "8022.C1BG62",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 107,
"experimental": 276,
"database": 610,
"textmining": 82,
"combined_score": 737
},
{
"protein2": "8022.A0A060X8B1",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 594,
"experimental": 362,
"database": 0,
"textmining": 140,
"combined_score": 761
},
{
"protein2": "8022.A0A060YP71",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 744,
"database": 572,
"textmining": 219,
"combined_score": 916
},
{
"protein2": "8022.A0A060XBJ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 155,
"database": 816,
"textmining": 119,
"combined_score": 851
},
{
"protein2": "8022.A0A060Z7B1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060VSJ9",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 501,
"experimental": 672,
"database": 510,
"textmining": 225,
"combined_score": 930
},
{
"protein2": "8022.A0A060WFI2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 745,
"database": 599,
"textmining": 206,
"combined_score": 911
},
{
"protein2": "8022.A0A060XR67",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 184,
"experimental": 231,
"database": 824,
"textmining": 66,
"combined_score": 883
},
{
"protein2": "8022.A0A060W1U9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 155,
"database": 736,
"textmining": 119,
"combined_score": 786
},
{
"protein2": "8022.A0A060XBN4",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 494,
"textmining": 151,
"combined_score": 821
},
{
"protein2": "8022.A0A060YSJ4",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 239,
"database": 560,
"textmining": 196,
"combined_score": 709
},
{
"protein2": "8022.A0A060YZ22",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 466,
"database": 566,
"textmining": 223,
"combined_score": 860
},
{
"protein2": "8022.A0A060VYB4",
"neighborhood": 53,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 335,
"database": 739,
"textmining": 64,
"combined_score": 825
},
{
"protein2": "8022.A0A060WN02",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060X1R9",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060XG31",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 650,
"database": 0,
"textmining": 222,
"combined_score": 716
},
{
"protein2": "8022.A0A060Y8T5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 422,
"textmining": 184,
"combined_score": 773
},
{
"protein2": "8022.A0A060YPV1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 387,
"database": 568,
"textmining": 177,
"combined_score": 765
},
{
"protein2": "8022.A0A060WET2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 112,
"combined_score": 728
},
{
"protein2": "8022.A0A060X011",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 160,
"experimental": 390,
"database": 385,
"textmining": 232,
"combined_score": 730
},
{
"protein2": "8022.A0A060W9A6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 203,
"experimental": 704,
"database": 569,
"textmining": 231,
"combined_score": 911
},
{
"protein2": "8022.A0A060ZU15",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 203,
"experimental": 704,
"database": 569,
"textmining": 231,
"combined_score": 911
},
{
"protein2": "8022.A0A060WSW3",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 466,
"database": 514,
"textmining": 223,
"combined_score": 843
},
{
"protein2": "8022.A0A060X5C5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 413,
"experimental": 804,
"database": 0,
"textmining": 389,
"combined_score": 923
},
{
"protein2": "8022.A0A060WIJ5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 466,
"database": 566,
"textmining": 223,
"combined_score": 860
},
{
"protein2": "8022.A0A060Y1M3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 681,
"database": 425,
"textmining": 213,
"combined_score": 898
},
{
"protein2": "8022.A0A060Y1T3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 743,
"database": 333,
"textmining": 268,
"combined_score": 869
},
{
"protein2": "8022.A0A060VTD2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 112,
"combined_score": 728
},
{
"protein2": "8022.A0A060YVG1",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060X996",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 414,
"database": 566,
"textmining": 86,
"combined_score": 747
},
{
"protein2": "8022.A0A060Y0S7",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 221,
"experimental": 390,
"database": 385,
"textmining": 198,
"combined_score": 738
},
{
"protein2": "8022.A0A060WT46",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060VVY9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 576,
"textmining": 75,
"combined_score": 723
},
{
"protein2": "8022.A0A060WTE7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 121,
"combined_score": 836
},
{
"protein2": "8022.A0A060WZ23",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 137,
"experimental": 338,
"database": 608,
"textmining": 160,
"combined_score": 786
},
{
"protein2": "8022.A0A060Y2D4",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 206,
"database": 827,
"textmining": 88,
"combined_score": 864
},
{
"protein2": "8022.A0A060WME3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060YQ33",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 136,
"experimental": 744,
"database": 572,
"textmining": 219,
"combined_score": 916
},
{
"protein2": "8022.A0A060Z0S6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 578,
"database": 305,
"textmining": 88,
"combined_score": 709
},
{
"protein2": "8022.A0A060YLY2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 501,
"experimental": 672,
"database": 510,
"textmining": 225,
"combined_score": 930
},
{
"protein2": "8022.A0A060X1K0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 654,
"textmining": 153,
"combined_score": 819
},
{
"protein2": "8022.A0A060VTJ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 827,
"textmining": 44,
"combined_score": 883
},
{
"protein2": "8022.A0A060YT46",
"neighborhood": 48,
"fusion": 0,
"cooccurence": 0,
"coexpression": 734,
"experimental": 288,
"database": 0,
"textmining": 308,
"combined_score": 858
},
{
"protein2": "8022.A0A060XRY9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 576,
"textmining": 75,
"combined_score": 723
},
{
"protein2": "8022.A0A060WXS1",
"neighborhood": 53,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 483,
"database": 521,
"textmining": 86,
"combined_score": 756
},
{
"protein2": "8022.A0A060X0G4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 681,
"database": 425,
"textmining": 422,
"combined_score": 925
},
{
"protein2": "8022.A0A060WS71",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 398,
"textmining": 131,
"combined_score": 748
},
{
"protein2": "8022.A0A060YVB4",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 216,
"combined_score": 751
},
{
"protein2": "8022.A0A060WZ37",
"neighborhood": 53,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 483,
"database": 777,
"textmining": 86,
"combined_score": 886
},
{
"protein2": "8022.A0A060Y6Y0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 622,
"database": 573,
"textmining": 233,
"combined_score": 865
},
{
"protein2": "8022.A0A060YEB2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 221,
"experimental": 390,
"database": 385,
"textmining": 198,
"combined_score": 738
},
{
"protein2": "8022.A0A060WU94",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 291,
"experimental": 366,
"database": 335,
"textmining": 230,
"combined_score": 739
},
{
"protein2": "8022.A0A060WTK7",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 151,
"combined_score": 731
},
{
"protein2": "8022.A0A060WES3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 394,
"experimental": 475,
"database": 372,
"textmining": 400,
"combined_score": 866
},
{
"protein2": "8022.A0A060YGJ9",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060VP96",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 300,
"database": 604,
"textmining": 136,
"combined_score": 744
},
{
"protein2": "8022.A0A060WKD4",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 136,
"combined_score": 726
},
{
"protein2": "8022.A0A060W5D0",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 501,
"experimental": 672,
"database": 594,
"textmining": 312,
"combined_score": 949
},
{
"protein2": "8022.A0A060Z3A5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060W9Q2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 216,
"combined_score": 751
},
{
"protein2": "8022.A0A060YBC7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 130,
"combined_score": 838
},
{
"protein2": "8022.A0A060X8W2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060YDZ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 203,
"experimental": 704,
"database": 569,
"textmining": 231,
"combined_score": 911
},
{
"protein2": "8022.A0A060ZJV2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 216,
"combined_score": 751
},
{
"protein2": "8022.A0A061A6Z5",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 121,
"combined_score": 836
},
{
"protein2": "8022.A0A060XVG3",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 745,
"database": 333,
"textmining": 191,
"combined_score": 866
},
{
"protein2": "8022.A0A060XVX5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 551,
"textmining": 110,
"combined_score": 860
},
{
"protein2": "8022.A0A060XVV6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 760,
"database": 602,
"textmining": 276,
"combined_score": 924
},
{
"protein2": "8022.A0A060XNA7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 414,
"database": 566,
"textmining": 86,
"combined_score": 747
},
{
"protein2": "8022.C1BG90",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 602,
"textmining": 269,
"combined_score": 701
},
{
"protein2": "8022.A0A060XFQ8",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 398,
"textmining": 184,
"combined_score": 763
},
{
"protein2": "8022.A0A060X6R7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 749,
"database": 305,
"textmining": 136,
"combined_score": 836
},
{
"protein2": "8022.A0A060X5Q3",
"neighborhood": 46,
"fusion": 0,
"cooccurence": 0,
"coexpression": 43,
"experimental": 244,
"database": 826,
"textmining": 42,
"combined_score": 863
},
{
"protein2": "8022.A0A060WUJ2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 745,
"database": 333,
"textmining": 191,
"combined_score": 866
},
{
"protein2": "8022.A0A060XRF4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060XV15",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 578,
"database": 305,
"textmining": 88,
"combined_score": 709
},
{
"protein2": "8022.A0A060WHY1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 317,
"experimental": 768,
"database": 609,
"textmining": 308,
"combined_score": 951
},
{
"protein2": "8022.A0A060Y668",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 188,
"database": 770,
"textmining": 262,
"combined_score": 852
},
{
"protein2": "8022.A0A060WDE0",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 494,
"textmining": 151,
"combined_score": 821
},
{
"protein2": "8022.A0A060X0K1",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060VMS2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 538,
"database": 434,
"textmining": 186,
"combined_score": 768
},
{
"protein2": "8022.A0A060YP00",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 422,
"textmining": 184,
"combined_score": 773
},
{
"protein2": "8022.A0A060X7R3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 551,
"textmining": 110,
"combined_score": 860
},
{
"protein2": "8022.A0A060WSJ3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 551,
"textmining": 110,
"combined_score": 860
},
{
"protein2": "8022.A0A060XRB2",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 388,
"experimental": 577,
"database": 372,
"textmining": 229,
"combined_score": 860
},
{
"protein2": "8022.A0A060Y2M8",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 745,
"database": 333,
"textmining": 191,
"combined_score": 866
},
{
"protein2": "8022.A0A060XIH9",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 394,
"experimental": 475,
"database": 372,
"textmining": 400,
"combined_score": 866
},
{
"protein2": "8022.A0A060Z3P3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 551,
"textmining": 110,
"combined_score": 860
},
{
"protein2": "8022.A0A060YC16",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 596,
"experimental": 158,
"database": 0,
"textmining": 234,
"combined_score": 721
},
{
"protein2": "8022.A0A060XRN9",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 108,
"combined_score": 717
},
{
"protein2": "8022.A0A060WJV4",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 136,
"combined_score": 726
},
{
"protein2": "8022.A0A060VXZ3",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 501,
"experimental": 672,
"database": 510,
"textmining": 225,
"combined_score": 930
},
{
"protein2": "8022.A0A060XLB8",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 398,
"experimental": 362,
"database": 0,
"textmining": 279,
"combined_score": 703
},
{
"protein2": "8022.A0A060XKL0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 578,
"database": 305,
"textmining": 88,
"combined_score": 709
},
{
"protein2": "8022.A0A060VSV9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 291,
"experimental": 366,
"database": 335,
"textmining": 230,
"combined_score": 739
},
{
"protein2": "8022.A0A060WIW0",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 494,
"textmining": 151,
"combined_score": 821
},
{
"protein2": "8022.A0A060X8I2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 760,
"database": 602,
"textmining": 276,
"combined_score": 924
},
{
"protein2": "8022.A0A060WX48",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 523,
"database": 333,
"textmining": 224,
"combined_score": 746
},
{
"protein2": "8022.A0A060XM16",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060X0B9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 52,
"experimental": 387,
"database": 568,
"textmining": 177,
"combined_score": 765
},
{
"protein2": "8022.A0A060XFQ3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 43,
"experimental": 285,
"database": 510,
"textmining": 277,
"combined_score": 729
},
{
"protein2": "8022.A0A060XWV3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 622,
"database": 573,
"textmining": 233,
"combined_score": 865
},
{
"protein2": "8022.A0A060X2Y0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060WZJ2",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 239,
"database": 560,
"textmining": 196,
"combined_score": 709
},
{
"protein2": "8022.A0A060WXM8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 413,
"experimental": 804,
"database": 0,
"textmining": 389,
"combined_score": 923
},
{
"protein2": "8022.A0A060WKE4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 80,
"experimental": 520,
"database": 427,
"textmining": 236,
"combined_score": 780
},
{
"protein2": "8022.A0A060ZIZ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 75,
"experimental": 719,
"database": 276,
"textmining": 285,
"combined_score": 847
},
{
"protein2": "8022.A0A060XG86",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 221,
"experimental": 390,
"database": 385,
"textmining": 198,
"combined_score": 738
},
{
"protein2": "8022.A0A061ADP7",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 422,
"textmining": 184,
"combined_score": 773
},
{
"protein2": "8022.A0A060WQ48",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 415,
"textmining": 184,
"combined_score": 770
},
{
"protein2": "8022.A0A060XSP1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 824,
"textmining": 44,
"combined_score": 881
},
{
"protein2": "8022.A0A060W1W2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 596,
"experimental": 158,
"database": 0,
"textmining": 234,
"combined_score": 721
},
{
"protein2": "8022.A0A060XX32",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 49,
"coexpression": 0,
"experimental": 0,
"database": 910,
"textmining": 0,
"combined_score": 910
},
{
"protein2": "8022.A0A060Y8X7",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 221,
"experimental": 390,
"database": 385,
"textmining": 198,
"combined_score": 738
},
{
"protein2": "8022.A0A060ZEP6",
"neighborhood": 53,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 335,
"database": 739,
"textmining": 64,
"combined_score": 825
},
{
"protein2": "8022.A0A060Y0I2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 291,
"experimental": 366,
"database": 335,
"textmining": 230,
"combined_score": 739
},
{
"protein2": "8022.A0A060YP66",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 681,
"database": 425,
"textmining": 372,
"combined_score": 919
},
{
"protein2": "8022.A0A060XQN1",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 596,
"experimental": 158,
"database": 0,
"textmining": 234,
"combined_score": 721
},
{
"protein2": "8022.A0A060XYC7",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 160,
"experimental": 390,
"database": 385,
"textmining": 225,
"combined_score": 727
},
{
"protein2": "8022.A0A060XS96",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 108,
"combined_score": 717
},
{
"protein2": "8022.A0A060W5B2",
"neighborhood": 53,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 694,
"database": 81,
"textmining": 219,
"combined_score": 764
},
{
"protein2": "8022.A0A060X173",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060YBS9",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 466,
"database": 514,
"textmining": 223,
"combined_score": 843
},
{
"protein2": "8022.A0A060XI31",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 546,
"database": 467,
"textmining": 86,
"combined_score": 759
},
{
"protein2": "8022.A0A060XPW0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 49,
"coexpression": 0,
"experimental": 0,
"database": 862,
"textmining": 0,
"combined_score": 863
},
{
"protein2": "8022.A0A060YHY9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 747,
"database": 530,
"textmining": 275,
"combined_score": 906
},
{
"protein2": "8022.A0A060X7A6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 551,
"textmining": 110,
"combined_score": 860
},
{
"protein2": "8022.A0A060X795",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 839,
"textmining": 75,
"combined_score": 895
},
{
"protein2": "8022.A0A060YYJ1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 622,
"database": 573,
"textmining": 233,
"combined_score": 865
},
{
"protein2": "8022.A0A060YN23",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 551,
"textmining": 110,
"combined_score": 860
},
{
"protein2": "8022.A0A060XXH3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 388,
"experimental": 577,
"database": 372,
"textmining": 229,
"combined_score": 860
},
{
"protein2": "8022.A0A060WP57",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 415,
"textmining": 184,
"combined_score": 770
},
{
"protein2": "8022.A0A060XQG8",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 745,
"database": 333,
"textmining": 191,
"combined_score": 866
},
{
"protein2": "8022.A0A060VYX8",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 77,
"experimental": 472,
"database": 333,
"textmining": 211,
"combined_score": 713
},
{
"protein2": "8022.A0A060WBD3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 751,
"database": 333,
"textmining": 309,
"combined_score": 880
},
{
"protein2": "8022.A0A060WWC7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 537,
"textmining": 158,
"combined_score": 725
},
{
"protein2": "8022.A0A060YX95",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 756,
"database": 431,
"textmining": 227,
"combined_score": 883
},
{
"protein2": "8022.A0A060Y956",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 86,
"combined_score": 710
},
{
"protein2": "8022.A0A060VU47",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 681,
"database": 425,
"textmining": 372,
"combined_score": 919
},
{
"protein2": "8022.A0A060W321",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060Y4J9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 622,
"database": 573,
"textmining": 233,
"combined_score": 865
},
{
"protein2": "8022.A0A060WZL8",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 475,
"database": 372,
"textmining": 231,
"combined_score": 822
},
{
"protein2": "8022.A0A060WCV3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 523,
"database": 333,
"textmining": 224,
"combined_score": 746
},
{
"protein2": "8022.Q9PT09",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 107,
"experimental": 276,
"database": 610,
"textmining": 82,
"combined_score": 737
},
{
"protein2": "8022.A0A060YAV2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 747,
"database": 530,
"textmining": 275,
"combined_score": 906
},
{
"protein2": "8022.A0A060YSP2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 494,
"textmining": 151,
"combined_score": 821
},
{
"protein2": "8022.A0A060VWL5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 466,
"database": 514,
"textmining": 223,
"combined_score": 843
},
{
"protein2": "8022.A0A060VTB1",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 398,
"textmining": 131,
"combined_score": 748
},
{
"protein2": "8022.A0A060Z671",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 80,
"experimental": 520,
"database": 427,
"textmining": 143,
"combined_score": 754
},
{
"protein2": "8022.A0A060X9N1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 578,
"database": 305,
"textmining": 88,
"combined_score": 709
},
{
"protein2": "8022.A0A060XLH8",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 239,
"database": 560,
"textmining": 196,
"combined_score": 709
},
{
"protein2": "8022.A0A060XTM1",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060WS21",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 161,
"database": 698,
"textmining": 159,
"combined_score": 768
},
{
"protein2": "8022.A0A060X6P4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 756,
"database": 431,
"textmining": 227,
"combined_score": 883
},
{
"protein2": "8022.A0A060WGQ7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060XKZ0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 760,
"database": 602,
"textmining": 276,
"combined_score": 924
},
{
"protein2": "8022.A0A060X747",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 538,
"database": 434,
"textmining": 186,
"combined_score": 768
},
{
"protein2": "8022.A0A060VZB1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 279,
"database": 593,
"textmining": 274,
"combined_score": 768
},
{
"protein2": "8022.A0A060WF01",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 494,
"textmining": 151,
"combined_score": 821
},
{
"protein2": "8022.A0A060Z3H2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 494,
"textmining": 151,
"combined_score": 821
},
{
"protein2": "8022.A0A060WC37",
"neighborhood": 48,
"fusion": 0,
"cooccurence": 0,
"coexpression": 192,
"experimental": 311,
"database": 430,
"textmining": 182,
"combined_score": 707
},
{
"protein2": "8022.A0A060Z2Q6",
"neighborhood": 48,
"fusion": 0,
"cooccurence": 0,
"coexpression": 192,
"experimental": 311,
"database": 430,
"textmining": 182,
"combined_score": 707
},
{
"protein2": "8022.A0A060WGA5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 188,
"database": 770,
"textmining": 262,
"combined_score": 852
},
{
"protein2": "8022.A0A060Y0Z6",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 388,
"experimental": 577,
"database": 372,
"textmining": 229,
"combined_score": 860
},
{
"protein2": "8022.A0A060XU63",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 596,
"experimental": 158,
"database": 0,
"textmining": 234,
"combined_score": 721
},
{
"protein2": "8022.A0A060YC57",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 206,
"database": 827,
"textmining": 451,
"combined_score": 918
},
{
"protein2": "8022.A0A060WW88",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 121,
"combined_score": 836
},
{
"protein2": "8022.A0A060X0I3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 87,
"coexpression": 184,
"experimental": 231,
"database": 824,
"textmining": 66,
"combined_score": 888
},
{
"protein2": "8022.A0A060VTX5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060ZHR8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 714,
"database": 0,
"textmining": 308,
"combined_score": 811
},
{
"protein2": "8022.A0A060YNU6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 415,
"database": 575,
"textmining": 134,
"combined_score": 771
},
{
"protein2": "8022.A0A060WZL3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 681,
"database": 425,
"textmining": 213,
"combined_score": 898
},
{
"protein2": "8022.A0A060X925",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 300,
"database": 604,
"textmining": 136,
"combined_score": 744
},
{
"protein2": "8022.A0A060X100",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060X3D1",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 594,
"experimental": 362,
"database": 0,
"textmining": 140,
"combined_score": 761
},
{
"protein2": "8022.A0A060Z5F3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 517,
"textmining": 151,
"combined_score": 711
},
{
"protein2": "8022.A0A060WM62",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060YC34",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 130,
"combined_score": 838
},
{
"protein2": "8022.A0A060XMU7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 233,
"combined_score": 857
},
{
"protein2": "8022.A0A060VZD9",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 475,
"database": 372,
"textmining": 231,
"combined_score": 822
},
{
"protein2": "8022.A0A060XUR0",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060VUJ1",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 112,
"combined_score": 728
},
{
"protein2": "8022.A0A060VN15",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 827,
"textmining": 44,
"combined_score": 883
},
{
"protein2": "8022.A0A060VNA2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 300,
"database": 604,
"textmining": 136,
"combined_score": 744
},
{
"protein2": "8022.A0A060YTQ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 546,
"database": 467,
"textmining": 86,
"combined_score": 759
},
{
"protein2": "8022.A0A060YCE9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060WLB7",
"neighborhood": 53,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 483,
"database": 777,
"textmining": 86,
"combined_score": 886
},
{
"protein2": "8022.A0A060WS33",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 576,
"textmining": 75,
"combined_score": 723
},
{
"protein2": "8022.A0A060YL26",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 537,
"textmining": 158,
"combined_score": 725
},
{
"protein2": "8022.A0A060Z011",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 571,
"textmining": 263,
"combined_score": 793
},
{
"protein2": "8022.A0A060XVP2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 140,
"combined_score": 727
},
{
"protein2": "8022.A0A060YZM3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 628,
"database": 418,
"textmining": 151,
"combined_score": 871
},
{
"protein2": "8022.A0A060Z608",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 650,
"database": 0,
"textmining": 222,
"combined_score": 716
},
{
"protein2": "8022.A0A060X833",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 418,
"database": 420,
"textmining": 183,
"combined_score": 700
},
{
"protein2": "8022.A0A060W2P2",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 681,
"database": 425,
"textmining": 213,
"combined_score": 898
},
{
"protein2": "8022.A0A060XS93",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 494,
"textmining": 151,
"combined_score": 821
},
{
