protein_id
large_stringlengths
6
10
protein_names
large_stringlengths
2
2.59k
protein_function
large_stringlengths
13
15.4k
organism
large_stringlengths
9
178
length
float64
3
35.4k
subcellular_location
large_stringlengths
7
6.16k
sequence
large_stringlengths
3
35.4k
go_ids
large listlengths
2
815
go_bp
large listlengths
2
708
go_mf
large listlengths
2
83
go_cc
large listlengths
2
102
interpro_ids
large listlengths
1
82
structure_path
large_stringlengths
21
38
string_id
large_stringlengths
10
27
interaction_partners
large listlengths
1
1.44k
full_interaction_info
large listlengths
1
1.44k
A0A024B5K5
endothelin-converting enzyme 1 (EC 3.4.24.71)
null
Danio rerio (Zebrafish) (Brachydanio rerio)
765
Cytoplasmic vesicle, secretory vesicle membrane {ECO:0000256|ARBA:ARBA00004250}. Golgi apparatus membrane {ECO:0000256|ARBA:ARBA00004194}; Single-pass membrane protein {ECO:0000256|ARBA:ARBA00004194}.
MSVALQDLRNNMSNYKRATFEEEDGTDVPVDGAISPDSVEVGFRKGGIQLFGPLGRRTQLEVVLAGLLLASLLALFGCAVTLGVRYNRDPARSICLTEACVTVASKIVEALDRSADPCQDFYQYACGGWVRKNPLPDGRSRWSTFNSIWDQNQAVLKHLLENGTFNSSSEAERKTQSYYLSCLNEQRIEELGAQPLMDLITKIGGWNITESWDKENFLDVLKIISGPYRAQPFFTVSVSVDPKNSNSNVIQVDQSGLFLPSRDYYLNKTNEKVLKAYLDYMVELGLLLGGDKNSTRGQMQQILDFETALANITVPQDERRDEEKIYHKITIADLQVLAPAIEWLDYLNSVLSPLELNDTEPVVVYAKEYMQQVSELINKTDHSLLNNYMIWNLVQKGASSLDQRFENAQDKLLESLYGTKKSCTPRWQTCIGNTDDTLGFALGALFVKATFDKQSKEIAEGMINEIRTAFKGALDDLKWMDEQTRQAAKDKADAIYDMIGFPDFILDSKELDDVYDGYEVTEDNFFQNMINFYNFSARVMADQLRKPPNRDQWSMTPPTVNAYYMPTKNGIVFPAGILQAPFYAQDHPKALNFGGIGVVMGHELTHAFDDQGREYDKDGNLRSWWQNSSVEAFKNRTECMVDQYTQYTINGEHINGKQTLGENIADNGGLKAAYHAYRSWVQKNGEEKRLPAVNLTNDQLFFVGFAQVWCSVRTPESAHEGLMTDPHSPPKYRVIGTLSNSPEFAEHFQCPLGSSMNSGHRCEVW
[ "GO:0032502", "GO:0048869", "GO:0009987", "GO:0048856", "GO:0043473", "GO:0030318", "GO:0050931", "GO:0070285", "GO:0008150", "GO:0048468", "GO:0048066", "GO:0030154" ]
[ "GO:0008150", "GO:0032502", "GO:0009987", "GO:0043473", "GO:0048869", "GO:0048856", "GO:0048066", "GO:0050931", "GO:0048468", "GO:0030154", "GO:0030318", "GO:0070285" ]
null
null
[ "IPR024079", "IPR000718", "IPR018497", "IPR042089", "IPR008753" ]
af_db/AF-A0A024B5K5-F1-model_v4.cif.gz
7955.ENSDARP00000135807
[ "7955.ENSDARP00000002773", "7955.ENSDARP00000148726", "7955.ENSDARP00000095917", "7955.ENSDARP00000115695" ]
[ { "protein2": "7955.ENSDARP00000002773", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 0, "textmining": 759, "combined_score": 758 }, { "protein2": "7955.ENSDARP00000148726", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 0, "textmining": 744, "combined_score": 744 }, { "protein2": "7955.ENSDARP00000095917", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 750, "textmining": 778, "combined_score": 942 }, { "protein2": "7955.ENSDARP00000115695", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 0, "textmining": 836, "combined_score": 836 } ]
A0A076NAB7
Rad, Gem/Kir family member 3, isoform E (Rgk3L)
null
Drosophila melanogaster (Fruit fly)
486
null
MVDDISPMHHRMQKKTRSASICATGASIETVIHGMPGASGSATPEGGTPGYRRRRPATRSQSARITSGARSVRQKTKAQQQQQQQQHTLQETRSYCTSEPRLSETETPPQRRKLSQRRPQTHAHRKSNAFLDVPTMNMHHLRVNDDDEDVDRLRTFSASKGGIINRGDSFRRRRSRSNSLAPSSPMHTRNGVGGLGGVAGGGSSLGLGCGYNGGSSSNGFGNANAQENHQPVEFYRVEMLGSAGVGKQALLSQFRTSDCINAYDGPECDDAEQNVSIILNGTESELKFLTGNPESKDELEQADAFLVVYSCIDKESFTRAKQILSRLQDMDLLRHRPTILVANKIDLARSRAVSAQDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQVQLQLNPKKSKDKDKNKFKENTNIETVETDNCLTDLKADDGGPRDANSPAHWYKSRSVMLASMKARQMLTWILGKEDSKFKHCENLQVL