"protein2": "8022.A0A060XU96",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 269,
"database": 823,
"textmining": 0,
"combined_score": 865
},
{
"protein2": "8022.A0A060Z5T3",
"neighborhood": 157,
"fusion": 0,
"cooccurence": 0,
"coexpression": 619,
"experimental": 274,
"database": 0,
"textmining": 310,
"combined_score": 817
},
{
"protein2": "8022.A0A060YKD2",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 681,
"database": 425,
"textmining": 213,
"combined_score": 898
},
{
"protein2": "8022.A0A060W590",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 622,
"database": 573,
"textmining": 233,
"combined_score": 865
},
{
"protein2": "8022.A0A060XLI5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 415,
"textmining": 184,
"combined_score": 770
},
{
"protein2": "8022.A0A060XFZ8",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 745,
"database": 333,
"textmining": 191,
"combined_score": 866
},
{
"protein2": "8022.A0A060W9R5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 487,
"database": 352,
"textmining": 231,
"combined_score": 801
},
{
"protein2": "8022.A0A060Z753",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 398,
"database": 571,
"textmining": 263,
"combined_score": 793
},
{
"protein2": "8022.A0A060WWK9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060WVU0",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 239,
"database": 560,
"textmining": 196,
"combined_score": 709
},
{
"protein2": "8022.A0A060VTX8",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 136,
"combined_score": 726
},
{
"protein2": "8022.A0A060YIJ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060YS73",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 681,
"database": 425,
"textmining": 213,
"combined_score": 898
},
{
"protein2": "8022.A0A060XT19",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 239,
"database": 560,
"textmining": 196,
"combined_score": 709
},
{
"protein2": "8022.A0A060WQJ1",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 388,
"experimental": 577,
"database": 372,
"textmining": 217,
"combined_score": 857
},
{
"protein2": "8022.A0A060XUV0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 910,
"textmining": 213,
"combined_score": 950
},
{
"protein2": "8022.A0A060YJ53",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 551,
"textmining": 110,
"combined_score": 860
},
{
"protein2": "8022.A0A060X1H7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 714,
"database": 0,
"textmining": 308,
"combined_score": 811
},
{
"protein2": "8022.A0A060Z1D6",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 362,
"database": 0,
"textmining": 204,
"combined_score": 798
},
{
"protein2": "8022.A0A060WTV3",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A061A939",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 654,
"textmining": 153,
"combined_score": 819
},
{
"protein2": "8022.A0A060W511",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 414,
"database": 566,
"textmining": 86,
"combined_score": 747
},
{
"protein2": "8022.A0A060XMQ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 317,
"experimental": 768,
"database": 609,
"textmining": 308,
"combined_score": 951
},
{
"protein2": "8022.A0A060X313",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 136,
"combined_score": 726
},
{
"protein2": "8022.A0A060XZQ6",
"neighborhood": 48,
"fusion": 0,
"cooccurence": 0,
"coexpression": 734,
"experimental": 288,
"database": 0,
"textmining": 308,
"combined_score": 858
},
{
"protein2": "8022.A0A060X5S5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 160,
"experimental": 390,
"database": 385,
"textmining": 265,
"combined_score": 741
},
{
"protein2": "8022.A0A060YDB5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 203,
"experimental": 704,
"database": 569,
"textmining": 231,
"combined_score": 911
},
{
"protein2": "8022.A0A060XV60",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 654,
"textmining": 153,
"combined_score": 819
},
{
"protein2": "8022.A0A060Y5M1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 578,
"database": 305,
"textmining": 88,
"combined_score": 709
},
{
"protein2": "8022.A0A060XF94",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 573,
"textmining": 85,
"combined_score": 724
},
{
"protein2": "8022.A0A060WTC8",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060X621",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 288,
"database": 607,
"textmining": 97,
"combined_score": 725
},
{
"protein2": "8022.A0A060WE23",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 576,
"textmining": 75,
"combined_score": 723
},
{
"protein2": "8022.A0A060Y0A6",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 464,
"experimental": 528,
"database": 0,
"textmining": 390,
"combined_score": 834
},
{
"protein2": "8022.A0A060X0Z3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 749,
"database": 305,
"textmining": 136,
"combined_score": 836
},
{
"protein2": "8022.A0A060XLX9",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 422,
"textmining": 184,
"combined_score": 773
},
{
"protein2": "8022.A0A060VUI9",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 160,
"experimental": 390,
"database": 385,
"textmining": 265,
"combined_score": 741
},
{
"protein2": "8022.A0A060Z698",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 203,
"experimental": 704,
"database": 569,
"textmining": 231,
"combined_score": 911
},
{
"protein2": "8022.A0A060XH83",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 140,
"combined_score": 727
},
{
"protein2": "8022.A0A060WPC3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 829,
"textmining": 44,
"combined_score": 884
},
{
"protein2": "8022.A0A060WDF7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 714,
"database": 0,
"textmining": 308,
"combined_score": 811
},
{
"protein2": "8022.A0A060XFF6",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060WMF6",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060WT77",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 79,
"coexpression": 184,
"experimental": 231,
"database": 824,
"textmining": 66,
"combined_score": 887
},
{
"protein2": "8022.A0A060XH19",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 300,
"database": 604,
"textmining": 136,
"combined_score": 744
},
{
"protein2": "8022.A0A060YGX2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 136,
"combined_score": 726
},
{
"protein2": "8022.A0A060YJ10",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 398,
"textmining": 164,
"combined_score": 757
},
{
"protein2": "8022.A0A060YPZ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 747,
"database": 530,
"textmining": 275,
"combined_score": 906
},
{
"protein2": "8022.A0A060YQ01",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 233,
"combined_score": 857
},
{
"protein2": "8022.A0A060XKP9",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 422,
"textmining": 184,
"combined_score": 773
},
{
"protein2": "8022.A0A060WJQ6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 839,
"textmining": 75,
"combined_score": 895
},
{
"protein2": "8022.A0A060W549",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060XMD3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 749,
"database": 305,
"textmining": 136,
"combined_score": 836
},
{
"protein2": "8022.A0A060XQK3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 760,
"database": 602,
"textmining": 276,
"combined_score": 924
},
{
"protein2": "8022.A0A060YIG6",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 362,
"database": 0,
"textmining": 204,
"combined_score": 798
},
{
"protein2": "8022.A0A060X8Y7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 415,
"database": 575,
"textmining": 134,
"combined_score": 771
},
{
"protein2": "8022.A0A060YQ36",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 749,
"database": 305,
"textmining": 136,
"combined_score": 836
},
{
"protein2": "8022.A0A060X0Y4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 475,
"database": 372,
"textmining": 231,
"combined_score": 822
},
{
"protein2": "8022.A0A060XKV5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 769,
"database": 862,
"textmining": 345,
"combined_score": 977
},
{
"protein2": "8022.A0A060ZGX8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 75,
"experimental": 719,
"database": 276,
"textmining": 285,
"combined_score": 847
},
{
"protein2": "8022.A0A060VRH7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 622,
"database": 573,
"textmining": 233,
"combined_score": 865
},
{
"protein2": "8022.A0A060XTG2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 136,
"combined_score": 726
},
{
"protein2": "8022.A0A060WQ49",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 136,
"combined_score": 726
},
{
"protein2": "8022.A0A060YDJ4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 681,
"database": 425,
"textmining": 213,
"combined_score": 898
},
{
"protein2": "8022.A0A060Z3C0",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 216,
"combined_score": 751
},
{
"protein2": "8022.A0A060YPE8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 54,
"experimental": 410,
"database": 568,
"textmining": 216,
"combined_score": 785
},
{
"protein2": "8022.A0A060WU49",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060YTB0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 54,
"experimental": 410,
"database": 568,
"textmining": 216,
"combined_score": 785
},
{
"protein2": "8022.A0A060Y7X2",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 239,
"database": 560,
"textmining": 196,
"combined_score": 709
},
{
"protein2": "8022.A0A060X189",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 92,
"experimental": 744,
"database": 572,
"textmining": 219,
"combined_score": 911
},
{
"protein2": "8022.A0A060VZ05",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 136,
"combined_score": 726
},
{
"protein2": "8022.A0A060YG86",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 678,
"database": 551,
"textmining": 110,
"combined_score": 860
},
{
"protein2": "8022.A0A060XFD4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 578,
"database": 305,
"textmining": 88,
"combined_score": 709
},
{
"protein2": "8022.A0A060WTN3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 681,
"database": 425,
"textmining": 372,
"combined_score": 919
},
{
"protein2": "8022.O93245",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 662,
"database": 736,
"textmining": 237,
"combined_score": 925
},
{
"protein2": "8022.A0A060VPK1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 291,
"experimental": 366,
"database": 335,
"textmining": 230,
"combined_score": 739
},
{
"protein2": "8022.A0A060Z6H0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 414,
"database": 566,
"textmining": 86,
"combined_score": 747
},
{
"protein2": "8022.A0A060XMQ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 86,
"coexpression": 184,
"experimental": 231,
"database": 824,
"textmining": 66,
"combined_score": 888
},
{
"protein2": "8022.A0A060XN97",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 650,
"database": 0,
"textmining": 222,
"combined_score": 716
},
{
"protein2": "8022.A0A060XAD4",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 398,
"textmining": 164,
"combined_score": 757
},
{
"protein2": "8022.A0A060Z048",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060YXQ1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 668,
"database": 537,
"textmining": 110,
"combined_score": 851
},
{
"protein2": "8022.A0A060WE12",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 54,
"experimental": 649,
"database": 423,
"textmining": 225,
"combined_score": 831
},
{
"protein2": "8022.A0A060X0B5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 487,
"database": 352,
"textmining": 231,
"combined_score": 801
},
{
"protein2": "8022.A0A060W593",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 415,
"database": 575,
"textmining": 134,
"combined_score": 771
},
{
"protein2": "8022.A0A060XL01",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 654,
"textmining": 153,
"combined_score": 819
},
{
"protein2": "8022.A0A060VNI0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 415,
"database": 575,
"textmining": 134,
"combined_score": 771
},
{
"protein2": "8022.A0A060YMA6",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 745,
"database": 333,
"textmining": 191,
"combined_score": 866
},
{
"protein2": "8022.A0A060ZAX5",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060VM58",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 466,
"database": 514,
"textmining": 223,
"combined_score": 843
},
{
"protein2": "8022.A0A060WTG9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 578,
"database": 305,
"textmining": 88,
"combined_score": 709
},
{
"protein2": "8022.A0A060Z269",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 80,
"experimental": 520,
"database": 427,
"textmining": 236,
"combined_score": 780
},
{
"protein2": "8022.A0A060XH10",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 578,
"database": 305,
"textmining": 88,
"combined_score": 709
},
{
"protein2": "8022.A0A060W0Z6",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 523,
"database": 333,
"textmining": 224,
"combined_score": 746
},
{
"protein2": "8022.A0A060XU67",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 602,
"textmining": 269,
"combined_score": 701
},
{
"protein2": "8022.A0A060YFC5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 466,
"database": 566,
"textmining": 223,
"combined_score": 860
},
{
"protein2": "8022.A0A060XC97",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060WFL5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060YDC6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 42,
"experimental": 769,
"database": 862,
"textmining": 345,
"combined_score": 977
},
{
"protein2": "8022.A0A060W3W8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 49,
"coexpression": 0,
"experimental": 0,
"database": 862,
"textmining": 0,
"combined_score": 863
},
{
"protein2": "8022.A0A060Y9Q0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 0,
"database": 816,
"textmining": 134,
"combined_score": 838
},
{
"protein2": "8022.A0A061AD99",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 140,
"combined_score": 727
},
{
"protein2": "8022.A0A060Y028",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 563,
"experimental": 362,
"database": 0,
"textmining": 374,
"combined_score": 812
},
{
"protein2": "8022.A0A060X8R3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 578,
"database": 305,
"textmining": 88,
"combined_score": 709
},
{
"protein2": "8022.A0A060W2L4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 517,
"textmining": 151,
"combined_score": 711
},
{
"protein2": "8022.A0A060Y887",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 388,
"experimental": 577,
"database": 372,
"textmining": 229,
"combined_score": 860
},
{
"protein2": "8022.A0A060X2T0",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 626,
"experimental": 0,
"database": 0,
"textmining": 276,
"combined_score": 722
},
{
"protein2": "8022.A0A060YYY0",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060YXU2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060XYX3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 155,
"database": 816,
"textmining": 86,
"combined_score": 845
},
{
"protein2": "8022.A0A060YL36",
"neighborhood": 53,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 483,
"database": 777,
"textmining": 86,
"combined_score": 886
},
{
"protein2": "8022.A0A060XXQ2",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 626,
"experimental": 0,
"database": 0,
"textmining": 276,
"combined_score": 722
},
{
"protein2": "8022.A0A060YTF9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 75,
"experimental": 719,
"database": 276,
"textmining": 285,
"combined_score": 847
},
{
"protein2": "8022.A0A060YB73",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 457,
"database": 525,
"textmining": 125,
"combined_score": 754
},
{
"protein2": "8022.A0A060Y544",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 487,
"database": 352,
"textmining": 231,
"combined_score": 801
},
{
"protein2": "8022.A0A060YGK7",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 745,
"database": 333,
"textmining": 191,
"combined_score": 866
},
{
"protein2": "8022.A0A060Z192",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 546,
"database": 467,
"textmining": 86,
"combined_score": 759
},
{
"protein2": "8022.A0A060VNG5",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 381,
"experimental": 475,
"database": 372,
"textmining": 276,
"combined_score": 835
},
{
"protein2": "8022.A0A060YDW3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 376,
"database": 570,
"textmining": 214,
"combined_score": 770
},
{
"protein2": "8022.A0A060YDC0",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 681,
"database": 425,
"textmining": 213,
"combined_score": 898
},
{
"protein2": "8022.A0A060W6N9",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 388,
"experimental": 577,
"database": 372,
"textmining": 229,
"combined_score": 860
},
{
"protein2": "8022.A0A060Z3A1",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 506,
"database": 419,
"textmining": 376,
"combined_score": 813
},
{
"protein2": "8022.A0A060VR91",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 594,
"experimental": 362,
"database": 0,
"textmining": 140,
"combined_score": 761
},
{
"protein2": "8022.A0A060WRN7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 745,
"database": 599,
"textmining": 206,
"combined_score": 911
},
{
"protein2": "8022.A0A060XY82",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 745,
"database": 333,
"textmining": 191,
"combined_score": 866
},
{
"protein2": "8022.A0A060Y386",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 745,
"database": 333,
"textmining": 191,
"combined_score": 866
},
{
"protein2": "8022.A0A060XUE1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 414,
"database": 566,
"textmining": 86,
"combined_score": 747
},
{
"protein2": "8022.A0A060VVC5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 747,
"database": 530,
"textmining": 275,
"combined_score": 906
},
{
"protein2": "8022.A0A060WKB0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 576,
"textmining": 75,
"combined_score": 723
},
{
"protein2": "8022.A0A060W7T8",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 239,
"database": 560,
"textmining": 196,
"combined_score": 709
},
{
"protein2": "8022.A0A060ZDS2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 414,
"database": 566,
"textmining": 86,
"combined_score": 747
},
{
"protein2": "8022.A0A061AF65",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 650,
"database": 0,
"textmining": 222,
"combined_score": 716
},
{
"protein2": "8022.A0A060XS17",
"neighborhood": 46,
"fusion": 0,
"cooccurence": 0,
"coexpression": 43,
"experimental": 244,
"database": 830,
"textmining": 42,
"combined_score": 867
},
{
"protein2": "8022.A0A060ZHH3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060ZGE1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 756,
"database": 431,
"textmining": 227,
"combined_score": 883
},
{
"protein2": "8022.A0A060Y3A3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 752,
"experimental": 892,
"database": 639,
"textmining": 406,
"combined_score": 993
},
{
"protein2": "8022.A0A060X691",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 756,
"database": 431,
"textmining": 227,
"combined_score": 883
},
{
"protein2": "8022.A0A060W5Y1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 49,
"coexpression": 0,
"experimental": 0,
"database": 826,
"textmining": 0,
"combined_score": 827
},
{
"protein2": "8022.A0A060XPD8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 537,
"textmining": 158,
"combined_score": 725
},
{
"protein2": "8022.A0A060W7A6",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 523,
"database": 333,
"textmining": 224,
"combined_score": 746
},
{
"protein2": "8022.A0A060XUA5",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 216,
"combined_score": 751
},
{
"protein2": "8022.A0A060XI97",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 749,
"database": 305,
"textmining": 136,
"combined_score": 836
},
{
"protein2": "8022.A0A060VMW3",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 388,
"experimental": 577,
"database": 372,
"textmining": 217,
"combined_score": 857
},
{
"protein2": "8022.A0A060XL60",
"neighborhood": 48,
"fusion": 0,
"cooccurence": 0,
"coexpression": 192,
"experimental": 311,
"database": 430,
"textmining": 182,
"combined_score": 707
},
{
"protein2": "8022.A0A060WI07",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 494,
"textmining": 151,
"combined_score": 821
},
{
"protein2": "8022.A0A061AFA1",
"neighborhood": 157,
"fusion": 0,
"cooccurence": 0,
"coexpression": 619,
"experimental": 274,
"database": 0,
"textmining": 310,
"combined_score": 817
},
{
"protein2": "8022.A0A060Z858",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 681,
"database": 425,
"textmining": 213,
"combined_score": 898
},
{
"protein2": "8022.A0A060XJK9",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 255,
"experimental": 468,
"database": 385,
"textmining": 308,
"combined_score": 811
},
{
"protein2": "8022.A0A060WZC6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 80,
"experimental": 520,
"database": 427,
"textmining": 236,
"combined_score": 780
},
{
"protein2": "8022.A0A061A773",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 121,
"combined_score": 836
},
{
"protein2": "8022.A0A060YQQ2",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 121,
"combined_score": 836
},
{
"protein2": "8022.A0A060VSN0",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 375,
"textmining": 108,
"combined_score": 727
},
{
"protein2": "8022.A0A060Y7A8",
"neighborhood": 53,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 483,
"database": 834,
"textmining": 86,
"combined_score": 915
},
{
"protein2": "8022.A0A060WD16",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 611,
"database": 494,
"textmining": 151,
"combined_score": 821
},
{
"protein2": "8022.A0A060XQ05",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 622,
"database": 573,
"textmining": 233,
"combined_score": 865
},
{
"protein2": "8022.A0A060ZCJ0",
"neighborhood": 47,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 239,
"database": 560,
"textmining": 196,
"combined_score": 709
},
{
"protein2": "8022.A0A060YUG1",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 380,
"database": 398,
"textmining": 131,
"combined_score": 748
},
{
"protein2": "8022.A0A060Z5L0",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060WZP5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 415,
"database": 575,
"textmining": 134,
"combined_score": 771
},
{
"protein2": "8022.A0A060W187",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 68,
"experimental": 743,
"database": 333,
"textmining": 268,
"combined_score": 869
},
{
"protein2": "8022.A0A060ZC75",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 760,
"database": 602,
"textmining": 276,
"combined_score": 924
},
{
"protein2": "8022.A0A060XJW3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 576,
"textmining": 75,
"combined_score": 723
},
{
"protein2": "8022.A0A060Z216",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060WN55",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 317,
"experimental": 768,
"database": 609,
"textmining": 308,
"combined_score": 951
},
{
"protein2": "8022.A0A060XH67",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 650,
"database": 0,
"textmining": 222,
"combined_score": 716
},
{
"protein2": "8022.A0A060VQQ6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 80,
"experimental": 520,
"database": 427,
"textmining": 236,
"combined_score": 780
},
{
"protein2": "8022.A0A060XYL7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 388,
"experimental": 577,
"database": 372,
"textmining": 229,
"combined_score": 860
},
{
"protein2": "8022.A0A060Y4G5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 85,
"coexpression": 184,
"experimental": 231,
"database": 824,
"textmining": 66,
"combined_score": 888
},
{
"protein2": "8022.A0A060YV64",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 227,
"experimental": 611,
"database": 417,
"textmining": 138,
"combined_score": 831
},
{
"protein2": "8022.A0A060XHR4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 475,
"database": 372,
"textmining": 356,
"combined_score": 851
},
{
"protein2": "8022.A0A060XHX0",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 304,
"experimental": 370,
"database": 352,
"textmining": 126,
"combined_score": 723
},
{
"protein2": "8022.A0A060X2P2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 80,
"experimental": 520,
"database": 652,
"textmining": 308,
"combined_score": 879
},
{
"protein2": "8022.A0A060YDW9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 654,
"textmining": 153,
"combined_score": 819
},
{
"protein2": "8022.A0A060XTQ9",
"neighborhood": 57,
"fusion": 0,
"cooccurence": 0,
"coexpression": 128,
"experimental": 745,
"database": 333,
"textmining": 191,
"combined_score": 866
},
{
"protein2": "8022.A0A060X382",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 372,
"experimental": 556,
"database": 404,
"textmining": 121,
"combined_score": 836
},
{
"protein2": "8022.A0A060W9T8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 155,
"database": 816,
"textmining": 119,
"combined_score": 851
},
{
"protein2": "8022.A0A060WI90",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 538,
"database": 434,
"textmining": 186,
"combined_score": 768
},
{
"protein2": "8022.A0A060X462",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 71,
"experimental": 749,
"database": 431,
"textmining": 228,
"combined_score": 883
},
{
"protein2": "8022.A0A060Z793",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 188,
"database": 770,
"textmining": 262,
"combined_score": 852
},
{
"protein2": "8022.A0A060YFT4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 137,
"experimental": 338,
"database": 608,
"textmining": 160,
"combined_score": 786
}
] |
A0A060XV60
|
Nitric oxide synthase (EC 1.14.13.39)
|
Produces nitric oxide (NO) which is a messenger molecule with diverse functions. {ECO:0000256|PIRNR:PIRNR000333}.
|
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 1,083
|
Cytoplasm, cytosol {ECO:0000256|ARBA:ARBA00004514}.
|
MKLLQDDETKLSHQTKPNKWETRANRCPFSIPVRNVKDGSSLKDMLHHQAVKNQPCTSKVCEGSVMTPKALLRGPKVSTLEILPQAIDLINQYYKSFKIPKIEHHLARLEEITMEIDSTGTYQLTVEELAFGARQAWRNAPRCIGRIQWSNLQLFDARKCKTTQEMFQFLCEHLQFATNGGNLRSAITVFPPRKEDGHDFRVWNSQLLKYAGYQMPDGSIQGDPSSVEFTKICIQLGWKPQYGLFDVLPLVLQVNGEDPDLYEIPPHLILEVSMEHPQHKWFQDLGLKWYALPAVSNMLMEIGGLEFPACPFNGWYMGTEIGVRDFCDYQRYNILEEVGRRMGLETHKLSSLWKDQALVTINVAVIYSFQKNKVTITDHHSAAESFMKHLETEFRLRGGCPADWAWLVPPMSGSLTPIFHQEMVNYILSPFFYYQPDPWMTHVWRNGEMCLKKQQISFKAVARAALFSSTLMSRVLAKRVRCTVLYATETGKSQTLAQRLNSMLNGAFNSRLLCMEDYNFSDMEQESLLVVVTSTFGNGDSPGNGESFKKQLFSLQYLRNKLRYCVFGLGSRMYPQFCAFAHAVDAKLEELGAERVTPTGEGDELNGQEEAFSAWALTALKDAYKEFKIQGQLSLQLPGAERFCEAWDPLRHRVAVESCPQDRITALSAIHSKTVFPMKLKSKHNLQSPHSSRSTILVELERERSAEVMNFAPGDHVGVFPGNLPQLVAGILKFLPHTPPTNQCLRLEYRSDTCRDDEKNWQTVGRIPACPLSQALTYFLDVTTPPSQNLLHKLSQLAKQEGHRQRLLTLAKDSQEYTTWKMFRVPNFLEVLEEFPSLELSAAFLLSQLPLLKPRLYSISSSPQLHPNELHLTLTVLNYHTQDGQGPLHHGVCSTWLDTIKKGDLVPCFIYSSGGFHLPAEPSTPVILVGAGSGIAPFRSFWQQRLHDMKHPEFSESPMSLVFGCQSSETDHLYKEETLEMRRRGVLKSVTNAYSRQPGLPKVYVQDVLRERMAEEVLSVLHQKEGHFYVCGGVNMAQGVTLAVQEILSSQLGITLTQAGEYLTQLKIQKRYHEDIFGAQFQK
|
[
"GO:0006952",
"GO:0009605",
"GO:0050896",
"GO:0051707",
"GO:0009607",
"GO:0042742",
"GO:0009617",
"GO:0006950",
"GO:0050829",
"GO:0098542",
"GO:0008150",
"GO:0044419",
"GO:0043207",
"GO:0016709",
"GO:0003674",
"GO:0004497",
"GO:0016705",
"GO:0003824",
"GO:0004517",
"GO:0016491"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0044419",
"GO:0009605",
"GO:0051707",
"GO:0009607",
"GO:0006950",
"GO:0006952",
"GO:0009617",
"GO:0098542",
"GO:0043207",
"GO:0042742",
"GO:0050829"
] |
[
"GO:0003674",
"GO:0003824",
"GO:0016491",
"GO:0004497",
"GO:0016705",
"GO:0016709",
"GO:0004517"
] | null |
[
"IPR003097",
"IPR017927",
"IPR001094",
"IPR008254",
"IPR001709",
"IPR029039",
"IPR039261",
"IPR023173",
"IPR050607",
"IPR044943",
"IPR044940",
"IPR044944",
"IPR012144",
"IPR004030",
"IPR036119",
"IPR001433",
"IPR017938"
] |
af_db/AF-A0A060XV60-F1-model_v4.cif.gz
|
8022.A0A060XV60
|
[
"8022.A0A060YPW7",
"8022.A0A060Z493",
"8022.A0A060VUH5",
"8022.A0A060VY42",
"8022.A0A060X0R0",
"8022.A0A060ZIY0",
"8022.A0A060X8W2",
"8022.A0A060Y668",
"8022.A0A060WT46",
"8022.A0A060XNB3",
"8022.A0A060YQL0",
"8022.A0A060WME3",
"8022.A0A060X1K0",
"8022.A0A060WMY9",
"8022.A0A060XQR2",
"8022.A0A060Y2D4",
"8022.A0A060YDZ6",
"8022.A0A060XTQ8",
"8022.A0A060YCJ5",
"8022.A0A060WAP3",
"8022.A0A060XX32",
"8022.A0A060XFL1",
"8022.A0A060W734",
"8022.A0A060XPW0",
"8022.A0A060YSI8",
"8022.A0A060XRH3",
"8022.A0A060X0X9",
"8022.A0A060Y6B4",
"8022.C1BFS0",
"8022.A0A060W0G4",
"8022.A0A060YQ30",
"8022.A0A060WPB0",
"8022.A0A060XHA1",
"8022.A0A060YV61",
"8022.A0A060WRK3",
"8022.A0A060XT26",
"8022.A0A060XBQ4",
"8022.A0A060X2Y0",
"8022.A0A060WZJ2",
"8022.A0A060WNA1",
"8022.A0A060ZHH7",
"8022.A0A060X7E4",
"8022.A0A060VM68",
"8022.A0A060YT33",
"8022.A0A060WIX3",
"8022.A0A061ADX4",
"8022.A0A060Y0G1",
"8022.A0A060YRP0",
"8022.A0A060WDB5",
"8022.A0A060VPQ2",
"8022.A0A060Z8E9",
"8022.A0A060XPD1",
"8022.A0A060ZEH8",
"8022.A0A060X1J3",
"8022.A0A060WPC7",
"8022.A0A060YT17",
"8022.A0A060WUS8",
"8022.A0A060WNH4",
"8022.A0A060X1G8",
"8022.A0A060X1N4",
"8022.A0A060VTH2",
"8022.A0A060XBJ4",
"8022.A0A060Z7B1",
"8022.A0A060XR67",
"8022.A0A060W1U9",
"8022.A0A060YSJ4",
"8022.A0A060WC75",
"8022.A0A060VXP1",
"8022.A0A060WCQ1",
"8022.A0A060X2J6",
"8022.A0A060YGK5",
"8022.A0A060XYR9",
"8022.A0A060XNC5",
"8022.A0A060YDR5",
"8022.A0A060WGM4",
"8022.A0A060YC89",
"8022.A0A060Y842",
"8022.A0A060Y8F7",
"8022.A0A060XF24",
"8022.A0A060W049",
"8022.A0A060W3W8",
"8022.A0A060XCT2",
"8022.A0A060WFL5",
"8022.A0A061A6B0",
"8022.A0A060VW47",
"8022.I7KJN7",
"8022.A0A060YAG9",
"8022.A0A060W162",
"8022.A0A060YWN2",
"8022.A0A060YXU2",
"8022.A0A060XYX3",
"8022.A0A060YB73",
"8022.A0A060WA19",
"8022.A0A060X3G7",
"8022.A0A060YX93",
"8022.A0A060W596",
"8022.A0A060XMQ9",
"8022.A0A060W2E5",
"8022.A0A060WC73",
"8022.A0A060YMX6",
"8022.A0A060WKC5",
"8022.A0A060XBU7",
"8022.A0A060YBL7",
"8022.A0A060Y4G5",
"8022.A0A060X194",
"8022.A0A060YDW9",
"8022.A0A060W9T8",
"8022.A0A060Z793",
"8022.A0A060WNQ7",
"8022.A0A060WAD8",
"8022.A0A060WCU7",
"8022.A0A060W7T8",
"8022.A0A060ZA76",
"8022.A0A060W5Y1",
"8022.A0A060VY35",
"8022.A0A060YGU6",
"8022.A0A060YS39",
"8022.A0A060ZCJ0",
"8022.A0A060WPM5",
"8022.A0A060WGA5",
"8022.A0A060YC57",
"8022.A0A060X0I3",
"8022.A0A060YJY5",
"8022.A0A060YD44",
"8022.A0A060WNP6",
"8022.A0A060YCE9",
"8022.A0A060WRK6",
"8022.A0A060W4D0",
"8022.A0A060XEY0",
"8022.A0A060WHF9",
"8022.A0A060WYW2",
"8022.A0A060Z057",
"8022.A0A060XLH8",
"8022.A0A060Y0K9",
"8022.A0A060Y5V9",
"8022.A0A060WT77",
"8022.A0A060VUY8",
"8022.A0A060XE59",
"8022.A0A060W893",
"8022.A0A060ZDN1",
"8022.A0A060YI86",
"8022.A0A060WU49",
"8022.A0A060Y7X2",
"8022.A0A060WWK9",
"8022.A0A060W698",
"8022.A0A060WVU0",
"8022.A0A060YIJ4",
"8022.A0A060XFW6",
"8022.A0A060YFN8",
"8022.A0A060W713",
"8022.A0A060WVX9",
"8022.A0A060XT19",
"8022.A0A060WHS3",
"8022.A0A060VMH2",
"8022.A0A060WHE5",
"8022.A0A060XIU8",
"8022.A0A060YH41"
] |
[
{
"protein2": "8022.A0A060YPW7",
"neighborhood": 154,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 0,
"database": 0,
"textmining": 230,
"combined_score": 737
},
{
"protein2": "8022.A0A060Z493",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 266,
"database": 833,
"textmining": 410,
"combined_score": 921
},
{
"protein2": "8022.A0A060VUH5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 916,
"textmining": 378,
"combined_score": 945
},
{
"protein2": "8022.A0A060VY42",
"neighborhood": 46,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 82,
"database": 602,
"textmining": 265,
"combined_score": 709
},
{
"protein2": "8022.A0A060X0R0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 178,
"database": 824,
"textmining": 186,
"combined_score": 871
},
{
"protein2": "8022.A0A060ZIY0",
"neighborhood": 43,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 680,
"database": 554,
"textmining": 219,
"combined_score": 890
},
{
"protein2": "8022.A0A060X8W2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 816,
"textmining": 87,
"combined_score": 883
},
{
"protein2": "8022.A0A060Y668",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 455,
"database": 782,
"textmining": 259,
"combined_score": 904
},
{
"protein2": "8022.A0A060WT46",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 816,
"textmining": 87,
"combined_score": 883
},
{
"protein2": "8022.A0A060XNB3",
"neighborhood": 116,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 325,
"database": 585,
"textmining": 261,
"combined_score": 813
},
{
"protein2": "8022.A0A060YQL0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 703,
"textmining": 77,
"combined_score": 714
},
{
"protein2": "8022.A0A060WME3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 812,
"textmining": 87,
"combined_score": 880
},
{
"protein2": "8022.A0A060X1K0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 66,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 0,
"combined_score": 831
},
{
"protein2": "8022.A0A060WMY9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 379,
"database": 568,
"textmining": 89,
"combined_score": 734
},
{
"protein2": "8022.A0A060XQR2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 703,
"textmining": 109,
"combined_score": 724
},
{
"protein2": "8022.A0A060Y2D4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 324,
"database": 835,
"textmining": 112,
"combined_score": 892
},
{
"protein2": "8022.A0A060YDZ6",
"neighborhood": 116,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 325,
"database": 585,
"textmining": 261,
"combined_score": 813
},
{
"protein2": "8022.A0A060XTQ8",
"neighborhood": 43,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 680,
"database": 554,
"textmining": 219,
"combined_score": 890
},
{
"protein2": "8022.A0A060YCJ5",
"neighborhood": 43,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 680,
"database": 554,
"textmining": 219,
"combined_score": 890
},
{
"protein2": "8022.A0A060WAP3",
"neighborhood": 49,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 153,
"database": 654,
"textmining": 86,
"combined_score": 711
},
{
"protein2": "8022.A0A060XX32",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 654,
"textmining": 153,
"combined_score": 819
},
{
"protein2": "8022.A0A060XFL1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 157,
"database": 721,
"textmining": 64,
"combined_score": 762
},
{
"protein2": "8022.A0A060W734",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 429,
"textmining": 308,
"combined_score": 894
},
{
"protein2": "8022.A0A060XPW0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 654,
"textmining": 153,
"combined_score": 819
},
{
"protein2": "8022.A0A060YSI8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 172,
"database": 835,
"textmining": 308,
"combined_score": 897
},
{
"protein2": "8022.A0A060XRH3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 54,
"database": 828,
"textmining": 64,
"combined_score": 835
},
{
"protein2": "8022.A0A060X0X9",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 385,
"experimental": 0,
"database": 650,
"textmining": 230,
"combined_score": 840
},
{
"protein2": "8022.A0A060Y6B4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 157,
"database": 721,
"textmining": 64,
"combined_score": 762
},
{
"protein2": "8022.C1BFS0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 705,
"database": 0,
"textmining": 105,
"combined_score": 724
},
{
"protein2": "8022.A0A060W0G4",
"neighborhood": 46,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 749
},
{
"protein2": "8022.A0A060YQ30",
"neighborhood": 49,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 153,
"database": 654,
"textmining": 86,
"combined_score": 711
},
{
"protein2": "8022.A0A060WPB0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 379,
"database": 568,
"textmining": 89,
"combined_score": 734
},
{
"protein2": "8022.A0A060XHA1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 266,
"database": 833,
"textmining": 410,
"combined_score": 921
},
{
"protein2": "8022.A0A060YV61",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 157,
"database": 721,
"textmining": 64,
"combined_score": 762
},
{
"protein2": "8022.A0A060WRK3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 379,
"database": 568,
"textmining": 89,
"combined_score": 734
},
{
"protein2": "8022.A0A060XT26",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 754,
"database": 429,
"textmining": 308,
"combined_score": 894
},
{
"protein2": "8022.A0A060XBQ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 167,
"database": 721,
"textmining": 130,
"combined_score": 780
},
{
"protein2": "8022.A0A060X2Y0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 826,
"textmining": 87,
"combined_score": 889
},
{
"protein2": "8022.A0A060WZJ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 482,
"database": 772,
"textmining": 114,
"combined_score": 886
},
{
"protein2": "8022.A0A060WNA1",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 721,
"textmining": 159,
"combined_score": 759
},
{
"protein2": "8022.A0A060ZHH7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 836,
"textmining": 311,
"combined_score": 919
},
{
"protein2": "8022.A0A060X7E4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 836,
"textmining": 311,
"combined_score": 919
},
{
"protein2": "8022.A0A060VM68",
"neighborhood": 48,
"fusion": 0,
"cooccurence": 0,
"coexpression": 48,
"experimental": 187,
"database": 527,
"textmining": 275,
"combined_score": 701
},
{
"protein2": "8022.A0A060YT33",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 338,
"database": 760,
"textmining": 158,
"combined_score": 854
},
{
"protein2": "8022.A0A060WIX3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 482,
"database": 772,
"textmining": 114,
"combined_score": 886
},
{
"protein2": "8022.A0A061ADX4",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 172,
"database": 835,
"textmining": 86,
"combined_score": 866
},
{
"protein2": "8022.A0A060Y0G1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 482,
"database": 772,
"textmining": 114,
"combined_score": 886
},
{
"protein2": "8022.A0A060YRP0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 835,
"textmining": 200,
"combined_score": 862
},
{
"protein2": "8022.A0A060WDB5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 826,
"textmining": 87,
"combined_score": 889
},
{
"protein2": "8022.A0A060VPQ2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 812,
"textmining": 87,
"combined_score": 880
},
{
"protein2": "8022.A0A060Z8E9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 266,
"database": 833,
"textmining": 410,
"combined_score": 921
},
{
"protein2": "8022.A0A060XPD1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 482,
"database": 772,
"textmining": 114,
"combined_score": 886
},
{
"protein2": "8022.A0A060ZEH8",
"neighborhood": 154,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 0,
"database": 0,
"textmining": 230,
"combined_score": 737
},
{
"protein2": "8022.A0A060X1J3",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 385,
"experimental": 0,
"database": 650,
"textmining": 230,
"combined_score": 840
},
{
"protein2": "8022.A0A060WPC7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 307,
"database": 785,
"textmining": 183,
"combined_score": 867
},
{
"protein2": "8022.A0A060YT17",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 379,
"database": 568,
"textmining": 89,
"combined_score": 734
},
{
"protein2": "8022.A0A060WUS8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 760,
"textmining": 86,
"combined_score": 775
},
{
"protein2": "8022.A0A060WNH4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 812,
"textmining": 87,
"combined_score": 880
},
{
"protein2": "8022.A0A060X1G8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 155,
"database": 712,
"textmining": 64,
"combined_score": 754
},
{
"protein2": "8022.A0A060X1N4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 324,
"database": 834,
"textmining": 390,
"combined_score": 925
},
{
"protein2": "8022.A0A060VTH2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 836,
"textmining": 311,
"combined_score": 919
},
{
"protein2": "8022.A0A060XBJ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 338,
"database": 824,
"textmining": 213,
"combined_score": 900
},
{
"protein2": "8022.A0A060Z7B1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 816,
"textmining": 87,
"combined_score": 883
},
{
"protein2": "8022.A0A060XR67",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 721,
"textmining": 86,
"combined_score": 815
},
{
"protein2": "8022.A0A060W1U9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 338,
"database": 760,
"textmining": 158,
"combined_score": 854
},
{
"protein2": "8022.A0A060YSJ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 482,
"database": 772,
"textmining": 114,
"combined_score": 886
},
{
"protein2": "8022.A0A060WC75",
"neighborhood": 46,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 82,
"database": 602,
"textmining": 265,
"combined_score": 709
},
{
"protein2": "8022.A0A060VXP1",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 721,
"textmining": 159,
"combined_score": 759
},
{
"protein2": "8022.A0A060WCQ1",
"neighborhood": 107,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 0,
"database": 736,
"textmining": 308,
"combined_score": 827
},
{
"protein2": "8022.A0A060X2J6",
"neighborhood": 55,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 44,
"database": 830,
"textmining": 140,
"combined_score": 850
},
{
"protein2": "8022.A0A060YGK5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 836,
"textmining": 311,
"combined_score": 919
},
{
"protein2": "8022.A0A060XYR9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 352,
"database": 715,
"textmining": 366,
"combined_score": 872
},
{
"protein2": "8022.A0A060XNC5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 178,
"database": 824,
"textmining": 186,
"combined_score": 871
},
{
"protein2": "8022.A0A060YDR5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 338,
"database": 824,
"textmining": 86,
"combined_score": 884
},
{
"protein2": "8022.A0A060WGM4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 379,
"database": 568,
"textmining": 89,
"combined_score": 734
},
{
"protein2": "8022.A0A060YC89",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 721,
"textmining": 159,
"combined_score": 759
},
{
"protein2": "8022.A0A060Y842",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 816,
"textmining": 87,
"combined_score": 883
},
{
"protein2": "8022.A0A060Y8F7",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 721,
"textmining": 159,
"combined_score": 759
},
{
"protein2": "8022.A0A060XF24",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 760,
"textmining": 86,
"combined_score": 775
},
{
"protein2": "8022.A0A060W049",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 157,
"database": 721,
"textmining": 64,
"combined_score": 762
},
{
"protein2": "8022.A0A060W3W8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 654,
"textmining": 153,
"combined_score": 819
},
{
"protein2": "8022.A0A060XCT2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 70,
"experimental": 0,
"database": 835,
"textmining": 375,
"combined_score": 895
},
{
"protein2": "8022.A0A060WFL5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 812,
"textmining": 87,
"combined_score": 880
},
{
"protein2": "8022.A0A061A6B0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 155,
"database": 712,
"textmining": 64,
"combined_score": 754
},
{
"protein2": "8022.A0A060VW47",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 654,
"textmining": 153,
"combined_score": 819
},
{
"protein2": "8022.I7KJN7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 172,
"database": 830,
"textmining": 308,
"combined_score": 894
},
{
"protein2": "8022.A0A060YAG9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 167,
"database": 721,
"textmining": 130,
"combined_score": 780
},
{
"protein2": "8022.A0A060W162",
"neighborhood": 154,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 0,
"database": 0,
"textmining": 230,
"combined_score": 737
},
{
"protein2": "8022.A0A060YWN2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 155,
"database": 712,
"textmining": 64,
"combined_score": 754
},
{
"protein2": "8022.A0A060YXU2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 826,
"textmining": 87,
"combined_score": 889
},
{
"protein2": "8022.A0A060XYX3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 338,
"database": 824,
"textmining": 86,
"combined_score": 884
},
{
"protein2": "8022.A0A060YB73",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 816,
"textmining": 87,
"combined_score": 883
},
{
"protein2": "8022.A0A060WA19",
"neighborhood": 154,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 0,
"database": 0,
"textmining": 230,
"combined_score": 737
},
{
"protein2": "8022.A0A060X3G7",
"neighborhood": 48,
"fusion": 0,
"cooccurence": 0,
"coexpression": 48,
"experimental": 187,
"database": 527,
"textmining": 275,
"combined_score": 701
},
{
"protein2": "8022.A0A060YX93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 760,
"textmining": 86,
"combined_score": 775
},
{
"protein2": "8022.A0A060W596",
"neighborhood": 48,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 0,
"database": 816,
"textmining": 108,
"combined_score": 834
},
{
"protein2": "8022.A0A060XMQ9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 721,
"textmining": 86,
"combined_score": 815
},
{
"protein2": "8022.A0A060W2E5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 157,
"database": 721,
"textmining": 64,
"combined_score": 762
},
{
"protein2": "8022.A0A060WC73",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 836,
"textmining": 311,
"combined_score": 919
},
{
"protein2": "8022.A0A060YMX6",
"neighborhood": 116,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 325,
"database": 585,
"textmining": 261,
"combined_score": 813
},
{
"protein2": "8022.A0A060WKC5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 157,
"database": 721,
"textmining": 64,
"combined_score": 762
},
{
"protein2": "8022.A0A060XBU7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 172,
"database": 830,
"textmining": 308,
"combined_score": 894
},
{
"protein2": "8022.A0A060YBL7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 703,
"textmining": 60,
"combined_score": 708
},
{
"protein2": "8022.A0A060Y4G5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 721,
"textmining": 86,
"combined_score": 815
},
{
"protein2": "8022.A0A060X194",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 385,
"experimental": 0,
"database": 650,
"textmining": 230,
"combined_score": 840
},
{
"protein2": "8022.A0A060YDW9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 55,
"coexpression": 0,
"experimental": 0,
"database": 827,
"textmining": 0,
"combined_score": 829
},
{
"protein2": "8022.A0A060W9T8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 338,
"database": 824,
"textmining": 213,
"combined_score": 900
},
{
"protein2": "8022.A0A060Z793",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 455,
"database": 782,
"textmining": 259,
"combined_score": 904
},
{
"protein2": "8022.A0A060WNQ7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 703,
"textmining": 44,
"combined_score": 703
},
{
"protein2": "8022.A0A060WAD8",
"neighborhood": 49,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 153,
"database": 654,
"textmining": 86,
"combined_score": 711
},
{
"protein2": "8022.A0A060WCU7",
"neighborhood": 46,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 835,
"textmining": 333,
"combined_score": 885
},
{
"protein2": "8022.A0A060W7T8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 482,
"database": 772,
"textmining": 114,
"combined_score": 886
},
{
"protein2": "8022.A0A060ZA76",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 836,
"textmining": 311,
"combined_score": 919
},
{
"protein2": "8022.A0A060W5Y1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 654,
"textmining": 153,
"combined_score": 819
},
{
"protein2": "8022.A0A060VY35",
"neighborhood": 107,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 0,
"database": 736,
"textmining": 308,
"combined_score": 827
},
{
"protein2": "8022.A0A060YGU6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 344,
"database": 836,
"textmining": 311,
"combined_score": 919
},
{
"protein2": "8022.A0A060YS39",
"neighborhood": 49,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 153,
"database": 654,
"textmining": 86,
"combined_score": 711
},
{
"protein2": "8022.A0A060ZCJ0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 482,
"database": 569,
"textmining": 114,
"combined_score": 784
},
{
"protein2": "8022.A0A060WPM5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 379,
"database": 568,
"textmining": 89,
"combined_score": 734
},
{
"protein2": "8022.A0A060WGA5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 455,
"database": 782,
"textmining": 259,
"combined_score": 904
},
{
"protein2": "8022.A0A060YC57",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 324,
"database": 829,
"textmining": 401,
"combined_score": 924
},
{
"protein2": "8022.A0A060X0I3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 721,
"textmining": 86,
"combined_score": 815
},
{
"protein2": "8022.A0A060YJY5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 155,
"database": 712,
"textmining": 64,
"combined_score": 754
},
{
"protein2": "8022.A0A060YD44",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 157,
"database": 721,
"textmining": 64,
"combined_score": 762
},
{
"protein2": "8022.A0A060WNP6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 705,
"database": 0,
"textmining": 105,
"combined_score": 724
},
{
"protein2": "8022.A0A060YCE9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 816,
"textmining": 87,
"combined_score": 883
},
{
"protein2": "8022.A0A060WRK6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 307,
"database": 785,
"textmining": 183,
"combined_score": 867
},
{
"protein2": "8022.A0A060W4D0",
"neighborhood": 48,
"fusion": 0,
"cooccurence": 0,
"coexpression": 48,
"experimental": 187,
"database": 527,
"textmining": 275,
"combined_score": 701
},
{
"protein2": "8022.A0A060XEY0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 157,
"database": 721,
"textmining": 64,
"combined_score": 762
},
{
"protein2": "8022.A0A060WHF9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 307,
"database": 785,
"textmining": 183,
"combined_score": 867
},
{
"protein2": "8022.A0A060WYW2",
"neighborhood": 42,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 787,
"textmining": 231,
"combined_score": 829
},
{
"protein2": "8022.A0A060Z057",
"neighborhood": 153,
"fusion": 0,
"cooccurence": 0,
"coexpression": 385,
"experimental": 0,
"database": 650,
"textmining": 230,
"combined_score": 840
},
{
"protein2": "8022.A0A060XLH8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 482,
"database": 569,
"textmining": 114,
"combined_score": 784
},
{
"protein2": "8022.A0A060Y0K9",
"neighborhood": 43,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 680,
"database": 554,
"textmining": 219,
"combined_score": 890
},
{
"protein2": "8022.A0A060Y5V9",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 614,
"experimental": 0,
"database": 679,
"textmining": 308,
"combined_score": 918
},
{
"protein2": "8022.A0A060WT77",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 721,
"textmining": 86,
"combined_score": 815
},
{
"protein2": "8022.A0A060VUY8",
"neighborhood": 43,
"fusion": 0,
"cooccurence": 0,
"coexpression": 129,
"experimental": 680,
"database": 554,
"textmining": 219,
"combined_score": 890
},
{
"protein2": "8022.A0A060XE59",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 157,
"database": 721,
"textmining": 64,
"combined_score": 762
},
{
"protein2": "8022.A0A060W893",
"neighborhood": 46,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 736,
"textmining": 86,
"combined_score": 749
},
{
"protein2": "8022.A0A060ZDN1",
"neighborhood": 49,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 153,
"database": 654,
"textmining": 86,
"combined_score": 711
},
{
"protein2": "8022.A0A060YI86",
"neighborhood": 159,
"fusion": 0,
"cooccurence": 0,
"coexpression": 614,
"experimental": 0,
"database": 679,
"textmining": 308,
"combined_score": 918
},
{
"protein2": "8022.A0A060WU49",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 812,
"textmining": 87,
"combined_score": 880
},
{
"protein2": "8022.A0A060Y7X2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 482,
"database": 772,
"textmining": 114,
"combined_score": 886
},
{
"protein2": "8022.A0A060WWK9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 812,
"textmining": 87,
"combined_score": 880
},
{
"protein2": "8022.A0A060W698",
"neighborhood": 46,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 82,
"database": 602,
"textmining": 265,
"combined_score": 709
},
{
"protein2": "8022.A0A060WVU0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 482,
"database": 772,
"textmining": 114,
"combined_score": 886
},
{
"protein2": "8022.A0A060YIJ4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 360,
"database": 826,
"textmining": 87,
"combined_score": 889
},
{
"protein2": "8022.A0A060XFW6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 433,
"database": 654,
"textmining": 153,
"combined_score": 819
},
{
"protein2": "8022.A0A060YFN8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 266,
"database": 833,
"textmining": 410,
"combined_score": 921
},
{
"protein2": "8022.A0A060W713",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 705,
"database": 0,
"textmining": 105,
"combined_score": 724
},
{
"protein2": "8022.A0A060WVX9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 157,
"database": 721,
"textmining": 64,
"combined_score": 762
},
{
"protein2": "8022.A0A060XT19",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 482,
"database": 772,
"textmining": 114,
"combined_score": 886
},
{
"protein2": "8022.A0A060WHS3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 167,
"database": 721,
"textmining": 130,
"combined_score": 780
},
{
"protein2": "8022.A0A060VMH2",
"neighborhood": 56,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 721,
"textmining": 159,
"combined_score": 759
},
{
"protein2": "8022.A0A060WHE5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 155,
"database": 712,
"textmining": 64,
"combined_score": 754
},
{
"protein2": "8022.A0A060XIU8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 0,
"database": 760,
"textmining": 86,
"combined_score": 775
},
{
"protein2": "8022.A0A060YH41",
"neighborhood": 49,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 153,
"database": 654,
"textmining": 86,
"combined_score": 711
}
] |
A0A060Z0U0
|
Interleukin-1
| null |
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
| 254
|
Cytoplasm, cytosol {ECO:0000256|ARBA:ARBA00004514}. Lysosome {ECO:0000256|ARBA:ARBA00004371}. Secreted, extracellular exosome {ECO:0000256|ARBA:ARBA00004550}.