[ "GO:0032413", "GO:0065007", "GO:1901020", "GO:0051049", "GO:0051051", "GO:0034766", "GO:0008150", "GO:0051924", "GO:0050789", "GO:2001258", "GO:0032410", "GO:0032409", "GO:0044092", "GO:1901386", "GO:0032879", "GO:0034765", "GO:2001257", "GO:0050794", "GO:1903170", "GO:0043271", "GO:0034762", "GO:1901019", "GO:1904062", "GO:1903169", "GO:0065009", "GO:0051926", "GO:0032412", "GO:0022898", "GO:0043269", "GO:1904063", "GO:0048523", "GO:0048519", "GO:0010959", "GO:1901385", "GO:0034763" ]
[ "GO:0008150", "GO:0065007", "GO:0050789", "GO:0048519", "GO:0051051", "GO:0032879", "GO:0050794", "GO:0065009", "GO:0048523", "GO:0051049", "GO:0032410", "GO:0032409", "GO:0044092", "GO:0043271", "GO:0034762", "GO:0034763", "GO:0032413", "GO:0034766", "GO:0034765", "GO:0051926", "GO:0022898", "GO:0043269", "GO:1901020", "GO:2001258", "GO:1903170", "GO:1904062", "GO:0032412", "GO:1904063", "GO:0010959", "GO:0051924", "GO:1901386", "GO:2001257", "GO:1901019", "GO:1903169", "GO:1901385" ]
null
null
[ "IPR027417", "IPR051641", "IPR001806" ]
af_db/AF-A0A076NAB7-F1-model_v4.cif.gz
7227.FBpp0309683
[ "7227.FBpp0306703", "7227.FBpp0304205", "7227.FBpp0081241" ]
[ { "protein2": "7227.FBpp0306703", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 727, "database": 0, "textmining": 84, "combined_score": 750 }, { "protein2": "7227.FBpp0304205", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 0, "textmining": 791, "combined_score": 791 }, { "protein2": "7227.FBpp0081241", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 0, "database": 0, "textmining": 916, "combined_score": 917 } ]
A0A087WSR0
Predicted gene, 20835 (Predicted gene, 20855) (Predicted gene, 20894) (Predicted gene, 20916) (Predicted gene, 20920) (Predicted gene, 21317) (Sycp3 like Y-linked)
null
Mus musculus (Mouse)
188
null
MRRMALKKLKVIPKEGYLLLLDFDDEDDDIKVSEEALSEVKSPAFDKNENISPQAEADEDMGDEVDSMLDKSEDDIYKTLHIKRKWMETYVKESFKGSNQKLERFCKTNERERKNINNKFCEQYITTFQKSDMDVQKFNEEKEKSVNSCQKEQQALKLSKCSQNQTLEAVKEMHEKSMEVLMNLGTKN
[ "GO:0032502", "GO:0019953", "GO:0060255", "GO:0007276", "GO:0048869", "GO:0009987", "GO:0065007", "GO:0009566", "GO:0008150", "GO:0022412", "GO:0032504", "GO:0003006", "GO:0048232", "GO:0007530", "GO:0050789", "GO:0019222", "GO:0048609", "GO:0030154", "GO:0007338", "GO:0000003", "GO:0007283", "GO:0010468", "GO:0032501", "GO:0048515", "GO:0022414", "GO:0005622", "GO:0043229", "GO:0043226", "GO:0110165", "GO:0005737", "GO:0005575", "GO:0043227", "GO:0005634", "GO:0043231", "GO:0005515", "GO:0005488", "GO:0003674" ]
[ "GO:0008150", "GO:0032502", "GO:0009987", "GO:0065007", "GO:0050789", "GO:0000003", "GO:0032501", "GO:0022414", "GO:0019953", "GO:0048869", "GO:0009566", "GO:0022412", "GO:0032504", "GO:0003006", "GO:0019222", "GO:0048609", "GO:0060255", "GO:0007276", "GO:0007530", "GO:0030154", "GO:0007338", "GO:0007283", "GO:0048515", "GO:0048232", "GO:0010468" ]
[ "GO:0003674", "GO:0005488", "GO:0005515" ]
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0005737", "GO:0043229", "GO:0043227", "GO:0043231", "GO:0005634" ]
[ "IPR051443", "IPR006888" ]
af_db/AF-A0A087WSR0-F1-model_v4.cif.gz
null
null
null
A0A096MIY8
Aspartate-beta-hydroxylase
null
Rattus norvegicus (Rat)
259
Sarcoplasmic reticulum membrane {ECO:0000256|ARBA:ARBA00004157}; Single-pass type II membrane protein {ECO:0000256|ARBA:ARBA00004157}.