|
MEFESNCSLMKNTSASVAWSSKLPQGLDVEISHHPITLRCVANLIIAMERLNGGKGFTLGRDEGLLNFLLESAVEVLELESARTEASSRAAFSSKGEYECSVTDSENKCWVLNEGSMELHAIMLQGGSSYHKVHLNLSTYITPVPSETKARPVALGIKGSNLYLSCITSEGTPTLHLEEVADKEQLKSINHESDMVRFLFYKQDTGVDISTLESAHYRNWFISTALQQDNTKMVNMCQRATLNRNTTFTVQRHN
|
[
"GO:0009893",
"GO:0060255",
"GO:0065007",
"GO:0010628",
"GO:0048518",
"GO:0008150",
"GO:0010604",
"GO:0050789",
"GO:0019222",
"GO:0048519",
"GO:0010605",
"GO:0010629",
"GO:0010468",
"GO:0009892"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0048518",
"GO:0050789",
"GO:0048519",
"GO:0009893",
"GO:0019222",
"GO:0009892",
"GO:0060255",
"GO:0010604",
"GO:0010605",
"GO:0010628",
"GO:0010629",
"GO:0010468"
] | null | null |
[
"IPR000975",
"IPR008996"
] |
af_db/AF-A0A060Z0U0-F1-model_v4.cif.gz
|
8022.A0A060Z0U0
|
[
"8022.A0A060WX21",
"8022.A0A060WI11",
"8022.A0A060YC27",
"8022.A0A060YIW1",
"8022.A0A060YA72",
"8022.A0A060YP34",
"8022.A0A060YX71",
"8022.A0A060YA09",
"8022.A0A060YKJ1",
"8022.A0A060WYC1",
"8022.A0A060VXI5",
"8022.W1I939",
"8022.A0A060VVP8",
"8022.A0A060XA82",
"8022.A0A060ZXZ7",
"8022.A0A060YU62",
"8022.A0A060XQB8",
"8022.A0A060Z1N9",
"8022.A0A060YXU1",
"8022.A0A060XMN7",
"8022.A0A060XPX7",
"8022.A0A060YRF1",
"8022.A0A060XUA7",
"8022.A0A060Z4Q6",
"8022.A0A060WMR1",
"8022.A0A060X3S2",
"8022.A0A060X035",
"8022.A0A060YIA4",
"8022.A0A060YTR0",
"8022.A0A060YCT9",
"8022.A0A060YF61",
"8022.A0A060WBT7",
"8022.Q8QFQ0",
"8022.A0A060XD94",
"8022.A0A060XFH8",
"8022.C1BEY3",
"8022.A0A060Y043",
"8022.A0A060X063",
"8022.A0A060XGI5",
"8022.A0A060VZ13",
"8022.A0A060WGW1",
"8022.A0A060Z3R0",
"8022.A0A060ZDV9",
"8022.A0A060XZ47",
"8022.A0A060X8T7",
"8022.A0A060X8C6",
"8022.A0A060VNB2",
"8022.A0A060YV84",
"8022.A0A060WTK5",
"8022.A0A060Y8G1",
"8022.A0A060Z6D6",
"8022.A0A060Z6R5",
"8022.A0A060YHN1",
"8022.A0A060WD93",
"8022.A0A060XHF7",
"8022.A0A061AEF4",
"8022.A0A060ZGH4",
"8022.A0A060XF80",
"8022.A0A061ACZ0",
"8022.A0A060XAE5",
"8022.A0A060YTI8",
"8022.A0A060W114",
"8022.A0A060VZJ8",
"8022.A0A060W995",
"8022.A0A060WD54",
"8022.A0A060WU24",
"8022.A0A060YVB1",
"8022.A0A060X986",
"8022.A0A060WL45",
"8022.A0A060Y6M5",
"8022.A0A060YFH5",
"8022.A0A060X3H8",
"8022.A0A060XIE4",
"8022.A0A060W3D8",
"8022.A0A060VUM0",
"8022.A0A060XTS9",
"8022.A0A060Z424",
"8022.A0A060W518",
"8022.A0A060YRT0",
"8022.A0A060XMR6",
"8022.A0A060YUC8",
"8022.A0A060VVA1",
"8022.A0A060YIQ8",
"8022.A0A060W037",
"8022.Q1G669",
"8022.A0A060WUH7",
"8022.A0A060YG76",
"8022.A0A060Y952",
"8022.A0A060WC91",
"8022.A0A061A315",
"8022.A0A060X3D3",
"8022.A0A060XFJ7",
"8022.A0A060XPX2",
"8022.A0A060WRJ1",
"8022.A0A060W2H2",
"8022.A0A060ZEP6",
"8022.A0A060WH57",
"8022.A0A060XQ00",
"8022.A0A060XR03",
"8022.A0A060Y7T2",
"8022.A0A060W128",
"8022.A0A060WVY3",
"8022.A0A060YUZ8",
"8022.A0A060WT74",
"8022.A0A060Z7Q9",
"8022.A0A060YYT8",
"8022.A0A060XA36",
"8022.C1BI02",
"8022.A0A060VTL5",
"8022.A0A060W4P9",
"8022.A0A060XXD6",
"8022.A0A060WA83",
"8022.A0A060VT18",
"8022.A0A060W2M3",
"8022.A0A060WSV1",
"8022.A0A060XB50",
"8022.A0A060X9U8",
"8022.A0A060Z1J2",
"8022.A0A060XLZ6",
"8022.A0A060W766",
"8022.A0A060WMZ6",
"8022.A0A060ZZG4",
"8022.A0A060XKG4",
"8022.A0A060YGA1",
"8022.A0A060XG27",
"8022.A0A060XIZ5",
"8022.A0A060YBG9",
"8022.A0A060YSX0",
"8022.A0A060VYB4",
"8022.A0A060XW82",
"8022.A0A060XVY3",
"8022.W0TYL2",
"8022.A0A060WQB0",
"8022.A0A060X1J2",
"8022.A0A060X7P8",
"8022.A0A060Z4I6",
"8022.A0A060W2H8",
"8022.A0A060WPH7",
"8022.A0A060YNP8",
"8022.A0A060XPJ8",
"8022.A0A060X8V7",
"8022.A0A060YQ81",
"8022.A0A060W820",
"8022.A0A060VNW8",
"8022.A0A060VY72",
"8022.A0A060WJ39",
"8022.A0A060X285",
"8022.A0A060Y084",
"8022.A0A060XRW9",
"8022.A0A060W9P9",
"8022.A0A060YKY4",
"8022.A0A060WPR8",
"8022.A0A060YHB3",
"8022.A0A060WBI2",
"8022.A0A060Y558",
"8022.A0A060YAX3"
] |
[
{
"protein2": "8022.A0A060WX21",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 140,
"experimental": 535,
"database": 824,
"textmining": 440,
"combined_score": 955
},
{
"protein2": "8022.A0A060WI11",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 236,
"combined_score": 726
},
{
"protein2": "8022.A0A060YC27",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 826,
"textmining": 367,
"combined_score": 896
},
{
"protein2": "8022.A0A060YIW1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 137,
"experimental": 53,
"database": 699,
"textmining": 505,
"combined_score": 861
},
{
"protein2": "8022.A0A060YA72",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 333,
"database": 507,
"textmining": 332,
"combined_score": 767
},
{
"protein2": "8022.A0A060YP34",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 853,
"database": 910,
"textmining": 450,
"combined_score": 992
},
{
"protein2": "8022.A0A060YX71",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 273,
"database": 650,
"textmining": 46,
"combined_score": 740
},
{
"protein2": "8022.A0A060YA09",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060YKJ1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060WYC1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 910,
"textmining": 367,
"combined_score": 946
},
{
"protein2": "8022.A0A060VXI5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.W1I939",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 236,
"combined_score": 726
},
{
"protein2": "8022.A0A060VVP8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060XA82",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 236,
"combined_score": 726
},
{
"protein2": "8022.A0A060ZXZ7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 110,
"database": 699,
"textmining": 506,
"combined_score": 856
},
{
"protein2": "8022.A0A060YU62",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 500,
"experimental": 0,
"database": 0,
"textmining": 443,
"combined_score": 709
},
{
"protein2": "8022.A0A060XQB8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 92,
"experimental": 0,
"database": 824,
"textmining": 380,
"combined_score": 892
},
{
"protein2": "8022.A0A060Z1N9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060YXU1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 74,
"experimental": 0,
"database": 670,
"textmining": 191,
"combined_score": 731
},
{
"protein2": "8022.A0A060XMN7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 333,
"database": 507,
"textmining": 332,
"combined_score": 767
},
{
"protein2": "8022.A0A060XPX7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 236,
"combined_score": 726
},
{
"protein2": "8022.A0A060YRF1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 630,
"experimental": 0,
"database": 289,
"textmining": 507,
"combined_score": 858
},
{
"protein2": "8022.A0A060XUA7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 333,
"database": 507,
"textmining": 279,
"combined_score": 748
},
{
"protein2": "8022.A0A060Z4Q6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 273,
"database": 419,
"textmining": 504,
"combined_score": 775
},
{
"protein2": "8022.A0A060WMR1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 686,
"database": 787,
"textmining": 389,
"combined_score": 955
},
{
"protein2": "8022.A0A060X3S2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 73,
"experimental": 265,
"database": 327,
"textmining": 507,
"combined_score": 743
},
{
"protein2": "8022.A0A060X035",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 830,
"textmining": 367,
"combined_score": 899
},
{
"protein2": "8022.A0A060YIA4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 760,
"textmining": 236,
"combined_score": 828
},
{
"protein2": "8022.A0A060YTR0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 167,
"database": 573,
"textmining": 423,
"combined_score": 780
},
{
"protein2": "8022.A0A060YCT9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 393,
"combined_score": 782
},
{
"protein2": "8022.A0A060YF61",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 273,
"database": 650,
"textmining": 46,
"combined_score": 740
},
{
"protein2": "8022.A0A060WBT7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 853,
"database": 910,
"textmining": 450,
"combined_score": 992
},
{
"protein2": "8022.Q8QFQ0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 215,
"experimental": 0,
"database": 572,
"textmining": 437,
"combined_score": 794
},
{
"protein2": "8022.A0A060XD94",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060XFH8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 200,
"combined_score": 744
},
{
"protein2": "8022.C1BEY3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 827,
"textmining": 450,
"combined_score": 908
},
{
"protein2": "8022.A0A060Y043",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 189,
"combined_score": 710
},
{
"protein2": "8022.A0A060X063",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 450,
"combined_score": 803
},
{
"protein2": "8022.A0A060XGI5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 0,
"database": 910,
"textmining": 269,
"combined_score": 933
},
{
"protein2": "8022.A0A060VZ13",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 74,
"experimental": 0,
"database": 910,
"textmining": 452,
"combined_score": 950
},
{
"protein2": "8022.A0A060WGW1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 215,
"experimental": 0,
"database": 572,
"textmining": 437,
"combined_score": 794
},
{
"protein2": "8022.A0A060Z3R0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 0,
"database": 834,
"textmining": 275,
"combined_score": 878
},
{
"protein2": "8022.A0A060ZDV9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060XZ47",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 0,
"database": 910,
"textmining": 269,
"combined_score": 933
},
{
"protein2": "8022.A0A060X8T7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 273,
"database": 650,
"textmining": 46,
"combined_score": 740
},
{
"protein2": "8022.A0A060X8C6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 236,
"combined_score": 726
},
{
"protein2": "8022.A0A060VNB2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 827,
"textmining": 450,
"combined_score": 908
},
{
"protein2": "8022.A0A060YV84",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 145,
"experimental": 612,
"database": 862,
"textmining": 483,
"combined_score": 973
},
{
"protein2": "8022.A0A060WTK5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 53,
"coexpression": 0,
"experimental": 0,
"database": 910,
"textmining": 0,
"combined_score": 911
},
{
"protein2": "8022.A0A060Y8G1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060Z6D6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 50,
"database": 743,
"textmining": 109,
"combined_score": 763
},
{
"protein2": "8022.A0A060Z6R5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 372,
"database": 533,
"textmining": 451,
"combined_score": 840
},
{
"protein2": "8022.A0A060YHN1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 333,
"database": 507,
"textmining": 332,
"combined_score": 767
},
{
"protein2": "8022.A0A060WD93",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 953,
"database": 835,
"textmining": 507,
"combined_score": 995
},
{
"protein2": "8022.A0A060XHF7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 236,
"combined_score": 726
},
{
"protein2": "8022.A0A061AEF4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 0,
"database": 830,
"textmining": 275,
"combined_score": 875
},
{
"protein2": "8022.A0A060ZGH4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 273,
"database": 419,
"textmining": 504,
"combined_score": 775
},
{
"protein2": "8022.A0A060XF80",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 189,
"combined_score": 710
},
{
"protein2": "8022.A0A061ACZ0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 273,
"database": 650,
"textmining": 46,
"combined_score": 740
},
{
"protein2": "8022.A0A060XAE5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060YTI8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 0,
"database": 607,
"textmining": 345,
"combined_score": 739
},
{
"protein2": "8022.A0A060W114",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 273,
"database": 650,
"textmining": 46,
"combined_score": 740
},
{
"protein2": "8022.A0A060VZJ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 0,
"database": 760,
"textmining": 218,
"combined_score": 808
},
{
"protein2": "8022.A0A060W995",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060WD54",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060WU24",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 215,
"experimental": 0,
"database": 572,
"textmining": 437,
"combined_score": 794
},
{
"protein2": "8022.A0A060YVB1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060X986",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 450,
"combined_score": 803
},
{
"protein2": "8022.A0A060WL45",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 500,
"experimental": 0,
"database": 0,
"textmining": 443,
"combined_score": 709
},
{
"protein2": "8022.A0A060Y6M5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060YFH5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 167,
"database": 573,
"textmining": 423,
"combined_score": 780
},
{
"protein2": "8022.A0A060X3H8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060XIE4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 155,
"database": 492,
"textmining": 508,
"combined_score": 774
},
{
"protein2": "8022.A0A060W3D8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 180,
"combined_score": 738
},
{
"protein2": "8022.A0A060VUM0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 921,
"database": 0,
"textmining": 442,
"combined_score": 954
},
{
"protein2": "8022.A0A060XTS9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 0,
"database": 824,
"textmining": 269,
"combined_score": 869
},
{
"protein2": "8022.A0A060Z424",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 74,
"experimental": 0,
"database": 670,
"textmining": 191,
"combined_score": 731
},
{
"protein2": "8022.A0A060W518",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060YRT0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 183,
"combined_score": 707
},
{
"protein2": "8022.A0A060XMR6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060YUC8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060VVA1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 0,
"database": 824,
"textmining": 269,
"combined_score": 869
},
{
"protein2": "8022.A0A060YIQ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 173,
"coexpression": 58,
"experimental": 0,
"database": 862,
"textmining": 450,
"combined_score": 933
},
{
"protein2": "8022.A0A060W037",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.Q1G669",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 415,
"experimental": 0,
"database": 272,
"textmining": 505,
"combined_score": 770
},
{
"protein2": "8022.A0A060WUH7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060YG76",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060Y952",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 233,
"combined_score": 755
},
{
"protein2": "8022.A0A060WC91",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A061A315",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 686,
"database": 787,
"textmining": 389,
"combined_score": 955
},
{
"protein2": "8022.A0A060X3D3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 333,
"database": 507,
"textmining": 332,
"combined_score": 767
},
{
"protein2": "8022.A0A060XFJ7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 0,
"database": 760,
"textmining": 218,
"combined_score": 808
},
{
"protein2": "8022.A0A060XPX2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 145,
"experimental": 612,
"database": 862,
"textmining": 483,
"combined_score": 973
},
{
"protein2": "8022.A0A060WRJ1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060W2H2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 236,
"combined_score": 726
},
{
"protein2": "8022.A0A060ZEP6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 116,
"database": 829,
"textmining": 88,
"combined_score": 854
},
{
"protein2": "8022.A0A060WH57",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 74,
"experimental": 0,
"database": 670,
"textmining": 191,
"combined_score": 731
},
{
"protein2": "8022.A0A060XQ00",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060XR03",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 236,
"combined_score": 726
},
{
"protein2": "8022.A0A060Y7T2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060W128",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 180,
"combined_score": 738
},
{
"protein2": "8022.A0A060WVY3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 853,
"database": 910,
"textmining": 450,
"combined_score": 992
},
{
"protein2": "8022.A0A060YUZ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060WT74",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 69,
"experimental": 0,
"database": 607,
"textmining": 345,
"combined_score": 739
},
{
"protein2": "8022.A0A060Z7Q9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 273,
"database": 618,
"textmining": 44,
"combined_score": 715
},
{
"protein2": "8022.A0A060YYT8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 50,
"database": 743,
"textmining": 109,
"combined_score": 763
},
{
"protein2": "8022.A0A060XA36",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 140,
"experimental": 535,
"database": 828,
"textmining": 440,
"combined_score": 956
},
{
"protein2": "8022.C1BI02",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 114,
"experimental": 0,
"database": 827,
"textmining": 450,
"combined_score": 908
},
{
"protein2": "8022.A0A060VTL5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 760,
"textmining": 236,
"combined_score": 828
},
{
"protein2": "8022.A0A060W4P9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 75,
"experimental": 937,
"database": 910,
"textmining": 507,
"combined_score": 997
},
{
"protein2": "8022.A0A060XXD6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 149,
"coexpression": 58,
"experimental": 0,
"database": 862,
"textmining": 450,
"combined_score": 931
},
{
"protein2": "8022.A0A060WA83",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 55,
"experimental": 155,
"database": 492,
"textmining": 505,
"combined_score": 772
},
{
"protein2": "8022.A0A060VT18",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 314,
"database": 824,
"textmining": 87,
"combined_score": 882
},
{
"protein2": "8022.A0A060W2M3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060WSV1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 0,
"database": 760,
"textmining": 218,
"combined_score": 808
},
{
"protein2": "8022.A0A060XB50",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060X9U8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 314,
"database": 824,
"textmining": 87,
"combined_score": 882
},
{
"protein2": "8022.A0A060Z1J2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 57,
"experimental": 167,
"database": 573,
"textmining": 423,
"combined_score": 780
},
{
"protein2": "8022.A0A060XLZ6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 67,
"experimental": 333,
"database": 507,
"textmining": 332,
"combined_score": 767
},
{
"protein2": "8022.A0A060W766",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 500,
"experimental": 0,
"database": 0,
"textmining": 443,
"combined_score": 709
},
{
"protein2": "8022.A0A060WMZ6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 686,
"database": 787,
"textmining": 389,
"combined_score": 955
},
{
"protein2": "8022.A0A060ZZG4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 49,
"experimental": 686,
"database": 787,
"textmining": 389,
"combined_score": 955
},
{
"protein2": "8022.A0A060XKG4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 333,
"database": 507,
"textmining": 279,
"combined_score": 748
},
{
"protein2": "8022.A0A060YGA1",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 215,
"experimental": 0,
"database": 572,
"textmining": 437,
"combined_score": 794
},
{
"protein2": "8022.A0A060XG27",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 372,
"database": 533,
"textmining": 271,
"combined_score": 776
},
{
"protein2": "8022.A0A060XIZ5",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060YBG9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 74,
"experimental": 0,
"database": 910,
"textmining": 452,
"combined_score": 950
},
{
"protein2": "8022.A0A060YSX0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 102,
"experimental": 0,
"database": 826,
"textmining": 404,
"combined_score": 898
},
{
"protein2": "8022.A0A060VYB4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 66,
"experimental": 116,
"database": 829,
"textmining": 88,
"combined_score": 854
},
{
"protein2": "8022.A0A060XW82",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 0,
"database": 910,
"textmining": 218,
"combined_score": 928
},
{
"protein2": "8022.A0A060XVY3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 124,
"experimental": 372,
"database": 533,
"textmining": 451,
"combined_score": 840
},
{
"protein2": "8022.W0TYL2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 145,
"experimental": 612,
"database": 827,
"textmining": 483,
"combined_score": 966
},
{
"protein2": "8022.A0A060WQB0",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 500,
"experimental": 0,
"database": 0,
"textmining": 443,
"combined_score": 709
},
{
"protein2": "8022.A0A060X1J2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 74,
"experimental": 0,
"database": 670,
"textmining": 191,
"combined_score": 731
},
{
"protein2": "8022.A0A060X7P8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 273,
"database": 650,
"textmining": 46,
"combined_score": 740
},
{
"protein2": "8022.A0A060Z4I6",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060W2H8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 828,
"textmining": 130,
"combined_score": 843
},
{
"protein2": "8022.A0A060WPH7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 314,
"database": 824,
"textmining": 87,
"combined_score": 882
},
{
"protein2": "8022.A0A060YNP8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 74,
"experimental": 0,
"database": 699,
"textmining": 507,
"combined_score": 850
},
{
"protein2": "8022.A0A060XPJ8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 180,
"combined_score": 738
},
{
"protein2": "8022.A0A060X8V7",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 58,
"experimental": 155,
"database": 492,
"textmining": 508,
"combined_score": 774
},
{
"protein2": "8022.A0A060YQ81",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 333,
"database": 507,
"textmining": 189,
"combined_score": 710
},
{
"protein2": "8022.A0A060W820",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 180,
"combined_score": 738
},
{
"protein2": "8022.A0A060VNW8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060VY72",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 139,
"experimental": 0,
"database": 826,
"textmining": 367,
"combined_score": 896
},
{
"protein2": "8022.A0A060WJ39",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 74,
"experimental": 0,
"database": 670,
"textmining": 191,
"combined_score": 731
},
{
"protein2": "8022.A0A060X285",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060Y084",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 273,
"database": 650,
"textmining": 46,
"combined_score": 740
},
{
"protein2": "8022.A0A060XRW9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060W9P9",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060YKY4",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 79,
"experimental": 372,
"database": 533,
"textmining": 271,
"combined_score": 776
},
{
"protein2": "8022.A0A060WPR8",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 0,
"database": 910,
"textmining": 218,
"combined_score": 928
},
{
"protein2": "8022.A0A060YHB3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 372,
"database": 533,
"textmining": 83,
"combined_score": 707
},
{
"protein2": "8022.A0A060WBI2",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 0,
"database": 760,
"textmining": 218,
"combined_score": 808
},
{
"protein2": "8022.A0A060Y558",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 56,
"experimental": 314,
"database": 824,
"textmining": 87,
"combined_score": 882
},
{
"protein2": "8022.A0A060YAX3",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 65,
"experimental": 0,
"database": 827,
"textmining": 269,
"combined_score": 871
}
] |
A0A068PF27
|
Progonadoliberin [Cleaved into: Gonadoliberin (Gonadotropin-releasing hormone) (GnRH) (Luliberin) (Luteinizing hormone-releasing hormone) (LH-RH); GnRH-associated peptide (GnRH-associated peptide)]
|
Stimulates the secretion of gonadotropins. {ECO:0000256|RuleBase:RU000635}.
|
Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
| 43
|
Secreted {ECO:0000256|ARBA:ARBA00004613, ECO:0000256|RuleBase:RU000635}.
|
LAQHWSYGLQPGGKRNAENLVESFQEIANEMENLREVKEAECP
|
[
"GO:1904014",
"GO:0050896",
"GO:1901698",
"GO:0010033",
"GO:1901700",
"GO:0043279",
"GO:0008150",
"GO:0042221",
"GO:0014070",
"GO:0010243",
"GO:0071867",
"GO:0043204",
"GO:0043025",
"GO:0043005",
"GO:0110165",
"GO:0030424",
"GO:0036477",
"GO:0042995",
"GO:0005575",
"GO:0120025",
"GO:0044297"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0042221",
"GO:1901698",
"GO:0010033",
"GO:1901700",
"GO:1904014",
"GO:0014070",
"GO:0010243",
"GO:0043279",
"GO:0071867"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0043204",
"GO:0036477",
"GO:0042995",
"GO:0044297",
"GO:0043025",
"GO:0120025",
"GO:0043005",
"GO:0030424"
] |
[
"IPR002012",
"IPR019792",
"IPR004079"
] |
af_db/AF-A0A068PF27-F1-model_v4.cif.gz
| null | null | null |
A0A023PXP4
|
Putative uncharacterized protein YLR235C
| null |
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
| 132
| null |
MLIGAPSNMRLRGALELLWRRLLHGLMQLRLVLKMHICSQLNHAIKRRAFLKTKGGKNALHGCLDTVINLQESILAGIRLVPVLPILLDYVLYNISLGGMTFADFLEVLLHFSALEGLCKGVFEADGLEAVH
|
[
"GO:0033554",
"GO:0051716",
"GO:0050896",
"GO:0006950",
"GO:0006974",
"GO:0009987",
"GO:0008150"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0009987",
"GO:0051716",
"GO:0006950",
"GO:0033554",
"GO:0006974"
] | null | null | null |
af_db/AF-A0A023PXP4-F1-model_v4.cif.gz
|
4932.YLR235C
|
[
"4932.YLR234W",
"4932.YLR236C"
] |
[
{
"protein2": "4932.YLR234W",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 88,
"experimental": 0,
"database": 0,
"textmining": 691,
"combined_score": 706
},
{
"protein2": "4932.YLR236C",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 96,
"experimental": 0,
"database": 0,
"textmining": 831,
"combined_score": 840
}
] |
A0A023GPJ3
|
Chronophage, isoform J
| null |
Drosophila melanogaster (Fruit fly)
| 1,140
|
Nucleus {ECO:0000256|ARBA:ARBA00004123}.
|
MDRDAEEGRPLSLVNRRPSISAPISGRKSAPASAAAAVAAAAAAAAAAAAASSTASGSRIHTPPPSPADLLADGASSTPKRLVDENDNTTPKDSETGATTLDSNAAPSSPAAIERQSSGDSSCEMEEQQDRQDKQSQPKQAKVKQEPYDEEGVNHHQNQDDDDDEEMEERSLAKRPKMELVDAEANTVHTEPSNYTCSTCKTRYTSAWRLIQHVQHSHGVKIYVESPGGGATLTVATPAALNNSALALAAAAAAASASGLASPQPAVSPNPAVTSSAKRSSPLGAAGSTILSTSVSSTCSNSLVNTSGGSISNTSSIGSPQQQQLQLQQQQAQQQQQRVQQQQRENLASAMAAGMRHHPLLPPPEAMHANPFQLLRMPLPPALAQAGNVVPTVAPLFGRPSPADHYRMEQLVSEQFRHHGFNLAAAAAAAQAQFNANGQVVGGVVSGSGEPRPPSSSSSGSQRGSVPPAALPPPSLSSQQQQQQQQAVQQQQQQGAQQQLQSAQQQQQSQQQSQQQQQITPGLVGGAGGSLKLEPQQMDFYSQRLRQLAGTTSPGAGSTVNSSSPSPRQKQSPHFASPSPSQQQQQQLATIPRPHSLTPPEKLGDASSENGSLGLILASTPRSASTPPSKTGDVSLQEPIAHCYSCSYCDKKFRFENNLIIHQRTHTGEKPYKCTACDFECSHIQKLMKHMRVHRSPADDQDNQDNQDDGSNADSLETNEADNDEDPNPDESEEELGDGDNDPDGDGDLDGEDEDEDELEECEDMDYKAEDLSVSNRIDGKSQSPKTTSSGATSLVGELMDKFGLSNIAQYSEAYKQALQESGRKEAAAAAAAAAAAADNNNRGGAGAPLSDKLNGLPVAALRLRDEFAKNCNMFQQPQDGGAPSQVPLFNPFPNPFELSKRMKMDGGDWWGMSQALHRNEALFENLKLKPLGLGGANSLIQGPLLKKESRQRNDTCEFCGKVFKNCSNLTVHRRSHTGEKPYKCELCSYACAQSSKLTRHMKTHGRTGKDVYRCRFCDMPFSVPSTLEKHMRKCVVNQGKAAAAANAVAAAQAAQAAAQHIQAAAQQAQAVQAQAVQAQAAQQSQQQQQQLSPMGVVGYPPQFVSGHNLSLPGSVSGDNDSNASSSMTGVHPISLKEEA
|
[
"GO:0046888",
"GO:0065008",
"GO:0023051",
"GO:0065007",
"GO:0002792",
"GO:0010648",
"GO:0023057",
"GO:1903530",
"GO:0051046",
"GO:0051049",
"GO:0051051",
"GO:0008150",
"GO:0090276",
"GO:0002791",
"GO:0010817",
"GO:0090087",
"GO:0050789",
"GO:0010646",
"GO:0048523",
"GO:0048519",
"GO:0090278",
"GO:0032879",
"GO:0051048",
"GO:1903531",
"GO:0046883",
"GO:0050794",
"GO:0005737",
"GO:0005829",
"GO:0005575",
"GO:0005622",
"GO:0110165"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050789",
"GO:0048519",
"GO:0065008",
"GO:0023051",
"GO:0023057",
"GO:0051051",
"GO:0048523",
"GO:0032879",
"GO:0050794",
"GO:0046888",
"GO:0010648",
"GO:1903530",
"GO:0051049",
"GO:0010817",
"GO:0010646",
"GO:0051048",
"GO:1903531",
"GO:0046883",
"GO:0002792",
"GO:0051046",
"GO:0090276",
"GO:0090087",
"GO:0090278",
"GO:0002791"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005737",
"GO:0005829",
"GO:0005622"
] |
[
"IPR051497",
"IPR036236",
"IPR013087"
] |
af_db/AF-A0A023GPJ3-F1-model_v4.cif.gz
| null | null | null |
A0A096MIW4
|
Serpin family C member 1
| null |
Rattus norvegicus (Rat)
| 123
| null |
MEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSNLVSANRLFGDKSLTFNESYQDVSEIVYGAKLQPLDFKENPEQSRVTINNWVANKTEGRIKDVIPQGAIDELTALVLVNTIYFKGIM
|
[
"GO:0006952",
"GO:0048732",
"GO:0051234",
"GO:0009605",
"GO:0009991",
"GO:0032502",
"GO:0002376",
"GO:0030879",
"GO:0002526",
"GO:0065008",
"GO:0048856",
"GO:0065007",
"GO:0046903",
"GO:0051179",
"GO:0002437",
"GO:0006950",
"GO:0050878",
"GO:0008150",
"GO:0042221",
"GO:0006954",
"GO:0007589",
"GO:0007584",
"GO:0002438",
"GO:0050896",
"GO:0031667",
"GO:0006955",
"GO:0007595",
"GO:0006810",
"GO:0048513",
"GO:0110165",
"GO:0005575",
"GO:0005576",
"GO:0005615",
"GO:0030234",
"GO:0098772",
"GO:0005488",
"GO:0061135",
"GO:1901681",
"GO:0030414",
"GO:0008201",
"GO:0061134",
"GO:0004866",
"GO:0004867",
"GO:0004857",
"GO:0003674",
"GO:0097367",
"GO:0005515",
"GO:0005539",
"GO:0140678"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0002376",
"GO:0065007",
"GO:0051179",
"GO:0050896",
"GO:0051234",
"GO:0009605",
"GO:0065008",
"GO:0048856",
"GO:0006950",
"GO:0042221",
"GO:0006955",
"GO:0006952",
"GO:0009991",
"GO:0002437",
"GO:0050878",
"GO:0007584",
"GO:0006810",
"GO:0048513",
"GO:0048732",
"GO:0046903",
"GO:0006954",
"GO:0007589",
"GO:0002438",
"GO:0031667",
"GO:0030879",
"GO:0002526",
"GO:0007595"
] |
[
"GO:0003674",
"GO:0098772",
"GO:0005488",
"GO:0030234",
"GO:1901681",
"GO:0097367",
"GO:0005515",
"GO:0140678",
"GO:0008201",
"GO:0061134",
"GO:0004857",
"GO:0005539",
"GO:0061135",
"GO:0030414",
"GO:0004866",
"GO:0004867"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0005576",
"GO:0005615"
] |
[
"IPR023796",
"IPR000215",
"IPR036186",
"IPR042178"
] | null | null | null | null |
A0A096MJR8
|
ADP-ribosylation factor like GTPase 13B
| null |
Rattus norvegicus (Rat)
| 401
| null |
RQNGRNEGDNVRSAKTPSDIRKAYIGKRYLNEKVPEVLHLVLQIHKFLVSLFNLRELCFSHAGLWTRTRLLLSQQPYGSSKPYVTSVPGDRCPLLVFVGTGLANKQDKEGALGEADVIECLSLEKLVNEHKCLCQIEPCSAVLGYGKKIDKSIKKGLYWLLHIIAKDFDALSERIQKDTTEQRALEEQEKCERAERVRKLREEREQEQTELDGTSGLAEMDSGPVLTNPFQPIAAVIIENEKKQEKEKKKKTAEKDSDVGHPEHKGEQEGAESQNEAGGCLRNPHRDVVNSYKEALSQQLDNEDELDQRVSEPGDNSKKKTKKLRMKRSHRVEPVNTDESAPKSPTPPPPPPPVGWGTPKVTRLPKLEPLGETRHNDFYGKPLPPLAVRQRPNGDAQDMIS
|
[
"GO:0010038",
"GO:0050896",
"GO:1901700",
"GO:0010035",
"GO:0042221",
"GO:1902074",
"GO:0008150",
"GO:0010226"
] |
[
"GO:0008150",
"GO:0050896",
"GO:0042221",
"GO:1901700",
"GO:0010035",
"GO:1902074",
"GO:0010038",
"GO:0010226"
] | null | null |
[
"IPR051995",
"IPR027417"
] | null | null | null | null |
A0A0A6YVS5
|
Protocadherin gamma subfamily C, 4
| null |
Mus musculus (Mouse)
| 131
| null |
MAAMPSTQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
|
[
"GO:0050808",
"GO:0009987",
"GO:0016043",
"GO:0065007",
"GO:0071840",
"GO:1901214",
"GO:1901215",
"GO:0043066",
"GO:0042981",
"GO:0008150",
"GO:0060548",
"GO:0043524",
"GO:0010941",
"GO:0050789",
"GO:0034330",
"GO:0043523",
"GO:0043069",
"GO:0048523",
"GO:0043067",
"GO:0048519",
"GO:0050794",
"GO:0110165",
"GO:0005575",
"GO:0016020"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0050789",
"GO:0048519",
"GO:0071840",
"GO:0048523",
"GO:0050794",
"GO:0016043",
"GO:0060548",
"GO:0010941",
"GO:1901214",
"GO:1901215",
"GO:0034330",
"GO:0043069",
"GO:0043067",
"GO:0050808",
"GO:0043066",
"GO:0042981",
"GO:0043524",
"GO:0043523"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0016020"
] |
[
"IPR031904"
] |
af_db/AF-A0A0A6YVS5-F1-model_v4.cif.gz
| null | null | null |
A0A0B4KED6
|
Defective proboscis extension response 12, isoform D
| null |
Drosophila melanogaster (Fruit fly)
| 321
| null |
MPMVPPRLLLRLRRPLHLMELRILLLCLPTLLLATTLEPDQKSILTDNDWKKLWMRGGINGDSKLDNNLDSSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLNTVVVRHIFLT
|
[
"GO:0008037",
"GO:0050808",
"GO:0032502",
"GO:0048869",
"GO:0008039",
"GO:0009987",
"GO:0048856",
"GO:0022008",
"GO:0016043",
"GO:0071840",
"GO:0007275",
"GO:0008038",
"GO:0008150",
"GO:0007399",
"GO:0048468",
"GO:0034330",
"GO:0030154",
"GO:0030182",
"GO:0032501",
"GO:0048731",
"GO:0048666",
"GO:0048699"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0009987",
"GO:0032501",
"GO:0008037",
"GO:0048869",
"GO:0048856",
"GO:0071840",
"GO:0007275",
"GO:0016043",
"GO:0008038",
"GO:0048468",
"GO:0030154",
"GO:0048731",
"GO:0008039",
"GO:0022008",
"GO:0007399",
"GO:0034330",
"GO:0030182",
"GO:0048666",
"GO:0050808",
"GO:0048699"
] | null | null |
[
"IPR007110",
"IPR036179",
"IPR013783",
"IPR013098",
"IPR003599",
"IPR003598",
"IPR037448"
] |
af_db/AF-A0A0B4KED6-F1-model_v4.cif.gz
| null | null | null |
A0A0B4KEJ7
|
Coronin
| null |
Drosophila melanogaster (Fruit fly)
| 535
| null |
MSFRVVRSSKFRHVYGQALKREQCYDNIRVSKSSWDSTFCAVNPKFLAIIVESAGGGAFIVLPHNKVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPDGGLSRTLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSHPDIVYSACFNWDGSKLVTTCKDKKIRIYDPRTAELESEAMCHEGSKATRAIFLRHGLIFTTGFNRSSERQYSLRAPDALNEPIVMVELDTSNGVMFPLYDADTNMIYLCGKGDSVIRYFEVTPEPPFVHYINTFQTTEPQRGIGLMPKRGCDVTTCEVAKFYRMNNNGLCQVISMTVPRKSDLFQEDLYPDTLAEDAAITAEEWIDGKDADPITFSLKDRVSIVQGGYVSSSVNKSLPAKKAGNILNKPRGDSASSGATSSSAGGGNFASGNNNEASEGGPPAAVLSEKDLRTIQDEIRKLKAIIVKQENRIRALEAKEDARNKNGSDAAPASAGAATSDGKASESANDHASTSAGTSKDED
|
[
"GO:0006952",
"GO:0009605",
"GO:0032502",
"GO:0048856",
"GO:0061061",
"GO:0006950",
"GO:0008150",
"GO:0043207",
"GO:0050896",
"GO:0007527",
"GO:0007525",
"GO:0051707",
"GO:0009620",
"GO:0050832",
"GO:0009607",
"GO:0098542",
"GO:0044419"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0050896",
"GO:0044419",
"GO:0009605",
"GO:0048856",
"GO:0006950",
"GO:0051707",
"GO:0009607",
"GO:0006952",
"GO:0061061",
"GO:0043207",
"GO:0009620",
"GO:0098542",
"GO:0007525",
"GO:0050832",
"GO:0007527"
] | null | null |
[
"IPR015505",
"IPR015048",
"IPR015943",
"IPR019775",
"IPR001680"
] |
af_db/AF-A0A0B4KEJ7-F1-model_v4.cif.gz
|
7227.FBpp0307639
|
[
"7227.FBpp0081260",
"7227.FBpp0079746",
"7227.FBpp0302793",
"7227.FBpp0088450",
"7227.FBpp0084124",
"7227.FBpp0301603",
"7227.FBpp0083898"
] |
[
{
"protein2": "7227.FBpp0081260",
"neighborhood": 141,
"fusion": 0,
"cooccurence": 0,
"coexpression": 184,
"experimental": 0,
"database": 0,
"textmining": 650,
"combined_score": 733
},
{
"protein2": "7227.FBpp0079746",
"neighborhood": 131,
"fusion": 877,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 0,
"textmining": 0,
"combined_score": 889
},
{
"protein2": "7227.FBpp0302793",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 119,
"experimental": 726,
"database": 0,
"textmining": 530,
"combined_score": 876
},
{
"protein2": "7227.FBpp0088450",
"neighborhood": 233,
"fusion": 0,
"cooccurence": 0,
"coexpression": 97,
"experimental": 0,
"database": 0,
"textmining": 619,
"combined_score": 713
},
{
"protein2": "7227.FBpp0084124",
"neighborhood": 141,
"fusion": 0,
"cooccurence": 0,
"coexpression": 236,
"experimental": 0,
"database": 0,
"textmining": 587,
"combined_score": 705
},
{
"protein2": "7227.FBpp0301603",
"neighborhood": 417,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 0,
"textmining": 625,
"combined_score": 772
},
{
"protein2": "7227.FBpp0083898",
"neighborhood": 187,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 0,
"textmining": 662,
"combined_score": 713
}
] |
A0A075BR52
|
Draculin-like 3 (Draculin-like, tandem duplicate 3)
| null |
Danio rerio (Zebrafish) (Brachydanio rerio)
| 631
|
Nucleus {ECO:0000256|ARBA:ARBA00004123}.
|
MEIEDSENMKDTTEPCRTEHCDDTEGQRDHMEGNKEGETEAKKSVACFHCKKRFTCKAHLQVHMRVHNKKKQKDRKATAEKLHTCDKSGKSFAYKSSLKKHMINHSGEKKHTCDQCGKSFPFKVYLEQHMLIHTGETLHECDQCGKSFRSKGEVKIHMLIHTGEKPHKCDQCGKSFRSKGEVKIHMLIHTGEKPHECDQCGKSFRSKGEVKIHMLIHTRKKPHECDQCGKSFRSKGEVKQHMSIHTGLKPYKCEECGKFFAQKNNLQVHMKVHTGEKPYRCDQCGKCFPYKQSLKLHLEIHAKGNPYTCDECGKSFKTCLQFRSHMTLHPEYKPYKCDQCEKSYGREDHLQRHMKYHTGEKPHKCEHCGKSFQMRDLLRSHLMVHREVKPYTCDQCGKGFTLKKCYNEHMNIHTGERPYTCDQCGKGFPYEQSLNLHMRFHRGEKPFTCDQCGQSFSQKGAYNIHMKIHTGEKPYTCDQCGMSFRHGSSLKLHMTHHTGEKPFHCDQCDKCYSTALFLKNHMKTHNKDQIYSCLTCGKTFNLLGCLRMHEKRHTLVKPFMCFDCGKCYFTDTELKQHLSVHSNERPYMCSLCFKSFSRMDSLKKHEKTHNRKIQNHHHDEGEHDQTSLLKG
|
[
"GO:0032502",
"GO:0030097",
"GO:0048468",
"GO:0009790",
"GO:0048856",
"GO:0035162",
"GO:0048869",
"GO:0030154",
"GO:0009987",
"GO:0007275",
"GO:0060215",
"GO:0032501",
"GO:0048568",
"GO:0048513",
"GO:0008150"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0009987",
"GO:0032501",
"GO:0048856",
"GO:0048869",
"GO:0007275",
"GO:0048468",
"GO:0009790",
"GO:0030154",
"GO:0048513",
"GO:0030097",
"GO:0048568",
"GO:0035162",
"GO:0060215"
] | null | null |
[
"IPR050752",
"IPR036236",
"IPR013087"
] |
af_db/AF-A0A075BR52-F1-model_v4.cif.gz
| null | null | null |
A0A0A0MQJ7
|
CDKN1A interacting zinc finger protein 1
| null |
Mus musculus (Mouse)
| 194
| null |
MFNPQLQQQQQLQQQQQQLQQQLQQQQLQQQQQQILQLQQLLQQSPPQASLSIPVSRGLPQQSSPQQLLSLQGLHSTSLLNGPMLQRALLLQQLQGLDQFAMPPATYDGASLTMPTATLGNLRAFNVTAPSLAAPSLTPPQMVTPNLQQFFPQATRQSLLGPPPVGVPINPSQLNHSGRNTQKQARTPSSTTPN
|
[
"GO:0090329",
"GO:0051641",
"GO:0045935",
"GO:0065007",
"GO:0034504",
"GO:0051179",
"GO:0051651",
"GO:0033365",
"GO:0048518",
"GO:0008150",
"GO:0032298",
"GO:2000105",
"GO:0010604",
"GO:0048522",
"GO:0051052",
"GO:0050789",
"GO:0031325",
"GO:0019222",
"GO:0051054",
"GO:0006275",
"GO:0051457",
"GO:0051235",
"GO:0050794",
"GO:0032507",
"GO:0051171",
"GO:0009893",
"GO:0072595",
"GO:0070727",
"GO:0060255",
"GO:0030174",
"GO:0009987",
"GO:0031323",
"GO:0019219",
"GO:0045740",
"GO:0080090",
"GO:0008104",
"GO:0045185",
"GO:0033036",
"GO:0051173",
"GO:0005622",
"GO:0043229",
"GO:0043226",
"GO:0110165",
"GO:0005575",
"GO:0043227",
"GO:0005634",
"GO:0043231",
"GO:0030332",
"GO:0005515",
"GO:0005488",
"GO:0003674"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0051179",
"GO:0048518",
"GO:0050789",
"GO:0009987",
"GO:0051641",
"GO:0051651",
"GO:0048522",
"GO:0019222",
"GO:0051235",
"GO:0050794",
"GO:0009893",
"GO:0033036",
"GO:0010604",
"GO:0031325",
"GO:0032507",
"GO:0051171",
"GO:0070727",
"GO:0060255",
"GO:0031323",
"GO:0080090",
"GO:0045185",
"GO:0051173",
"GO:0045935",
"GO:0051052",
"GO:0051054",
"GO:0072595",
"GO:0019219",
"GO:0008104",
"GO:0033365",
"GO:0006275",
"GO:0051457",
"GO:0045740",
"GO:0090329",
"GO:0034504",
"GO:0032298",
"GO:2000105",
"GO:0030174"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0005515",
"GO:0030332"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0043229",
"GO:0043227",
"GO:0043231",
"GO:0005634"
] |
[
"IPR026811"
] |
af_db/AF-A0A0A0MQJ7-F1-model_v4.cif.gz
| null | null | null |
A0A0A6YVQ0
|
CDKN1A interacting zinc finger protein 1
| null |
Mus musculus (Mouse)
| 57
| null |
MFNPQLQQQQQLQQQQQQLQQQLQQQQLQQQQQQILQLQQLLQQSPPQASLSIPVSR
|
[
"GO:0090329",
"GO:0051641",
"GO:0045935",
"GO:0065007",
"GO:0034504",
"GO:0051179",
"GO:0051651",
"GO:0033365",
"GO:0048518",
"GO:0008150",
"GO:0032298",
"GO:2000105",
"GO:0010604",
"GO:0048522",
"GO:0051052",
"GO:0050789",
"GO:0031325",
"GO:0019222",
"GO:0051054",
"GO:0006275",
"GO:0051457",
"GO:0051235",
"GO:0050794",
"GO:0032507",
"GO:0051171",
"GO:0009893",
"GO:0072595",
"GO:0070727",
"GO:0060255",
"GO:0030174",
"GO:0009987",
"GO:0031323",
"GO:0019219",
"GO:0045740",
"GO:0080090",
"GO:0008104",
"GO:0045185",
"GO:0033036",
"GO:0051173",
"GO:0005622",
"GO:0043229",
"GO:0043226",
"GO:0110165",
"GO:0005575",
"GO:0043227",
"GO:0005634",
"GO:0043231",
"GO:0030332",
"GO:0005515",
"GO:0005488",
"GO:0003674"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0051179",
"GO:0048518",
"GO:0050789",
"GO:0009987",
"GO:0051641",
"GO:0051651",
"GO:0048522",
"GO:0019222",
"GO:0051235",
"GO:0050794",
"GO:0009893",
"GO:0033036",
"GO:0010604",
"GO:0031325",
"GO:0032507",
"GO:0051171",
"GO:0070727",
"GO:0060255",
"GO:0031323",
"GO:0080090",
"GO:0045185",
"GO:0051173",
"GO:0045935",
"GO:0051052",
"GO:0051054",
"GO:0072595",
"GO:0019219",
"GO:0008104",
"GO:0033365",
"GO:0006275",
"GO:0051457",
"GO:0045740",
"GO:0090329",
"GO:0034504",
"GO:0032298",
"GO:2000105",
"GO:0030174"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0005515",
"GO:0030332"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0043229",
"GO:0043227",
"GO:0043231",
"GO:0005634"
] | null |
af_db/AF-A0A0A6YVQ0-F1-model_v4.cif.gz
| null | null | null |
A0A0A6YW72
|
Dachsous cadherin related 2
| null |
Mus musculus (Mouse)
| 3,346
|
Cell membrane {ECO:0000256|ARBA:ARBA00004251}; Single-pass type I membrane protein {ECO:0000256|ARBA:ARBA00004251}.
|
MSPAGRRMGEGRQPAGSPRGRPRGAGAQSSLLRLFVHAWLWAASGSSAQVFNLSLSVDEGLPPDTLVGDIRAGLPAAQQQDGNGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERQDHYSFVAATLLGEVVQVEIRVNDVNDHSPRFPRDSLQLDVSELSPPGTAFRLPGAQDPDAGLFSIQGYTLLQASDMPQDPTGPFFQLRYGTPGLPASPSLPVSSSPLEPLDLVLLRRLDREAAAAHELHIEAWDGGSPRRTGLLHVQLRVLDENDNPPVFEQGEYRATVREDAQPGSEVCRVRATDRDLGPNGLVRYSIRERQVPVASAGGGPLGDPGYFSVEELSGVVRVQRPLDREEQAWHQLVVQARDGGAEPEVATVRVSIDVLDVNDNPPAIHLLFLTEGGAVQVSEGAHPGDYVARVSVSDADGDPEKEEEAAGVLGARLLGAGSIKLSLESGNGVFALRPGGPPGVFFLCIEGLLDRESQDLYELRLVATDAGSPPLSTEESLLLWVSDLNDQPPVFSQEHYWASVSEAAVPGTSVVWVSALDADQAGTDHAKLRYELVQLSDPCQSEALSPEEECVPSFSINPDNGLISTIRALDREVQETVELRVVAQDLGEPPLSATCLVTITVDDVNDNEPVFRRQVYNVTLAEHAAVGHCFLQVKASDADAGLYGLVKYSLYDGFQSYEAPPAFQIDPQDGRICVSQDIDRERDPGTFDLLVKAKDGGGLSAQAFVRVEVDDVNDNYPVFTPSTYVTSISGQTPPGTEIINVLASDRDSGIYGTVAYELIPGDQSSLFTIDSTTGIIYLTSTLSHLEATTIFLMVCARDGGGLTAATNADVTIHIMQTTLAPAEFERPKYTFSVYEDVPEDTLVGTVKARESLNSSEPITYRISSGDPEGKFSIHRWLGSIRTLKPLDHEAQPMVVLTVQAQLGSSPACSSTEVNITVMDVNDNRPEFPTASDEIRISQTTPPGTALYLARAQDRDSGLNGLVRYSIASPQPSEFSMDQGRGVLYLRESLGSKADFRLILVAKDQGVPPQVSQLVLTVVIESQERIPAVAFENLVYQVEVSESLPLTTQILQVQAYPLYPWRPTSKTFYSLDVSVDSAVFGIHPHTGWIYLRRQLDYEFTQTYKFRVYVHTSEDRLLQNVSTSVIVHVLDENDHSPAFLQNRVFLNVEESPIPLGVIGKMTAIDADSGKNGQLSYFLLTDGKFFKMNPNTGELINWLALDREHQGHHQITVLVTDHGSPPRNATMLVYVTITDINDNWPFFPQCLPGKEFHFKVLEGQPVNTLVTTVFAKDLDEGLSAELTYSISSDYPAHFKIDANNGEIRTTSILSHDYRPSYRMTVIASDHGVPPLQGKAIINIQVIPLSKGRVLMSQNIRHLVIPENTKPSKIMSLMKSPDPLQQDHGGKLHFSIAAEDKDDHFEIDSSTGDLFLTKELDYEMTSHYLIRVISKDHSQSPAWNSTVFLSIDVEDQNEHSPSFQDEFIVISIEENVPVGTLVYVFNAKDGDGSFLNSRIQYFAESSSVGVNPFLIHPSSGALVTASPLDRENVPTFILTVTASDQAVNVTDRRWRTLVAEVVILDVNDHSPTFVSYPITYVREDAEVGAVVHRITAQDPDAEMNGEVAYSILSGNEDMVFVLDSSSGLLRIACPLDYEVKTQHILTLVAHDGGMPARSSSQTLTITVLDVNDETPAFKQLLYETSVKENQSPGVFVTRVEAEDTDSGVNSKHQFEIMPGPAFGLFEINPDTGEVVTAVTFDREAQGIFRLRVLVRDGGVPSLSSTADIICTIEDENDHAPEFIVLHHDIEILENRDPEVVYTVLAFDMDAGNNGAVTYHIAEGNTDEYFAIHTTSGELSTTRALDRELISNFTLTILCSDLGNPPRSSAMQLHVRVLDDNDHSPAFPMLHYQSSIREDAEVGTVVLVLSAVDRDEGLNGQVEYFLMEEVSGAFTIDRVTGILRTSHALDRESRSQHTFQAVARDCSTQGAKSSVLSILISVTDANDNDPVWEENPVDAFISPMLALNQTVVHLRASDPDAGPNGTVTFSFADRQSVFSIDGYTGEVKLQQNLSSEHFPIWLQLLATDQGTPARTTMGLLVVHKEGEGMKLSFSRYLYTGLVTENCEPGTSVVTVKAFAPVSSPDAITYSVVSGNEDGVFSLGSNSGQLIVEEPGLLDFEVRSEVRLIILAESNGHQAFTQVTVAIQDWNDNPPRFAQSVYQASVSEGQFYSVHVIQVSATDLDQGLNSQIEYSIVSGNQAGAFRIDELNGVILTNSILDYESSGSYSLIVQATDRGVPRLSGTALVKIQVTDINDNAPVFLPSEAVEIAENSLPGVIVARVSVHDADLNPAFTFSLVKESSSAAKFAISQDTGVVVLAQTLDFEEVTEYELIVRVSDSVHHTEGSVIIRVLDVNDNPPVFTQDFYQAAVPELTPGGYLVLTLSATDLESSGDISYRILSPPEGFTIDPRNGTIFTTNSVSVLEKIPTLRFLVEANDGGIPSLTALTLVEIEIQDVNNYAPEFPAGCYNLSLSEDTPIGSTLMTFSTIDGDYSFENTHTEYSIISGNLHNYFHIETSLLGSEHPHQQRGALVLLHALDREASASHKLVILASDHGCPPLSSTSVIAIDILDINDNAPTFSSRHYQAHVKESTPVGSHITMVSADDPDKGSHAEIIYGIISGNEKEHFYLEDRTGVLYLVKPLDYEETVAFTLTIQATDEEEKHVSFAAVHISVLDDNDHSPQFLSSTLACITPENLPPLSIICSVHALDFDTGPYGEVTYSIVSPCLVTHGMHPYQDLFAIDPLTGDIHTEQMLDYESVREYCLLVQAKDRGDASASLEVWVEVEGIDEFEPIFTQDQYFFSLREKGQGQQLIGRVEASDADAGVDGEVLYSLRTPSTVFSVNKTNGNIYWVRAPLLGSSQLVKEDTLEVKIIAHSPKPGSKSTSCSVFVNVSLPAEGHHRTVLVHSFSISLVVSLLVFLSLVCTLIVLILRHKQKDPLHSYEEKKTPSSPDADPKLTGAASELKAGQETAEYRGVTGPGEVMPAEWLNLMSVMEKDIIHLFRHSNYSGHCSVDGETAEDKEIQRINENPYRKDSDYALSDQGSRVPDSGIPRDSDQLSCLSGETDVMTSSEVMEASHMFEEGVGGEGCDVIYVQNNALSLRREATAGVLAESRRESFTSGSQEGRCVAPSTQMTSSDDVRGSYAWDYFLSWEPKFQHLASVFNDIARLKDEHMQVPGIPKDTSFVFPPPLITAVAQPGIKAVPPRMPAITLGQVLPKFPRSPLPYHGGSLPEVMTPNFSPSLSLLTMQTPARSPMLPDGESRGTHMLGPWHDRKAEDEVQG
|
[
"GO:0072001",
"GO:0032502",
"GO:0009987",
"GO:0008283",
"GO:0001822",
"GO:0048856",
"GO:0010463",
"GO:0007275",
"GO:0072006",
"GO:0032501",
"GO:0048731",
"GO:0072137",
"GO:0048513",
"GO:0008150"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0009987",
"GO:0032501",
"GO:0008283",
"GO:0048856",
"GO:0007275",
"GO:0010463",
"GO:0072006",
"GO:0048731",
"GO:0048513",
"GO:0072001",
"GO:0001822",
"GO:0072137"
] | null | null |
[
"IPR002126",
"IPR015919",
"IPR020894"
] | null |
10090.ENSMUSP00000141425
|
[
"10090.ENSMUSP00000077574"
] |
[
{
"protein2": "10090.ENSMUSP00000077574",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 70,
"coexpression": 0,
"experimental": 0,
"database": 900,
"textmining": 135,
"combined_score": 912
}
] |
A0A0A6YXZ9
|
Protocadherin gamma subfamily C, 5
| null |
Mus musculus (Mouse)
| 107
| null |
MRPMASPQQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNA
|
[
"GO:0050808",
"GO:0009987",
"GO:0016043",
"GO:0065007",
"GO:0071840",
"GO:1901214",
"GO:1901215",
"GO:0043066",
"GO:0042981",
"GO:0008150",
"GO:0060548",
"GO:0043524",
"GO:0010941",
"GO:0050789",
"GO:0034330",
"GO:0043523",
"GO:0043069",
"GO:0048523",
"GO:0043067",
"GO:0048519",
"GO:0050794",
"GO:0110165",
"GO:0005575",
"GO:0016020"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0050789",
"GO:0048519",
"GO:0071840",
"GO:0048523",
"GO:0050794",
"GO:0016043",
"GO:0060548",
"GO:0010941",
"GO:1901214",
"GO:1901215",
"GO:0034330",
"GO:0043069",
"GO:0043067",
"GO:0050808",
"GO:0043066",
"GO:0042981",
"GO:0043524",
"GO:0043523"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0016020"
] |
[
"IPR031904"
] |
af_db/AF-A0A0A6YXZ9-F1-model_v4.cif.gz
| null | null | null |
A0A0A6YY53
|
Immunoglobulin heavy constant gamma 2C
| null |
Mus musculus (Mouse)
| 335
| null |
XKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRVPITQNPCPPLKECPPCAAPDLLGGPSVFIFPPKIKDVLMISLSPMVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNRALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGFLPAEIAVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKSTWERGSLFACSVVHEGLHNHLTTKTISRSLGK
|
[
"GO:0002455",
"GO:0006952",
"GO:0009605",
"GO:0002449",
"GO:0002376",
"GO:0019724",
"GO:0002443",
"GO:0002252",
"GO:0019730",
"GO:0002250",
"GO:0006950",
"GO:0008150",
"GO:0019731",
"GO:0016064",
"GO:0043207",
"GO:0050896",
"GO:0051707",
"GO:0006955",
"GO:0042742",
"GO:0009607",
"GO:0009617",
"GO:0006959",
"GO:0098542",
"GO:0044419",
"GO:0002460",
"GO:0032991",
"GO:0110165",
"GO:0005575",
"GO:0042571",
"GO:0005576",
"GO:0019814",
"GO:0005615",
"GO:0003823",
"GO:0003674",
"GO:0005488"
] |
[
"GO:0008150",
"GO:0002376",
"GO:0050896",
"GO:0044419",
"GO:0009605",
"GO:0002252",
"GO:0006950",
"GO:0051707",
"GO:0006955",
"GO:0009607",
"GO:0006952",
"GO:0002443",
"GO:0002250",
"GO:0043207",
"GO:0009617",
"GO:0006959",
"GO:0098542",
"GO:0002455",
"GO:0002449",
"GO:0019730",
"GO:0042742",
"GO:0002460",
"GO:0019724",
"GO:0019731",
"GO:0016064"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0003823"
] |
[
"GO:0005575",
"GO:0032991",
"GO:0110165",
"GO:0005576",
"GO:0019814",
"GO:0005615",
"GO:0042571"
] |
[
"IPR007110",
"IPR036179",
"IPR013783",
"IPR003006",
"IPR003597",
"IPR050380"
] | null | null | null | null |
A0A0A8P3N1
|
Lymphocyte antigen 86
| null |
Danio rerio (Zebrafish) (Brachydanio rerio)
| 166
| null |
MKTYFNMLLFLILGLVQMDRAHSQDPQWPLHTICNSNKLTVTYRSCVISDPLQDVGVSFLPCPNKLTDPTTVRIAFILRQSITEFYSSIKLFLNGLHVWGVDEPLCLPQFPRFTFCGSRRGEMITFEMLIKSKVDLPLKGDFNLMVHGINQDGFQIACVNATLSFW
|
[
"GO:0006952",
"GO:0009605",
"GO:0002376",
"GO:0006950",
"GO:0008150",
"GO:0043207",
"GO:0140546",
"GO:0050896",
"GO:0009615",
"GO:0051607",
"GO:0051707",
"GO:0045087",
"GO:0006955",
"GO:0009607",
"GO:0098542",
"GO:0044419"
] |
[
"GO:0008150",
"GO:0002376",
"GO:0050896",
"GO:0044419",
"GO:0009605",
"GO:0006950",
"GO:0051707",
"GO:0006955",
"GO:0009607",
"GO:0006952",
"GO:0043207",
"GO:0009615",
"GO:0045087",
"GO:0098542",
"GO:0140546",
"GO:0051607"
] | null | null |
[
"IPR014756",
"IPR039945",
"IPR003172"
] |
af_db/AF-A0A0A8P3N1-F1-model_v4.cif.gz
|
7955.ENSDARP00000157223
|
[
"7955.ENSDARP00000116931"
] |
[
{
"protein2": "7955.ENSDARP00000116931",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 359,
"coexpression": 391,
"experimental": 880,
"database": 0,
"textmining": 957,
"combined_score": 997
}
] |
A0A0B4JD42
|
Odorant-binding protein 56i, isoform B
| null |
Drosophila melanogaster (Fruit fly)
| 129
| null |
MVVCVQRTQVQAGPIKDQCMAAAGITAQDVANRHETDDPGHSVKCFFRCFLENIGIIADNQIIPGAFDRVLGHIVTAEAVERMEATCNMIKSETSHDESCEFAWQISECYEGVRLSDVKKGQRTRNHRG
|
[
"GO:0000003",
"GO:0008150",
"GO:0019953",
"GO:0110165",
"GO:0005575",
"GO:0005576",
"GO:0005615"
] |
[
"GO:0008150",
"GO:0000003",
"GO:0019953"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005576",
"GO:0005615"
] |
[
"IPR006170",
"IPR036728"
] |
af_db/AF-A0A0B4JD42-F1-model_v4.cif.gz
| null | null | null |
A0A0B4K7D0
|
Limostatin, isoform C
| null |
Drosophila melanogaster (Fruit fly)
| 120
| null |
MTTTMAAPQQQEVPHALLDIETPNQFNYSPSPLAQPDSLRSKPYFDFLSTLYAHDTAKSNLFRPYSVRQRRDADVQKLSRPRRAIVFRPLFVYKQQEIRKQEIRDRNAQRRHDLNRLQRV
|
[
"GO:0046888",
"GO:0009605",
"GO:0009991",
"GO:0048878",
"GO:0065008",
"GO:0009743",
"GO:0065007",
"GO:0010648",
"GO:0023057",
"GO:1903530",
"GO:0051049",
"GO:0055088",
"GO:0051051",
"GO:0008150",
"GO:0042221",
"GO:0090276",
"GO:0002791",
"GO:0090087",
"GO:0042594",
"GO:0050896",
"GO:0050789",
"GO:0050848",
"GO:0010646",
"GO:0071310",
"GO:0009267",
"GO:0055090",
"GO:0033554",
"GO:0031667",
"GO:0070887",
"GO:0032879",
"GO:0042593",
"GO:0050794",
"GO:0009966",
"GO:0042592",
"GO:0048583",
"GO:0033500",
"GO:0051716",
"GO:0023051",
"GO:0009987",
"GO:0002792",
"GO:1901700",
"GO:0031668",
"GO:0071322",
"GO:0051046",
"GO:0006950",
"GO:0010817",
"GO:0071496",
"GO:0048523",
"GO:0070328",
"GO:0048519",
"GO:0031669",
"GO:1901701",
"GO:0010033",
"GO:0090278",
"GO:1902531",
"GO:0007154",
"GO:0051048",
"GO:1903531",
"GO:0046883"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050896",
"GO:0050789",
"GO:0042592",
"GO:0009987",
"GO:0048519",
"GO:0009605",
"GO:0048878",
"GO:0065008",
"GO:0023057",
"GO:0051051",
"GO:0042221",
"GO:0032879",
"GO:0050794",
"GO:0048583",
"GO:0051716",
"GO:0023051",
"GO:0006950",
"GO:0048523",
"GO:0007154",
"GO:0046888",
"GO:0009991",
"GO:0010648",
"GO:1903530",
"GO:0051049",
"GO:0055088",
"GO:0042594",
"GO:0010646",
"GO:0033554",
"GO:0070887",
"GO:0009966",
"GO:0033500",
"GO:1901700",
"GO:0031668",
"GO:0010817",
"GO:0071496",
"GO:0010033",
"GO:0051048",
"GO:1903531",
"GO:0046883",
"GO:0009743",
"GO:0090276",
"GO:0090087",
"GO:0071310",
"GO:0009267",
"GO:0055090",
"GO:0031667",
"GO:0042593",
"GO:0002792",
"GO:0051046",
"GO:0031669",
"GO:1901701",
"GO:0090278",
"GO:1902531",
"GO:0002791",
"GO:0050848",
"GO:0071322",
"GO:0070328"
] | null | null | null |
af_db/AF-A0A0B4K7D0-F1-model_v4.cif.gz
| null | null | null |
A0A0B4KEW8
|
Pawn, isoform C
| null |
Drosophila melanogaster (Fruit fly)
| 1,343
| null |
MRRKPQNLTHSIPSSRAGDRGGGGGGVGRGTSRPSAISNNRRPRDHRHLMAMVVSTLPLALLLLLVQTTAGQHESVSQISPKSSSHRSPDRQRIESTMADSVNGLAEGQSSPLDVNDNETRAERVERSASPILHDRQPIGPNDVHFPEDLEKDVSAGRYFHYNIKPTGTFDNQDEQPERTHQGIRAGKTLSQGGSSSEQSFLGRGDLRPLVSGSPIRPSPSNTATSATAASATQAPHSPRQNGNPDIQDIITGIVKLLNGNVNVHANTQGIRRPSASRINNRGPPRISEAQNLPIDYEAQKPGTSMRPPPYPFDRPERPFITGVPIPEQIVPVRPGFVSNRPPWYRNKPRPPIATSVGGNRRPLPQYKPLPAPPVQAPLQPQDPLDRKNEQEKEQNHQEQPQPTDDVVLPTDTTYDSEFSNEDANAQYIEVSDQDTDATGGEVEDELQPPPPPPSTTNNPPTTPTNPSKKKHKPKPGSEKKKLPEESPQDEGFSTIIETSSVVHTVMGMSSTYVPMSMDSSESLGLDPSTEEVIFMTANRTPTLEPSVTSSLGTSSSSNPASAIQPTSSKEHTKTTTTTTTTTSSSTSTTTSTTTPPSTESVSPNSSNANTNATPPAPYHPRPGIVLDDPEFKPGGRPRPPVQRPPAQQTLPLPAVQPTRQHLPPGYGEIFDVTLSAIQGPGPKGSGSQQTINIKPYGSYAAGGGQGDIIVSASDPPAGATTPATRLPQLPGSGSGSGSGSGTGSGGASTPGVGVSSGGGGGSGSSISPAAPANAVTQSSGGYVVPETEVVDLQGHSKPQGGAPTTNAGPTRPHYRQRPTQPPVRIDTCIVGDDSTCDQAQHERCKTDNGVSSCHCRPGYSRRKHREPCRRVISFHLGMRVDRIYEHRIVWDTKLMDKHSEPFGQLSYESIRALDSAMSMTPYSDEFMEAKVNNIYRGDPNLGGSGVYVNMTIKLDESVETLRPNLRSDVQKHLLGVLHRRNNNIGNSVLYVSSPEGAVSALQDLDECQSPELNDCHSGASCSNTWGSFRCACEAGLRDPWADQPARSGRECQACADSVCNNHGTCSYAEDGAQLCTCDSSHYGAQCEIDGEVLGVAIGASVAAIIIIVLTLVCLIMWSRRWQREQKNAMGSPVFGYMNTAPLKSAGLPQAGYQVTLEDRMRWAQIADVMAQTNHYGQAEPIGPTRPSSAMFAYPNLGAMGMGTLGGMSLQSTMQMHPSATLAPPVPLPRRLGLGPRSNGMRTLENSSSSEEEDRADLLGRNFQVPRPKSRSNGSIANQSGIYYDVDYEPSGNGIGNSSVDHLYGSQNQSVTHSSGHSHIPGPQGIPMSTYTSGRAPSSYYMK
|
[
"GO:0032502",
"GO:0022416",
"GO:0048856",
"GO:0008407",
"GO:0009653",
"GO:0009887",
"GO:0048513",
"GO:0008150",
"GO:0007423"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0048856",
"GO:0009653",
"GO:0009887",
"GO:0048513",
"GO:0008407",
"GO:0007423",
"GO:0022416"
] | null | null |
[
"IPR050751",
"IPR001881",
"IPR000742",
"IPR000152",
"IPR018097",
"IPR049883"
] | null | null | null | null |
A0A0B4KEZ2
|
Nervy, isoform D
| null |
Drosophila melanogaster (Fruit fly)
| 757
|
Nucleus {ECO:0000256|ARBA:ARBA00004123}.
|
MMALDGKAIIKEEITDKDAYDAAAAAAAAVAAGAALAVASAAAVQVPPASSSSAGSASSAAAAATNNTTSAAATAAAISRRLKASSSGGDKSSTSSSSSKDSSHTSSSRSERDRERERERERERDRLCRTPPDSPPDSSRSLAPRSPHSPLQLHQHPQRNASVSPVVNGSSSGGGGVGSSGTSPTPTPGSQHAASLAAAAAAAAAAHVEQARLVSKMRKFLGALVQFSQELGQPEVCERVRALVLSLCSGSISVEEFRLALQEAINLPLRPYVVPLLKNSIALVQREILALARATNQSALQYVTNNEQAVMEFAPHGVASAEFGDIFIQLEAPTSNGSSAVFKRRSSDSMMEHGGHNGLQEWNEYMASGGAGYPPPPSKRLTLHPAHSVVAYGEYGVSSAEGLPSAAAFMQRDERDLRMSEAQARHAAPPQRAGNPQPNPNAAAPGAPGAGGEEEWKNIHTMLNCISAMVDKTKRAITILQQRGIEPQHPNSGQEVTPAAMAELRRQTEEKVAEFKRNAEDAVTQVKRQAVIEIQRAVVAAETRAAEIMTQERLRMEKFFMEMSRHSSGERDLDNKSPSMASAQNGSNLQQQCWNCGRKATETCSGCNMARYCSASCQYRDWDSHHQVCGNTRASELSAKHLHSASNLSLRNAMATRSPPTPNSAAHLQAAAAAAAAAAGAREAVSAPVGGPGAGIAVGTGAGSGGQSGGGGGGGGGGGGGAAAAAVAAATPGALVANGLGSKXRIRMMKPKKKYLC
|
[
"GO:0032989",
"GO:0009605",
"GO:0040011",
"GO:0000902",
"GO:0048667",
"GO:0048869",
"GO:0048856",
"GO:0022008",
"GO:0007275",
"GO:0009653",
"GO:0009887",
"GO:0000904",
"GO:0007411",
"GO:0030030",
"GO:0008150",
"GO:0042221",
"GO:0007399",
"GO:0050896",
"GO:0022416",
"GO:0048468",
"GO:0042330",
"GO:0030154",
"GO:0031175",
"GO:0097485",
"GO:0032990",
"GO:0048731",
"GO:0048513",
"GO:0007423",
"GO:0048812",
"GO:0048699",
"GO:0032502",
"GO:0009987",
"GO:0016043",
"GO:0071840",
"GO:0120039",
"GO:0120036",
"GO:0061564",
"GO:0006935",
"GO:0048858",
"GO:0007409",
"GO:0008407",
"GO:0030182",
"GO:0032501",
"GO:0048666",
"GO:0005622",
"GO:0043229",
"GO:0043226",
"GO:0110165",
"GO:0005575",
"GO:0043227",
"GO:0005634",
"GO:0043231"
] |
[
"GO:0008150",
"GO:0040011",
"GO:0050896",
"GO:0032502",
"GO:0009987",
"GO:0032501",
"GO:0009605",
"GO:0048869",
"GO:0048856",
"GO:0007275",
"GO:0009653",
"GO:0042221",
"GO:0042330",
"GO:0071840",
"GO:0032989",
"GO:0000902",
"GO:0009887",
"GO:0048468",
"GO:0030154",
"GO:0048731",
"GO:0048513",
"GO:0016043",
"GO:0006935",
"GO:0022008",
"GO:0000904",
"GO:0030030",
"GO:0007399",
"GO:0097485",
"GO:0032990",
"GO:0007423",
"GO:0048858",
"GO:0008407",
"GO:0030182",
"GO:0048666",
"GO:0048667",
"GO:0007411",
"GO:0022416",
"GO:0031175",
"GO:0048699",
"GO:0120039",
"GO:0120036",
"GO:0048812",
"GO:0061564",
"GO:0007409"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0043229",
"GO:0043227",
"GO:0043231",
"GO:0005634"
] |
[
"IPR013289",
"IPR013293",
"IPR014896",
"IPR037249",
"IPR003894",
"IPR002893"
] | null |
7227.FBpp0303462
| null | null |
A0A067YRV0
|
Zinc finger FYVE domain-containing protein 26
|
Phosphatidylinositol 3-phosphate-binding protein required for the abscission step in cytokinesis: recruited to the midbody during cytokinesis and acts as a regulator of abscission. May also be required for efficient homologous recombination DNA double-strand break repair. {ECO:0000256|ARBA:ARBA00044939}.
|
Danio rerio (Zebrafish) (Brachydanio rerio)
| 2,269
| null |
MHPFGREEETSRRELFGFFRRCLQRGEWELAAACVSQLGEARAEDPHSPRDIVKAIVTHPYPLRWETVGSPHRLAWYWLQVLERPTEIKVSVSVKRELEFLLLLEELEDIPQSVLKELHEAFLYSEEVKGKAPGDSASPLSAALLSCLRSLLTRQQPRLCHSLISFLSNGDPSRDHTLQDAFIQHLTEQVKVPAKDRNREWVEQVCSVLALAPWGSDRSGAQLEPLWEGLWAAREGLMTEERILGCLLRPQSQALLMAYSSTALRLLKDKLLAEAPHTQVDLPDLERVMLGLCCHKDKRLAWKAIYFECLSSGKHFLEQVLLTGLDLIKREEFSKLETLLHSEFQPLSRLLLLLGWMHCQSLESAKTLLTVLHHRQPQSNDSALSDLACTLSCQLGVLEWCTQNNPGISHDALLSHLHMLDHHSALYVLHCLTPLAKFEEHKVLELLQRTGDPSQVDSPSSSVQRNITLFRGFCAMKYALYAISVNARTHAHTGSLDCEPLHELQTEAAQEDETAEGCSNLFQHYLSECQLYLEAVPALFRLELLENIFSLLFLSDSDFTQQTSTATETQPYTNTETSKPKSTKEVNTAEHFLKAENEGERMDELNQINPQLGHLTSGCRGFLVDLNVMEGILRLVREGLEGVCGVGQEDGRALGADVELAESLGCSVTAETFSARLQRLSKYTAEAQWRLQIVTSNHGNGNDGLYLPSPLPSPALPLKRQGSGSSGTSSRRRRKHHRHRSERHVSSERQNGEVSTSTSDGGVCVSVVCRGTETCPCGGSHSWLVPAMLSPPESLLIACIRRGNYIEAQQVIAMYGLENSECAGELVFMDRYREVLIELAQVEQKIESQSLSTSSSSSEGLGTLGATPAGRTRMGSSSRLTLKSIGSAAAAGMAFYSISDVADRLMSTPSRPIPCLEDSYWLSQCTIDSPDFVRPLVEELSPAAMAAFDLSCCQCQLWKTSRQLLETAERRLSSFLEARGVRVDPKVPHANGIRGFPSVLQQISKILNKTSTNKGMSKTDCNGEENAVCSPFGCSAQEVLLSCHSTLTEESITIQQNLNQRLEVTLQTLSSATNTSVDSLVGSNLLTALAEQAALKQSELDCHPVRTAMKQLLQYLDQLCPLVPDGAPDRPDYIRSFFDYVNVLASVLVRSLGSEDQSTVVKLGNPLLLLLQSPAQLLSHLLFDRQVSPDRVLSLLQQERLRLSVQQVVVQRCCETLPLWDSRAVNFSQRVSGLNGGAFCPASIASILQQYAQDCSPSLDLSDPTTTSDPSSESEVSVEDVSAASTSLSTSPPSPSSSSPSSSFLLTPSALSFLKSRSPLVAALACLSASRGGVTRVTSSGWSGLPSYFRGSGRKEAVLDGEQISREGEALLKNFPILRMYLRTMAEPVLGVSLEADEGLGVALCGKPVVGMLFSGLQGNAAQAMAAEAFQQALNNGDLNRALDLLELYAQPCSQEGALRDKLLAFTALQESSSAEQLFRVRDWELRGRVVLQGLDRWPLQQCLDLLHFCLSDQNTKDPLREQLQQRKQELDMYQRMLRLQPSLPWETWQELREESTKNPESVFSQMLEAREFELCAQWVQLYSVSDQSGMQLQTEHLLYLLEHNHTEEAFQLLEALSDSMGLEVSERALDRRPGLAACHFLSDYLTLHFQSQMTPARRRHIHALHLGSKVLLTLPEASRQDYFSLLSDPLLMLEQMLMNLKVDWAAVAITTLRSLLLAQDAGITTQHIDTLLADYARKALDFPYAPREWSRSDSVISLQDAFLQCPAQESCPSSPSHTPPPSTGGTPMQTPSSERRPSGKKIRPLATPFTPPEKTPDRKDWIPDHKQHICMVCQRERFTMFNRRHHCRRCGRLVCHSCSSKKMAVAGFDEPVRVCDQCYNFFHTDSDEELEQGEAGSPSSIDEVLNGVLSLPEVSRKQYRLSPNPAENQQLKSEFYYEQAPSASLCVAILTLHSDHAACGQQLIDHCRSLSRKLTNPEVDARLLTDVMRQLLFSAKLMFVNAGCTQEPALCDSYISKVDVLKILVTANYKYIPSLDDIQETAAVTRLRNQLLELEYYQLAVEVSTKSALDPNGVWQAWAMASLKAGNLSGAREKFVRCLKAPVDRNQLNHGPRLLQEIIQHLESTVKLTLSQTMDEDILASLRELEEALSDSAPPEGTESKVQRCNFHQECLFYLFTYGTHLSLISFYLRHDCLKDALTYLQNKGCSDDVFLEGIFQPCLERGRLGALQGLLENLDPTLETWGRYLLSACQLLQRRGHYHSLTTFVLR
|
[
"GO:0032989",
"GO:0000902",
"GO:0019953",
"GO:0007276",
"GO:0048667",
"GO:0048869",
"GO:0048856",
"GO:0022008",
"GO:0007281",
"GO:0007275",
"GO:0009653",
"GO:0000904",
"GO:0030030",
"GO:0008150",
"GO:0007399",
"GO:0022412",
"GO:0007292",
"GO:0048468",
"GO:0030154",
"GO:0031175",
"GO:0048599",
"GO:0032990",
"GO:0048731",
"GO:0048699",
"GO:0048812",
"GO:0048477",
"GO:0022414",
"GO:0032502",
"GO:0009987",
"GO:0016043",
"GO:0071840",
"GO:0009994",
"GO:0120039",
"GO:0120036",
"GO:0061564",
"GO:0032504",
"GO:0003006",
"GO:0048858",
"GO:0048609",
"GO:0007409",
"GO:0030182",
"GO:0000003",
"GO:0032501",
"GO:0048666"
] |
[
"GO:0008150",
"GO:0022414",
"GO:0032502",
"GO:0009987",
"GO:0000003",
"GO:0032501",
"GO:0019953",
"GO:0048869",
"GO:0048856",
"GO:0007275",
"GO:0009653",
"GO:0022412",
"GO:0071840",
"GO:0032504",
"GO:0003006",
"GO:0048609",
"GO:0032989",
"GO:0000902",
"GO:0007276",
"GO:0007281",
"GO:0048468",
"GO:0030154",
"GO:0048731",
"GO:0016043",
"GO:0009994",
"GO:0022008",
"GO:0000904",
"GO:0030030",
"GO:0007399",
"GO:0007292",
"GO:0048599",
"GO:0032990",
"GO:0048477",
"GO:0048858",
"GO:0030182",
"GO:0048666",
"GO:0048667",
"GO:0031175",
"GO:0048699",
"GO:0120039",
"GO:0120036",
"GO:0048812",
"GO:0061564",
"GO:0007409"
] | null | null |
[
"IPR028730",
"IPR000306",
"IPR017455",
"IPR011011",
"IPR013083"
] | null | null | null | null |
A0A087WNQ6
|
Sycp3 like Y-linked
| null |
Mus musculus (Mouse)
| 110
| null |
METLKVFLGTGDVRNDIYKTLHIKRKWMETYVKESFKGSNQKLERFCKTNERERKNINNKFCEQYITTFQKSDMDVQKFNEEKEKSVNSCQKEQQALKLSKCSQNQTLEA
|
[
"GO:0032502",
"GO:0019953",
"GO:0060255",
"GO:0007276",
"GO:0048869",
"GO:0009987",
"GO:0065007",
"GO:0009566",
"GO:0008150",
"GO:0022412",
"GO:0032504",
"GO:0003006",
"GO:0048232",
"GO:0007530",
"GO:0050789",
"GO:0019222",
"GO:0048609",
"GO:0030154",
"GO:0007338",
"GO:0000003",
"GO:0007283",
"GO:0010468",
"GO:0032501",
"GO:0048515",
"GO:0022414",
"GO:0005622",
"GO:0043229",
"GO:0043226",
"GO:0110165",
"GO:0005737",
"GO:0005575",
"GO:0043227",
"GO:0005634",
"GO:0043231",
"GO:0005515",
"GO:0005488",
"GO:0003674"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0009987",
"GO:0065007",
"GO:0050789",
"GO:0000003",
"GO:0032501",
"GO:0022414",
"GO:0019953",
"GO:0048869",
"GO:0009566",
"GO:0022412",
"GO:0032504",
"GO:0003006",
"GO:0019222",
"GO:0048609",
"GO:0060255",
"GO:0007276",
"GO:0007530",
"GO:0030154",
"GO:0007338",
"GO:0007283",
"GO:0048515",
"GO:0048232",
"GO:0010468"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0005515"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0005737",
"GO:0043229",
"GO:0043227",
"GO:0043231",
"GO:0005634"
] |
[
"IPR051443",
"IPR006888"
] |
af_db/AF-A0A087WNQ6-F1-model_v4.cif.gz
| null | null | null |
A0A097HUX0
|
25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (EC 1.14.15.18) (25-hydroxyvitamin D-1alpha-hydroxylase)
| null |
Danio rerio (Zebrafish) (Brachydanio rerio)
| 505
| null |
MMMVLHQALKVTGRSALPLLRFAERWADVIRAPPTPQVKTLEQMPGPSPARFIRDLFMKRGFSRLHQLQLEGRQKYGPMWKASFGPILTVHVAEPELIQQVLRQEGQHPVRSELSSWKDYRALRGEGYGLLTAEGEEWQCVRSLLSKHMLRPQAVEAYDGALNAVVSDLLQKLKLRSQESSSRIVSDISAEFYRFGLEGISSVLFESRIGCLDAVVPVETERFIQSINTMFVMTLLTMAMPQWLHRLLPKPWDTFCRCWDVMFEFAKGHIDQRLQEEKQKLECGEQLEGRYLTYFLSQAGLPLTSVYSNVTELLLAGVDTISSTLSWSLYELSRHPDVQTALRDEVLSVMKDRSVPQASDVAAMPLLKAVVKEILRLYPVIPANARVINKDIEVGGYVIPKNTLITLCHYATSRDPQQFRDPDSFRPQRWGDRSDRSHPYATVPFGVGKRSCIGRRIAELEVYLALSRILMHFTMEPVRENDTVHPMTRTLLVPERQIDLRFTER
|
[
"GO:0032502",
"GO:0030097",
"GO:0048468",
"GO:0009987",
"GO:0071425",
"GO:0008283",
"GO:0048856",
"GO:0048869",
"GO:0030154",
"GO:0072089",
"GO:0008150",
"GO:0016709",
"GO:0004498",
"GO:0003674",
"GO:0016705",
"GO:0003824",
"GO:0004497",
"GO:0016491"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0009987",
"GO:0008283",
"GO:0048856",
"GO:0048869",
"GO:0048468",
"GO:0030154",
"GO:0072089",
"GO:0030097",
"GO:0071425"
] |
[
"GO:0003674",
"GO:0003824",
"GO:0016491",
"GO:0016705",
"GO:0004497",
"GO:0016709",
"GO:0004498"
] | null |
[
"IPR050479",
"IPR001128",
"IPR017972",
"IPR002401",
"IPR036396"
] |
af_db/AF-A0A097HUX0-F1-model_v4.cif.gz
| null | null | null |
A0A0A6YWR3
|
Signal-regulatory protein beta 1A
| null |
Mus musculus (Mouse)
| 182
| null |
MLLLDAWTHIPHSVLLLILLLGFKDVTKRNNMDFSIRISNVTPADSGTYYCVKFQRGSSEPDIEIQSGGGTELLVLAKPSSPMVSGPAARAVPQQTVTFTCRSHGFFPRNLTLKWFKNGDEISHLETSVEPEETSVSYRVSSTVQVVLEPRDVRSQIICEVDHVTLDRAPLRGIAHISEFIQ
|
[
"GO:0051234",
"GO:0051716",
"GO:0051649",
"GO:0051641",
"GO:0009987",
"GO:0060627",
"GO:0065007",
"GO:0023052",
"GO:0051179",
"GO:0050764",
"GO:0050794",
"GO:0016192",
"GO:0048518",
"GO:0051049",
"GO:0008150",
"GO:0006909",
"GO:0035556",
"GO:0050896",
"GO:0050789",
"GO:0051050",
"GO:0032879",
"GO:0007154",
"GO:0007165",
"GO:0006810",
"GO:0050766",
"GO:0071944",
"GO:0005575",
"GO:0110165",
"GO:0016020",
"GO:0005886"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0023052",
"GO:0051179",
"GO:0048518",
"GO:0050896",
"GO:0050789",
"GO:0051234",
"GO:0051716",
"GO:0051641",
"GO:0050794",
"GO:0051050",
"GO:0032879",
"GO:0007154",
"GO:0007165",
"GO:0051649",
"GO:0060627",
"GO:0051049",
"GO:0035556",
"GO:0006810",
"GO:0050766",
"GO:0050764",
"GO:0016192",
"GO:0006909"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0071944",
"GO:0016020",
"GO:0005886"
] |
[
"IPR051755",
"IPR007110",
"IPR036179",
"IPR013783",
"IPR003597",
"IPR013106"
] |
af_db/AF-A0A0A6YWR3-F1-model_v4.cif.gz
| null | null | null |
A0A0A6YX79
|
Protocadherin 1
| null |
Mus musculus (Mouse)
| 45
| null |
MGPLRPSPGPGGQRLLLPPLLLALLLLLAPSASHTTQVVYKVPEE
|
[
"GO:0098609",
"GO:0009987",
"GO:0007155",
"GO:0016339",
"GO:0008150",
"GO:0007156",
"GO:0098742",
"GO:0110165",
"GO:0070161",
"GO:0005911",
"GO:0071944",
"GO:0005575",
"GO:0016020",
"GO:0005886",
"GO:0030054",
"GO:0005515",
"GO:0005488",
"GO:0003674"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0007155",
"GO:0098609",
"GO:0098742",
"GO:0016339",
"GO:0007156"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0005515"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0071944",
"GO:0016020",
"GO:0030054",
"GO:0070161",
"GO:0005886",
"GO:0005911"
] | null |
af_db/AF-A0A0A6YX79-F1-model_v4.cif.gz
| null | null | null |
A0A0A6YYP6
|
Signal-regulatory protein beta 1A
| null |
Mus musculus (Mouse)
| 397
| null |
MLLLDAWTHIPHSVLLLILLLGFKGAAVRELKVIQPVKSFFVGAGGSATLNCTVTSLLPVGPIRWYRGVGQSRLLIYPFTGEHSPRITNVSDVTKRNNMDFSIRISNVTPADSGTYYCVKFQRGSSEPDIEIQSGGGTELLVLAKPSSPMVSGPAARAVPQQTVTFTCRSHGFFPRNLTLKWFKNGDEISHLETSVEPEETSVSYRVSSTVQVVLEPRDVRSQIICEVDHVTLDRAPLRGIAHISEFIQVPPTLEIRQQPTMVWNVINVTCQIQKFYPPSFQLTWLENGNISRREVPFTLIVNKDGTYNWISCLLVNISALEENMVVTCKVEHDEQAEVIETHTVLVTEHQRVKGTATKSELKTAGIAKIPVAVLLGSKILLLIAATVIYMHKKQNA
|
[
"GO:0051234",
"GO:0051716",
"GO:0051649",
"GO:0051641",
"GO:0009987",
"GO:0060627",
"GO:0065007",
"GO:0023052",
"GO:0051179",
"GO:0050764",
"GO:0050794",
"GO:0016192",
"GO:0048518",
"GO:0051049",
"GO:0008150",
"GO:0006909",
"GO:0035556",
"GO:0050896",
"GO:0050789",
"GO:0051050",
"GO:0032879",
"GO:0007154",
"GO:0007165",
"GO:0006810",
"GO:0050766",
"GO:0071944",
"GO:0005575",
"GO:0110165",
"GO:0016020",
"GO:0005886"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0023052",
"GO:0051179",
"GO:0048518",
"GO:0050896",
"GO:0050789",
"GO:0051234",
"GO:0051716",
"GO:0051641",
"GO:0050794",
"GO:0051050",
"GO:0032879",
"GO:0007154",
"GO:0007165",
"GO:0051649",
"GO:0060627",
"GO:0051049",
"GO:0035556",
"GO:0006810",
"GO:0050766",
"GO:0050764",
"GO:0016192",
"GO:0006909"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0071944",
"GO:0016020",
"GO:0005886"
] |
[
"IPR051755",
"IPR007110",
"IPR036179",
"IPR013783",
"IPR003597",
"IPR003599",
"IPR013106"
] |
af_db/AF-A0A0A6YYP6-F1-model_v4.cif.gz
| null | null | null |
A0A0B4K6C1
|
Shal K[+] channel interacting protein, isoform G
| null |
Drosophila melanogaster (Fruit fly)
| 1,034
| null |
MAVSNIVCEWLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSIRSLREKGAASVYFMLNDPNSLSGSMEILCETPPNNELELVLREQLETDGVRLTAHPYSTPDGQRGHLEGLASVYCELLMAPFGDILATIERARQAAWAERSPLHSAAQVVGGSGGAGGSTGSGSGGAASGGSGGSSGVLHHRQQHGHRGHSMHGAGLPNSHSQPIYVPGKYSPSSCLSDKEEDEIYGFGYGVFAPRVARGGLTQQQQLLQQQTLQTQQSIQQQQQQMQQQQQQLPIVPGQQQQGPHQHQTLPPNVAHLNFVQQNCLSPRSAYFYEFPPTAEGRETKKRTTLARLLKGLKTVNRRDRNNQQNGAQARAANDRLRHFQMINGGAGGQQHSFEETIHRLKVQEAMRKKEKFQREHEEILRDIRQGLLQMSRGEGRMDDTYMYDEALRTGGGMGIAGLGMPLGVGGNGGGGGAAHYAGGRVRFSNNRESTGVISLRSAGDISLPQRGPPRRGLIVPQQPPNPPTIIPLTHARSHDRESGDYAGSISDLQSVTSRFSTVSIGTNNCTARYRTLSGGIGESPSLSPSPSSDYEDIGVTRGHGCLPPSLLAAKAKKNGLPHGKANTICQKATVHHSGEMRSSAKEIGAFNENGRNFVATKDTSRDFSNSQDNTDRGSMSDQAFACSASSVESLPSASGSSTQALVRPGSPHSSISAEDRTSMASCICKAKALVDSLPNPYDKEALKFKKGDLIDVLSMNASGIWKGRCHGRVGHFKFINVEVLPEQRMKNSSSKTLAAGSRLANSGNGSHNGGPCSVEDLLIRIGLKEYTSVFVLNGYEDLELFKELEPADLDYLGILNQEHRAKLLTAVQLLHDIESTNFARTGSDVDIPGSSSENDEARLNNINMKHGASPFGRRHFPRDSGCYEGSPLPSSQTPTQAVNSTDESNSLDDVVTKCSSEIMKRVESARRCKDNPFKTTLPGGGRLGKKSFLGGNGLMADDTLTRGGLSEKSSDSGVSSSSLSSGPLKSST
|
[
"GO:0003008",
"GO:0050877",
"GO:0007600",
"GO:0007606",
"GO:0032501",
"GO:0008150",
"GO:0007608"
] |
[
"GO:0008150",
"GO:0032501",
"GO:0003008",
"GO:0050877",
"GO:0007600",
"GO:0007606",
"GO:0007608"
] | null | null |
[
"IPR001660",
"IPR051725",
"IPR013761",
"IPR036028",
"IPR001452"
] |
af_db/AF-A0A0B4K6C1-F1-model_v4.cif.gz
| null | null | null |
A0A0B4K7N3
|
Antares, isoform B
| null |
Drosophila melanogaster (Fruit fly)
| 272
|
Secreted {ECO:0000256|ARBA:ARBA00004613}.
|
MKMWYLYLFLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALKTGILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHFSRASVNNLVPYEEGQIPAGKCATGPSQMYQFLCSEDEYVDANSMVVESNMPSSDQIQVDI
|
[
"GO:0046692",
"GO:0019953",
"GO:0065008",
"GO:0060180",
"GO:0019098",
"GO:0065007",
"GO:0045924",
"GO:0044706",
"GO:0045434",
"GO:0007621",
"GO:0008150",
"GO:0007320",
"GO:0032504",
"GO:0007620",
"GO:0007617",
"GO:0048609",
"GO:0046008",
"GO:0046693",
"GO:0000003",
"GO:0032501",
"GO:0007610",
"GO:0044703",
"GO:0022414",
"GO:0110165",
"GO:0005575",
"GO:0005576",
"GO:0005615"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0000003",
"GO:0032501",
"GO:0022414",
"GO:0019953",
"GO:0065008",
"GO:0019098",
"GO:0044706",
"GO:0032504",
"GO:0048609",
"GO:0007610",
"GO:0044703",
"GO:0046692",
"GO:0045924",
"GO:0007320",
"GO:0007617",
"GO:0060180",
"GO:0007621",
"GO:0007620",
"GO:0046008",
"GO:0046693",
"GO:0045434"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0005576",
"GO:0005615"
] |
[
"IPR014044",
"IPR035940",
"IPR034763"
] |
af_db/AF-A0A0B4K7N3-F1-model_v4.cif.gz
|
7227.FBpp0297539
|
[
"7227.FBpp0086228",
"7227.FBpp0079243",
"7227.FBpp0311701",
"7227.FBpp0290920",
"7227.FBpp0307158",
"7227.FBpp0084680",
"7227.FBpp0087560",
"7227.FBpp0311741",
"7227.FBpp0077991",
"7227.FBpp0083547",
"7227.FBpp0083834",
"7227.FBpp0079415",
"7227.FBpp0084682",
"7227.FBpp0307765"
] |
[
{
"protein2": "7227.FBpp0086228",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 242,
"experimental": 0,
"database": 0,
"textmining": 669,
"combined_score": 738
},
{
"protein2": "7227.FBpp0079243",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 385,
"experimental": 0,
"database": 0,
"textmining": 653,
"combined_score": 777
},
{
"protein2": "7227.FBpp0311701",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 285,
"experimental": 0,
"database": 0,
"textmining": 606,
"combined_score": 706
},
{
"protein2": "7227.FBpp0290920",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 185,
"experimental": 0,
"database": 0,
"textmining": 893,
"combined_score": 909
},
{
"protein2": "7227.FBpp0307158",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 410,
"experimental": 0,
"database": 0,
"textmining": 606,
"combined_score": 757
},
{
"protein2": "7227.FBpp0084680",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 178,
"experimental": 0,
"database": 0,
"textmining": 705,
"combined_score": 747
},
{
"protein2": "7227.FBpp0087560",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 198,
"experimental": 0,
"database": 0,
"textmining": 891,
"combined_score": 908
},
{
"protein2": "7227.FBpp0311741",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 512,
"experimental": 0,
"database": 0,
"textmining": 492,
"combined_score": 741
},
{
"protein2": "7227.FBpp0077991",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 126,
"experimental": 0,
"database": 0,
"textmining": 799,
"combined_score": 816
},
{
"protein2": "7227.FBpp0083547",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 458,
"experimental": 0,
"database": 0,
"textmining": 666,
"combined_score": 811
},
{
"protein2": "7227.FBpp0083834",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 201,
"experimental": 0,
"database": 0,
"textmining": 651,
"combined_score": 709
},
{
"protein2": "7227.FBpp0079415",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 501,
"experimental": 0,
"database": 0,
"textmining": 670,
"combined_score": 828
},
{
"protein2": "7227.FBpp0084682",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 450,
"experimental": 0,
"database": 0,
"textmining": 911,
"combined_score": 948
},
{
"protein2": "7227.FBpp0307765",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 204,
"experimental": 0,
"database": 0,
"textmining": 890,
"combined_score": 908
}
] |
A0A0B4KEI1
|
Uncharacterized protein, isoform C
| null |
Drosophila melanogaster (Fruit fly)
| 136
|
Mitochondrion membrane {ECO:0000256|ARBA:ARBA00004325}.
|
MYIHISENNTVAISLTDRLKASKLTRRGNKFSNLFKMSSNSLFETDEDVAQANKLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGLAYTMAKEYLLHEEPKSNTRPDE
|
[
"GO:0098771",
"GO:0050801",
"GO:0042592",
"GO:0048878",
"GO:0008150",
"GO:0055070",
"GO:0055080"
] |
[
"GO:0008150",
"GO:0042592",
"GO:0048878",
"GO:0098771",
"GO:0050801",
"GO:0055070",
"GO:0055080"
] | null | null |
[
"IPR007667",
"IPR050355"
] |
af_db/AF-A0A0B4KEI1-F1-model_v4.cif.gz
|
7227.FBpp0302903
|
[
"7227.FBpp0078918",
"7227.FBpp0082459",
"7227.FBpp0078919",
"7227.FBpp0100180",
"7227.FBpp0100177"
] |
[
{
"protein2": "7227.FBpp0078918",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 103,
"experimental": 684,
"database": 0,
"textmining": 164,
"combined_score": 742
},
{
"protein2": "7227.FBpp0082459",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 46,
"experimental": 684,
"database": 0,
"textmining": 169,
"combined_score": 727
},
{
"protein2": "7227.FBpp0078919",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 101,
"experimental": 684,
"database": 0,
"textmining": 164,
"combined_score": 741
},
{
"protein2": "7227.FBpp0100180",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 773,
"database": 0,
"textmining": 186,
"combined_score": 807
},
{
"protein2": "7227.FBpp0100177",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 773,
"database": 0,
"textmining": 170,
"combined_score": 803
}
] |
A0A0B4KEQ6
|
Uncharacterized protein, isoform D
| null |
Drosophila melanogaster (Fruit fly)
| 72
|
Mitochondrion membrane {ECO:0000256|ARBA:ARBA00004325}.
|
MLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGLAYTMAKEYLLHEEPKSNTRPDE
|
[
"GO:0098771",
"GO:0050801",
"GO:0042592",
"GO:0048878",
"GO:0008150",
"GO:0055070",
"GO:0055080"
] |
[
"GO:0008150",
"GO:0042592",
"GO:0048878",
"GO:0098771",
"GO:0050801",
"GO:0055070",
"GO:0055080"
] | null | null |
[
"IPR007667",
"IPR050355"
] |
af_db/AF-A0A0B4KEQ6-F1-model_v4.cif.gz
| null | null | null |
A0A060IVL7
|
Tripartite motif containing 69 protein
| null |
Danio rerio (Zebrafish) (Brachydanio rerio)
| 548
| null |
MRETPANFQQDQNPETPPILSPSQQESQSRRARRTEQSMSSSLPAQNKMDKQKLRPEIPPRVSKSSAQRLSRDLTCSICLDLFKQPVSLPCDHTFCEACITSYWSGPRVKCQAGSGSCPQCRKVFHGKSYRPNRIVANIVESYCQGMEESGVRLGAVSEPAPTTPLCMRHREELKLYCEEDQELVCLVCGISQDHRAHTLVCVQDAQKRYRASLTTSANALQKELNTALECERETEEEVKKLKDHTADLKQRIEAQFSELHQFLYQEEKLLQVKLKTEERRELIRLDEHKALLSVEISRLRRAVNDIEDKLSEQDPYTLLRSIKGLLQRQPPKFERPTLTPPSLCEGRFAGPLQYRVWKSLKGSIYPVPSAITFNSKTANPWLSLTSSLTCVRYQTFNSSVQDNPQRFNAALSLMGGQGFTKGRHYWEVEVYSSTVWTVGVARESVTRKGVINTMPANGFWTLSLSYGVQYMAGTSPPTLLSLEEPLARIGVYLDYKRGLVSFYNAESMTHLYTFRDTFTETLFPYFNLGFLDKVHENEPLKVFMPKI
|
[
"GO:0035295",
"GO:0007420",
"GO:0050793",
"GO:0048856",
"GO:0065007",
"GO:1904748",
"GO:0043009",
"GO:0007275",
"GO:0042981",
"GO:0008150",
"GO:0007399",
"GO:0060548",
"GO:0010941",
"GO:0009888",
"GO:0003002",
"GO:0050789",
"GO:0021915",
"GO:0060322",
"GO:0043069",
"GO:0022004",
"GO:0043067",
"GO:0048731",
"GO:0007389",
"GO:0048513",
"GO:0050794",
"GO:0030917",
"GO:0032502",
"GO:0009790",
"GO:0007417",
"GO:0021700",
"GO:0043066",
"GO:0021532",
"GO:0051093",
"GO:0060429",
"GO:0048523",
"GO:0048519",
"GO:0032501",
"GO:0021732",
"GO:0009952",
"GO:0009792",
"GO:1904746",
"GO:0071695",
"GO:0021903"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050789",
"GO:0032502",
"GO:0048519",
"GO:0032501",
"GO:0050793",
"GO:0048856",
"GO:0007275",
"GO:0022004",
"GO:0007389",
"GO:0050794",
"GO:0021700",
"GO:0051093",
"GO:0048523",
"GO:0035295",
"GO:1904748",
"GO:0060548",
"GO:0010941",
"GO:0009888",
"GO:0003002",
"GO:0060322",
"GO:0048731",
"GO:0048513",
"GO:0030917",
"GO:0009790",
"GO:1904746",
"GO:0071695",
"GO:0007420",
"GO:0007399",
"GO:0021915",
"GO:0043069",
"GO:0043067",
"GO:0007417",
"GO:0021532",
"GO:0060429",
"GO:0021732",
"GO:0009952",
"GO:0009792",
"GO:0043009",
"GO:0042981",
"GO:0043066",
"GO:0021903"
] | null | null |
[
"IPR001870",
"IPR043136",
"IPR003879",
"IPR013320",
"IPR006574",
"IPR003877",
"IPR050143",
"IPR027370",
"IPR000315",
"IPR001841",
"IPR013083",
"IPR017907"
] |
af_db/AF-A0A060IVL7-F1-model_v4.cif.gz
| null | null | null |
A0A096MJT2
|
Protein tyrosine phosphatase, non-receptor type 3
| null |
Rattus norvegicus (Rat)
| 92
| null |
MTSRLRALGGRINNIRTSELPKEKTRSEVTCSIRFLDGLVQTFKVNKQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSPEVSPVSCIFE
|
[
"GO:0048732",
"GO:0031100",
"GO:0032502",
"GO:0001889",
"GO:0031099",
"GO:0048856",
"GO:0061008",
"GO:0007275",
"GO:0032501",
"GO:0048731",
"GO:0097421",
"GO:0048513",
"GO:0008150"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0032501",
"GO:0048856",
"GO:0007275",
"GO:0031099",
"GO:0048731",
"GO:0048513",
"GO:0048732",
"GO:0031100",
"GO:0061008",
"GO:0001889",
"GO:0097421"
] | null | null |
[
"IPR000299",
"IPR018979",
"IPR029071"
] |
af_db/AF-A0A096MJT2-F1-model_v4.cif.gz
| null | null | null |
A0A0A6YVT4
|
Protocadherin gamma subfamily C, 5
| null |
Mus musculus (Mouse)
| 55
| null |
MRPMASPQVAGKCKPRPTLTGVSLKPRDPARADPKMVMKLAPGPTTSLIQRCCKP
|
[
"GO:0050808",
"GO:0009987",
"GO:0016043",
"GO:0065007",
"GO:0071840",
"GO:1901214",
"GO:1901215",
"GO:0043066",
"GO:0042981",
"GO:0008150",
"GO:0060548",
"GO:0043524",
"GO:0010941",
"GO:0050789",
"GO:0034330",
"GO:0043523",
"GO:0043069",
"GO:0048523",
"GO:0043067",
"GO:0048519",
"GO:0050794",
"GO:0110165",
"GO:0005575",
"GO:0016020"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0050789",
"GO:0048519",
"GO:0071840",
"GO:0048523",
"GO:0050794",
"GO:0016043",
"GO:0060548",
"GO:0010941",
"GO:1901214",
"GO:1901215",
"GO:0034330",
"GO:0043069",
"GO:0043067",
"GO:0050808",
"GO:0043066",
"GO:0042981",
"GO:0043524",
"GO:0043523"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0016020"
] | null |
af_db/AF-A0A0A6YVT4-F1-model_v4.cif.gz
| null | null | null |
A0A0A6YWE3
|
Pleiomorphic adenoma gene-like 1
| null |
Mus musculus (Mouse)
| 121
|
Nucleus {ECO:0000256|ARBA:ARBA00004123}.
|
MAPFRCQKCGKSFVTLEKFTIHNYSHSRERPFKCSKAECGKAFVSKYKLMRHMATHSPQKIHQCTHCEKTFNRKDHLKNHLQTHDPNKISYACDDCGKKYHTMLGYKRHLALHSASNGDLT
|
[
"GO:0060538",
"GO:0007519",
"GO:0032502",
"GO:0060255",
"GO:0048869",
"GO:0009987",
"GO:0048856",
"GO:0065007",
"GO:0061061",
"GO:0008150",
"GO:0007517",
"GO:0009888",
"GO:0050789",
"GO:0019222",
"GO:0030154",
"GO:0010468",
"GO:0035914",
"GO:0048513",
"GO:0060537",
"GO:0005515",
"GO:0005488",
"GO:0003674"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0009987",
"GO:0065007",
"GO:0050789",
"GO:0048869",
"GO:0048856",
"GO:0019222",
"GO:0060255",
"GO:0061061",
"GO:0009888",
"GO:0030154",
"GO:0048513",
"GO:0007517",
"GO:0010468",
"GO:0035914",
"GO:0060537",
"GO:0060538",
"GO:0007519"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0005515"
] | null |
[
"IPR036236",
"IPR013087"
] |
af_db/AF-A0A0A6YWE3-F1-model_v4.cif.gz
| null | null | null |
A0A0A6YWM6
|
Protocadherin gamma subfamily C, 3
| null |
Mus musculus (Mouse)
| 78
| null |
MVAEARSSGLVSPWRTVGVLLLLAALTEASTIIHYEILEERERGFPVGNVVTDLGLDLGSLSARRLRVVSGASRRFFE
|
[
"GO:0050808",
"GO:0009987",
"GO:0016043",
"GO:0065007",
"GO:0071840",
"GO:1901214",
"GO:1901215",
"GO:0043066",
"GO:0016339",
"GO:0042981",
"GO:0008150",
"GO:0007156",
"GO:0098742",
"GO:0060548",
"GO:0043524",
"GO:0010941",
"GO:0098609",
"GO:0050789",
"GO:0034330",
"GO:0043523",
"GO:0043069",
"GO:0048523",
"GO:0043067",
"GO:0048519",
"GO:0007155",
"GO:0050794",
"GO:0110165",
"GO:0070161",
"GO:0005911",
"GO:0071944",
"GO:0005575",
"GO:0016020",
"GO:0005886",
"GO:0030054"
] |
[
"GO:0008150",
"GO:0009987",
"GO:0065007",
"GO:0050789",
"GO:0048519",
"GO:0071840",
"GO:0048523",
"GO:0007155",
"GO:0050794",
"GO:0016043",
"GO:0060548",
"GO:0010941",
"GO:0098609",
"GO:1901214",
"GO:1901215",
"GO:0098742",
"GO:0034330",
"GO:0043069",
"GO:0043067",
"GO:0050808",
"GO:0043066",
"GO:0016339",
"GO:0042981",
"GO:0007156",
"GO:0043524",
"GO:0043523"
] | null |
[
"GO:0005575",
"GO:0110165",
"GO:0071944",
"GO:0016020",
"GO:0030054",
"GO:0070161",
"GO:0005886",
"GO:0005911"
] |
[
"IPR013164"
] |
af_db/AF-A0A0A6YWM6-F1-model_v4.cif.gz
| null | null | null |
A0A0B4JD76
|
O/E-associated zinc finger protein, isoform C
| null |
Drosophila melanogaster (Fruit fly)
| 1,366
| null |
MSRRKQAKPRACLKLGEKEDEENTGLLEPKEELLSGDEDNEDNEGEDEDEEVADEVAPEGGGGERPQLVPNESQQQSWPTADEPAAPAAVAKEEEAEEGSEELQHPRDEVVASDAAANANGHCKSSGHEEDAVDAEEPEDLELDDELLSLSGDEDYDDEELQSLDSFYSDMYSTHTSSSYSPSISDGTMTPNSHHLIGAPTAAGQEDHPTEGKINGGADGEDLPKPKRLPHFHHHHHHHYHHQQALKIANKLRKINKEAKMGATAGGGATGAASKFDKLTGEGIKSRGDGSYQCQFCEKTFPRLGYLKHHVQSHAEHLPFKCEYCSKLFKHKRSRDRHKKLHTNERNYKCPHCEAAFSRSDHLKIHMKTHDIQKPFQCSMCNRGYNTAAALTSHMQKHKKNAAILAAGGNPNALNYSPRSTGSASASVSSNGSLQKRRYALALASDSSPSRMDFPKRSRSNHVGGTTTTATPTPLLRCSYCPKVTEFSSLEQLNAHLQSVHEQPQTQAVKTPVQEGEGFQLSCEYCTMKFGNIAGLFQHMRSTHMDRLSSPNSYYEHFNRLATAGTFSPRLALDLPKIKPDLGSPERESRPAEDDLPTDLSNNKRRPLTPNPQAQTPLAPPSAPPGVFFCNQCNAGLPDFESFRNHLKSHIAEGMQLVCPHCGMSLPEQSEFERHVVGHFLITGSEFNCSSSCGKSFAKSEDLQQHLLSEHVLTLLKCSLCSELCESRMAMQLHLACAHSQETKLLRCSACLELFRSDAEFHVHVKTRHQLGGHPTLGATSSAPTNPLQCMFCRAVCSSELEMHFHLAAHARQFRCPSCPETFHVEFLLDRHMQSQHGGVKDKEANSPNMGSLYVNALLPPLAAAAAAAAATNNNSSIIDYNVAFKGLFGGASGGAGSGGGGAQSGGAPPSANKFYSPLQVDTNALKAQTSPHPALMYGLSQRYLMEMYAAKSTSPSGNEGVGNSQPPAPQATAPPPPPNASTATFSCGMCERQDLRSEAELHSHRKLAHNLKTGVSLRCAYCAGNFKSRAELEQHMKSCHNSTGKHKCLICDEVFPSPAILAEHKLQHSKVGQSGKCSHCGQPLEDVAAFRAHLSEHGSDGASLPLACICCRQTLHSEFELSLHAKFHTKSSSSGGSLQEPVCALCLEPLPDATEGPAKLCDKCCRKHNLNGKRGKHSEPATSLPAPPSAFVENRCNLCKMILPHAQKLQEHLVEHTFAGTEQRGFNCYICSAVFTAPGGLLNHMGEHGAHSRPYDCNLCPEKFFFRAELEHHQRGHELRPQARPPAAKVEVPSIRNTSPGQSPVRSPTIVKQELYETDTVESAGVEDEPENHPDEEEYIEVEQMPHETRPSGIGSQLERSTSSA
|
[
"GO:0032502",
"GO:0035277",
"GO:0048856",
"GO:0007275",
"GO:0032501",
"GO:0009653",
"GO:0048731",
"GO:0007424",
"GO:0008150",
"GO:0060541"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0032501",
"GO:0048856",
"GO:0007275",
"GO:0009653",
"GO:0035277",
"GO:0048731",
"GO:0060541",
"GO:0007424"
] | null | null |
[
"IPR036236",
"IPR013087"
] | null | null | null | null |
A0A0B4K762
|
Limostatin, isoform B
| null |
Drosophila melanogaster (Fruit fly)
| 152
| null |
MFAYTWQFPSLHSFLVPSLQLAPLILVILATTMTTTMAAPQQQEVPHALLDIETPNQFNYSPSPLAQPDSLRSKPYFDFLSTLYAHDTAKSNLFRPYSVRQRRDADVQKLSRPRRAIVFRPLFVYKQQEIRKQEIRDRNAQRRHDLNRLQRV
|
[
"GO:0046888",
"GO:0009605",
"GO:0009991",
"GO:0048878",
"GO:0065008",
"GO:0009743",
"GO:0065007",
"GO:0010648",
"GO:0023057",
"GO:1903530",
"GO:0051049",
"GO:0055088",
"GO:0051051",
"GO:0008150",
"GO:0042221",
"GO:0090276",
"GO:0002791",
"GO:0090087",
"GO:0042594",
"GO:0050896",
"GO:0050789",
"GO:0050848",
"GO:0010646",
"GO:0071310",
"GO:0009267",
"GO:0055090",
"GO:0033554",
"GO:0031667",
"GO:0070887",
"GO:0032879",
"GO:0042593",
"GO:0050794",
"GO:0009966",
"GO:0042592",
"GO:0048583",
"GO:0033500",
"GO:0051716",
"GO:0023051",
"GO:0009987",
"GO:0002792",
"GO:1901700",
"GO:0031668",
"GO:0071322",
"GO:0051046",
"GO:0006950",
"GO:0010817",
"GO:0071496",
"GO:0048523",
"GO:0070328",
"GO:0048519",
"GO:0031669",
"GO:1901701",
"GO:0010033",
"GO:0090278",
"GO:1902531",
"GO:0007154",
"GO:0051048",
"GO:1903531",
"GO:0046883"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050896",
"GO:0050789",
"GO:0042592",
"GO:0009987",
"GO:0048519",
"GO:0009605",
"GO:0048878",
"GO:0065008",
"GO:0023057",
"GO:0051051",
"GO:0042221",
"GO:0032879",
"GO:0050794",
"GO:0048583",
"GO:0051716",
"GO:0023051",
"GO:0006950",
"GO:0048523",
"GO:0007154",
"GO:0046888",
"GO:0009991",
"GO:0010648",
"GO:1903530",
"GO:0051049",
"GO:0055088",
"GO:0042594",
"GO:0010646",
"GO:0033554",
"GO:0070887",
"GO:0009966",
"GO:0033500",
"GO:1901700",
"GO:0031668",
"GO:0010817",
"GO:0071496",
"GO:0010033",
"GO:0051048",
"GO:1903531",
"GO:0046883",
"GO:0009743",
"GO:0090276",
"GO:0090087",
"GO:0071310",
"GO:0009267",
"GO:0055090",
"GO:0031667",
"GO:0042593",
"GO:0002792",
"GO:0051046",
"GO:0031669",
"GO:1901701",
"GO:0090278",
"GO:1902531",
"GO:0002791",
"GO:0050848",
"GO:0071322",
"GO:0070328"
] | null | null | null |
af_db/AF-A0A0B4K762-F1-model_v4.cif.gz
|
7227.FBpp0297147
|
[
"7227.FBpp0296961"
] |
[
{
"protein2": "7227.FBpp0296961",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 0,
"textmining": 830,
"combined_score": 830
}
] |
A0A0B4KEU5
|
Coronin
| null |
Drosophila melanogaster (Fruit fly)
| 534
| null |
MSFRVVRSSKFRHVYGQALKREQCYDNIRVSKSSWDSTFCAVNPKFLAIIVESAGGGAFIVLPHNKVGRMWQVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPDGGLSRTLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSHPDIVYSACFNWDGSKLVTTCKDKKIRIYDPRTAELESEAMCHEGSKATRAIFLRHGLIFTTGFNRSSERQYSLRAPDALNEPIVMVELDTSNGVMFPLYDADTNMIYLCGKGDSVIRYFEVTPEPPFVHYINTFQTTEPQRGIGLMPKRGCDVTTCEVAKFYRMNNNGLCQVISMTVPRKSDLFQEDLYPDTLAEDAAITAEEWIDGKDADPITFSLKGGYVSSSVNKSLPAKKAGNILNKPRGDSASSGATSSSAGGGNFASGNNNEASEGGPPAAVLSEKDLRTIQDEIRKLKAIIVKQENRIRALEAKEDARNKNGSDAAPASAGAATSDGKASESANDHASTSAGTSKDED
|
[
"GO:0006952",
"GO:0009605",
"GO:0032502",
"GO:0048856",
"GO:0061061",
"GO:0006950",
"GO:0008150",
"GO:0043207",
"GO:0050896",
"GO:0007527",
"GO:0007525",
"GO:0051707",
"GO:0009620",
"GO:0050832",
"GO:0009607",
"GO:0098542",
"GO:0044419"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0050896",
"GO:0044419",
"GO:0009605",
"GO:0048856",
"GO:0006950",
"GO:0051707",
"GO:0009607",
"GO:0006952",
"GO:0061061",
"GO:0043207",
"GO:0009620",
"GO:0098542",
"GO:0007525",
"GO:0050832",
"GO:0007527"
] | null | null |
[
"IPR015505",
"IPR015048",
"IPR015943",
"IPR019775",
"IPR036322",
"IPR001680"
] |
af_db/AF-A0A0B4KEU5-F1-model_v4.cif.gz
| null | null | null |
A0A0B4KEX9
|
Uncharacterized protein, isoform D
| null |
Drosophila melanogaster (Fruit fly)
| 592
| null |
MHEAESVGGLGTESTPESPMSPQTPDPALLDVRQKVHRFEAFRTNICFIKQERHSLKLLENRRHPSFEDQSEDHHTPPATPPRRIRLPGLGSRGSSRSSSIPSFQAGIHEVRSEDEVDQISDFETDSHTAAEEYLVVDTTSEVVPSEEVADSKVDQQQVQRSISADQSKEALTLPLKMRNDFPRNYRSTPRRKTEIIGTTNEHLVGKFHSVYQPKDEEEEVEIELRDKSDKCVHPILEELIKTEEAYVNNLFTGIENYGNIFQRKDLPLGLRGKKYDLFGNIEQIAEFHRDEFLPMLQRNRRDLKRLFDEFLQFLDQHCFYGYVIFTMNKQKSLKLCDLYKNYFTSIRLERDDKLGINSFLVQPIQRMARYPLLLTQFINTFFKNRDIVMKPLIESCCRLEKRLRALLTTTNESEIINDIVDCHEFNVYYQGKFRKVNEFQVLDHKLKRSYRSKVFIFDKCIIYTEIKGKNLLFHGRYPCEHIGISAKTKSFTLYYERRKQQECEFTADPVQIAIWLDLIRDMINNYANEERQKLQERYSRENDHLHRKAPSFSLYRDSNRFSSDSGIGNIWIMPKADEDTISNRTTWYAAT
|
[
"GO:0032502",
"GO:0035114",
"GO:0048736",
"GO:0048856",
"GO:0002165",
"GO:0007552",
"GO:0007275",
"GO:0035107",
"GO:0009653",
"GO:0009887",
"GO:0048563",
"GO:0009886",
"GO:0007478",
"GO:0008150",
"GO:0007560",
"GO:0007444",
"GO:0048737",
"GO:0007480",
"GO:0035120",
"GO:0032501",
"GO:0048513",
"GO:0009791",
"GO:0048707",
"GO:0048569",
"GO:0035218"
] |
[
"GO:0008150",
"GO:0032502",
"GO:0032501",
"GO:0048856",
"GO:0007275",
"GO:0009653",
"GO:0009791",
"GO:0048736",
"GO:0002165",
"GO:0007552",
"GO:0035107",
"GO:0009887",
"GO:0009886",
"GO:0048513",
"GO:0035114",
"GO:0048563",
"GO:0007560",
"GO:0007444",
"GO:0048737",
"GO:0035120",
"GO:0048707",
"GO:0048569",
"GO:0007478",
"GO:0007480",
"GO:0035218"
] | null | null |
[
"IPR035899",
"IPR000219",
"IPR011993",
"IPR051336"
] |
af_db/AF-A0A0B4KEX9-F1-model_v4.cif.gz
| null | null | null |
A0A075B6A3
|
Immunoglobulin heavy constant alpha
| null |
Mus musculus (Mouse)
| 344
| null |
XSARNPTIYPLTLPRALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGGYTMSSQLTLPAVECPEGESVKCSVQHDSNAVQELDVKCSGPPPPCPPCPPSCHPSLSLQRPALEDLLLGSDASLTCTLNGLRNPEGAVFTWEPSTGKDAVQKKAVQNSCGCYSVSSVLPGCAERWNSGASFKCTVTHPESDTLTGTIAKITVNTFPPQVHLLPPPSEELALNELVSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAELWKQGDQYSCMVGHEALPMNFTQKTIDRLSGKPTNVSVSVIMSEGDGICY
|
[
"GO:0002455",
"GO:0002449",
"GO:0002376",
"GO:0019724",
"GO:0002443",
"GO:0002252",
"GO:0002250",
"GO:0008150",
"GO:0016064",
"GO:0002385",
"GO:0050896",
"GO:0002251",
"GO:0006955",
"GO:0006959",
"GO:0002460",
"GO:0032991",
"GO:0005575",
"GO:0042571",
"GO:0005576",
"GO:0110165",
"GO:0019814",
"GO:0005615",
"GO:0003823",
"GO:0003674",
"GO:0005488"
] |
[
"GO:0008150",
"GO:0002376",
"GO:0050896",
"GO:0002252",
"GO:0006955",
"GO:0002443",
"GO:0002250",
"GO:0002251",
"GO:0006959",
"GO:0002455",
"GO:0002449",
"GO:0002385",
"GO:0002460",
"GO:0019724",
"GO:0016064"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0003823"
] |
[
"GO:0005575",
"GO:0032991",
"GO:0110165",
"GO:0005576",
"GO:0019814",
"GO:0005615",
"GO:0042571"
] |
[
"IPR007110",
"IPR036179",
"IPR013783",
"IPR003006",
"IPR003597",
"IPR003599",
"IPR050380"
] | null | null | null | null |
A0A096MJ68
|
Secretory leukocyte peptidase inhibitor
| null |
Rattus norvegicus (Rat)
| 107
|
Secreted {ECO:0000256|ARBA:ARBA00004613}.
|
MRLQDAIKIGACPARKPAQCLKREKPECGTDWECPGKQRCCQDTCGFKCLNPVPIRGPVKKKPGRCLKFQGKCLMLNPPNKCQNDGQCDGKYKCCEGMCGKVCLPPV
|
[
"GO:0050727",
"GO:0048583",
"GO:0031347",
"GO:0050789",
"GO:0032101",
"GO:0048519",
"GO:0065007",
"GO:0048585",
"GO:0080134",
"GO:0050728",
"GO:0008150",
"GO:0031348",
"GO:0032102"
] |
[
"GO:0008150",
"GO:0050789",
"GO:0048519",
"GO:0065007",
"GO:0048583",
"GO:0048585",
"GO:0032101",
"GO:0080134",
"GO:0031348",
"GO:0032102",
"GO:0050727",
"GO:0031347",
"GO:0050728"
] | null | null |
[
"IPR036645",
"IPR008197",
"IPR050514"
] |
af_db/AF-A0A096MJ68-F1-model_v4.cif.gz
|
10116.ENSRNOP00000068012
|
[
"10116.ENSRNOP00000014981"
] |
[
{
"protein2": "10116.ENSRNOP00000014981",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 78,
"experimental": 336,
"database": 0,
"textmining": 644,
"combined_score": 762
}
] |
A0A096MJV3
|
Heat shock transcription factor 4
| null |
Rattus norvegicus (Rat)
| 329
|
Nucleus {ECO:0000256|ARBA:ARBA00004123}.
|
MQEAPAALPTEPGPSPVPAFLGKLWALVGDPGTDHLIRWSPSGTSFLVSDQSRFAKEVLPQYFKHSNMASFVRQLNMYGFRKVVSIEQGGLLRPERDHVEFQHPSFVRGCEQLLERVRRKVPALRGDDTRWRPEDLGRLLGEVQALRGVQESTEARLQELRQQNEILWREVVTLRQSHSQQHRVIGKLIQCLFGPLQTGPSSTGAKRKLSLMLDEGSACSASAKFNACPVSGALLQDPYFIQSHPHRCPWLWCRPSWKGKGASALRGPGAYNSLNQGAPGRYLTGELWAWIAVTGAQRVCCPPCCFGLPLKLWSPWMRWVLACMDENGP
|
[
"GO:0065007",
"GO:1903507",
"GO:0051172",
"GO:0008150",
"GO:0010556",
"GO:0050789",
"GO:0019222",
"GO:0010605",
"GO:0009889",
"GO:0050794",
"GO:0051171",
"GO:0031326",
"GO:1903506",
"GO:0060255",
"GO:0031323",
"GO:0009890",
"GO:0019219",
"GO:0010558",
"GO:2001141",
"GO:1902679",
"GO:0031327",
"GO:0080090",
"GO:0051252",
"GO:0031324",
"GO:0051253",
"GO:0006355",
"GO:0048523",
"GO:0048519",
"GO:0045892",
"GO:0045934",
"GO:0010468",
"GO:0009892",
"GO:0005622",
"GO:0043229",
"GO:0043226",
"GO:0110165",
"GO:0005575",
"GO:0043227",
"GO:0005634",
"GO:0043231",
"GO:0003676",
"GO:0003677",
"GO:0042802",
"GO:0005488",
"GO:0043565",
"GO:0097159",
"GO:0003674",
"GO:1901363",
"GO:0005515"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050789",
"GO:0048519",
"GO:0019222",
"GO:0050794",
"GO:0048523",
"GO:0009892",
"GO:0051172",
"GO:0010605",
"GO:0009889",
"GO:0051171",
"GO:0060255",
"GO:0031323",
"GO:0009890",
"GO:0080090",
"GO:0031324",
"GO:0010556",
"GO:0031326",
"GO:0019219",
"GO:0010558",
"GO:0031327",
"GO:0051252",
"GO:0051253",
"GO:0045934",
"GO:0010468",
"GO:2001141",
"GO:1902679",
"GO:0006355",
"GO:1903507",
"GO:1903506",
"GO:0045892"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0097159",
"GO:1901363",
"GO:0005515",
"GO:0003676",
"GO:0042802",
"GO:0003677",
"GO:0043565"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0043229",
"GO:0043227",
"GO:0043231",
"GO:0005634"
] |
[
"IPR000232",
"IPR036388",
"IPR036390"
] | null | null | null | null |
A0A096MK39
|
Heat shock transcription factor 4
| null |
Rattus norvegicus (Rat)
| 489
|
Nucleus {ECO:0000256|ARBA:ARBA00004123}.
|
MQEAPAALPTEPGPSPVPAFLGKLWALVGDPGTDHLIRWSPSGTSFLVSDQSRFAKEVLPQYFKHSNMASFVRQLNMYGFRKVVSIEQGGLLRPERDHVEFQHPSFVRGCEQLLERVRRKVPALRGDDTRWRPEDLGRLLGEVQALRGVQESTEARLQELRQQNEILWREVVTLRQSHSQQHRVIGKLIQCLFGPLQTGPSSTGAKRKLSLMLDEGSACSASAKFNACPVSGALLQDPYFIQSPLPETTVGLSPHRARGPIISDIPEDCPSPEGHRLSPSSAGRRVKGLALLKEEPASPGGDGEAGLALAPNECDFCVTAPPPLPVAVVQAILEGKGSFSPEGPRSIQQPEPRGPREVPDRGTLGLDRGNRSPESLLPPVLLRPPPETVEPMDALGPSLHGREWTLMDLDMELSLMQPLAPERAEAELTVKDLTSSGVGKDHTLGTPLMLDVQADLEGAALSVPGALTLYNATESNASYLDPGASPSSP
|
[
"GO:0065007",
"GO:1903507",
"GO:0051172",
"GO:0008150",
"GO:0010556",
"GO:0050789",
"GO:0019222",
"GO:0010605",
"GO:0009889",
"GO:0050794",
"GO:0051171",
"GO:0031326",
"GO:1903506",
"GO:0060255",
"GO:0031323",
"GO:0009890",
"GO:0019219",
"GO:0010558",
"GO:2001141",
"GO:1902679",
"GO:0031327",
"GO:0080090",
"GO:0051252",
"GO:0031324",
"GO:0051253",
"GO:0006355",
"GO:0048523",
"GO:0048519",
"GO:0045892",
"GO:0045934",
"GO:0010468",
"GO:0009892",
"GO:0005622",
"GO:0043229",
"GO:0043226",
"GO:0110165",
"GO:0005575",
"GO:0043227",
"GO:0005634",
"GO:0043231",
"GO:0003676",
"GO:0003677",
"GO:0042802",
"GO:0005488",
"GO:0043565",
"GO:0097159",
"GO:0003674",
"GO:1901363",
"GO:0005515"
] |
[
"GO:0008150",
"GO:0065007",
"GO:0050789",
"GO:0048519",
"GO:0019222",
"GO:0050794",
"GO:0048523",
"GO:0009892",
"GO:0051172",
"GO:0010605",
"GO:0009889",
"GO:0051171",
"GO:0060255",
"GO:0031323",
"GO:0009890",
"GO:0080090",
"GO:0031324",
"GO:0010556",
"GO:0031326",
"GO:0019219",
"GO:0010558",
"GO:0031327",
"GO:0051252",
"GO:0051253",
"GO:0045934",
"GO:0010468",
"GO:2001141",
"GO:1902679",
"GO:0006355",
"GO:1903507",
"GO:1903506",
"GO:0045892"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0097159",
"GO:1901363",
"GO:0005515",
"GO:0003676",
"GO:0042802",
"GO:0003677",
"GO:0043565"
] |
[
"GO:0005575",
"GO:0110165",
"GO:0005622",
"GO:0043226",
"GO:0043229",
"GO:0043227",
"GO:0043231",
"GO:0005634"
] |
[
"IPR000232",
"IPR036388",
"IPR036390"
] |
af_db/AF-A0A096MK39-F1-model_v4.cif.gz
|
10116.ENSRNOP00000068369
|
[
"10116.ENSRNOP00000007727",
"10116.ENSRNOP00000051301",
"10116.ENSRNOP00000055204",
"10116.ENSRNOP00000029527"
] |
[
{
"protein2": "10116.ENSRNOP00000007727",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 0,
"database": 0,
"textmining": 736,
"combined_score": 735
},
{
"protein2": "10116.ENSRNOP00000051301",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 44,
"experimental": 0,
"database": 0,
"textmining": 719,
"combined_score": 719
},
{
"protein2": "10116.ENSRNOP00000055204",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 64,
"experimental": 0,
"database": 0,
"textmining": 698,
"combined_score": 705
},
{
"protein2": "10116.ENSRNOP00000029527",
"neighborhood": 0,
"fusion": 0,
"cooccurence": 0,
"coexpression": 0,
"experimental": 67,
"database": 0,
"textmining": 848,
"combined_score": 852
}
] |
A0A0A6YXW6
|
Immunoglobulin heavy constant alpha
| null |
Mus musculus (Mouse)
| 389
| null |
XSARNPTIYPLTLPRALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGGYTMSSQLTLPAVECPEGESVKCSVQHDSNAVQELDVKCSGPPPPCPPCPPSCHPSLSLQRPALEDLLLGSDASLTCTLNGLRNPEGAVFTWEPSTGKDAVQKKAVQNSCGCYSVSSVLPGCAERWNSGASFKCTVTHPESDTLTGTIAKITVNTFPPQVHLLPPPSEELALNELVSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAELWKQGDQYSCMVGHEALPMNFTQKTIDRLSERQEPLSYVLLDQSEDILEEEAPGASLWPTTVTFLTLFLLSLFYSTALTVTTVRGPFGSKEVPQY
|
[
"GO:0002455",
"GO:0002449",
"GO:0002376",
"GO:0019724",
"GO:0002443",
"GO:0002252",
"GO:0002250",
"GO:0008150",
"GO:0016064",
"GO:0002385",
"GO:0050896",
"GO:0002251",
"GO:0006955",
"GO:0006959",
"GO:0002460",
"GO:0032991",
"GO:0005575",
"GO:0042571",
"GO:0005576",
"GO:0110165",
"GO:0019814",
"GO:0005615",
"GO:0003823",
"GO:0003674",
"GO:0005488"
] |
[
"GO:0008150",
"GO:0002376",
"GO:0050896",
"GO:0002252",
"GO:0006955",
"GO:0002443",
"GO:0002250",
"GO:0002251",
"GO:0006959",
"GO:0002455",
"GO:0002449",
"GO:0002385",
"GO:0002460",
"GO:0019724",
"GO:0016064"
] |
[
"GO:0003674",
"GO:0005488",
"GO:0003823"
] |
[
"GO:0005575",
"GO:0032991",
"GO:0110165",
"GO:0005576",
"GO:0019814",
"GO:0005615",
"GO:0042571"
] |
[
"IPR007110",
"IPR036179",
"IPR013783",
"IPR003006",
"IPR003597",
"IPR050380"
] | null | null | null | null |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.