MAEDKEAKHGGHKNGRRGGISGGSFFTWFMVIALLGVWTSVAVVWFDLVDYEEVLGKLGVYDADGDGDFDVDDAKVLLEGPGGLAKRKTKAKGLKERSTSERTFPPEEAETQAELEEQAPEGADLEADGPAGEPQSEVEDFLTATDSDDRFEALEPGTVHEDTEDSYHVEETASQNHPNDAEEVMSEQESSDHGEAVTDDGLQQHAEEVRHEDYDEPVYEPSENERIEISDNAIDDSNIISEEINVASVEEQQDTPPDT
[ "GO:0006873", "GO:0050801", "GO:0048878", "GO:0055082", "GO:0051480", "GO:0098771", "GO:0019725", "GO:0006874", "GO:0055074", "GO:0055080", "GO:0008150", "GO:0030003", "GO:0042592" ]
[ "GO:0008150", "GO:0042592", "GO:0048878", "GO:0019725", "GO:0050801", "GO:0055082", "GO:0098771", "GO:0006873", "GO:0055074", "GO:0055080", "GO:0006874", "GO:0030003", "GO:0051480" ]
null
null
[ "IPR007943", "IPR039038" ]
af_db/AF-A0A096MIY8-F1-model_v4.cif.gz
null
null
null
A0A096MJA1
Tyrosine-protein phosphatase non-receptor type (EC 3.1.3.48)
May act at junctions between the membrane and the cytoskeleton. {ECO:0000256|PIRNR:PIRNR000927}.
Rattus norvegicus (Rat)
967
Cytoplasm, cytoskeleton {ECO:0000256|ARBA:ARBA00004245, ECO:0000256|PIRNR:PIRNR000927}.
MGRKVQSERRKAGVGGGGRGRLERRPLGALKALGRANLPGVLGPAKEPRDSQLSHGAAGVGATPNSATEPPSKARCHFRFVVRQALAIPRHAIPESQAHSYSAAVMTSRLRALGGRINNIRTSELPKEKTRSEVTCSIRFLDGLVQTFKVNKQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSPRWLEASKPLRKQLKGGLPCILHFRVRYFIPDPNTLQQEQTSQFIPDQNDDFLSKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHGGRDLHNLDLMIGIASAGIAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHSFFQAKKLLPQEKNVLSQYWTLGSRNPKKSVNNQYCKKVIGGMVWNPVMRRSLSVERLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSLSPKDSDSEVSQNHSPHRGSLSENNPAQSCLTQKSSSSVSPCSNAPGSFSPDGVDQQFLEDYHKVTKGGSIEEASQYYCDKNDDGDGYLVLIRITPDKEGRFGFNLKGGVDQKMPLVVSRINPESPADTCMPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRKAVRSLAEIRSEDELSQLFPEAMFPACPEGGDSLEGSMELLKKGLESGTVLIQFEQLYRKKPGLAVTFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGPLPHTCAQFWQVVWDQKLSLVVMLTTLTERGRTKCHQYWPDPPDIMDHGIFHIQCQAEDCTIAYVSREMLVTNTETGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVKYVRSLRVGGEPALVHCSAGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYEEGLVQTLDPS
[ "GO:0048732", "GO:0031100", "GO:0032502", "GO:0001889", "GO:0031099", "GO:0048856", "GO:0061008", "GO:0007275", "GO:0032501", "GO:0048731", "GO:0097421", "GO:0048513", "GO:0008150" ]
[ "GO:0008150", "GO:0032502", "GO:0032501", "GO:0048856", "GO:0007275", "GO:0031099", "GO:0048731", "GO:0048513", "GO:0048732", "GO:0031100", "GO:0061008", "GO:0001889", "GO:0097421" ]
null
null
[ "IPR019749", "IPR014352", "IPR035963", "IPR019748", "IPR019747", "IPR000299", "IPR018979", "IPR018980", "IPR001478", "IPR036034", "IPR011993", "IPR029021", "IPR000242", "IPR041783", "IPR016130", "IPR003595", "IPR000387", "IPR012151", "IPR029071" ]
af_db/AF-A0A096MJA1-F1-model_v4.cif.gz
null
null
null
A0A096MJE4
Cytotoxic T-lymphocyte protein 4 (Cytotoxic T-lymphocyte-associated antigen 4)
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. {ECO:0000256|ARBA:ARBA00002230}.
Rattus norvegicus (Rat)
223
Cell membrane {ECO:0000256|ARBA:ARBA00004251}; Single-pass type I membrane protein {ECO:0000256|ARBA:ARBA00004251}.
MARLGVQRYKTHLQLPSRTWPFGVLLSLLFIPIFSEAIQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLVTAVSLNRTLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
[ "GO:0050777", "GO:0042130", "GO:0065007", "GO:0002695", "GO:0050670", "GO:0050776", "GO:0008150", "GO:0050866", "GO:0042127", "GO:0042129", "GO:0050863", "GO:0007162", "GO:0050789", "GO:0032944", "GO:0002683", "GO:0050672", "GO:0022407", "GO:0008285", "GO:1903037", "GO:0050794", "GO:0030155", "GO:0048583", "GO:0070664", "GO:0002682", "GO:1903038", "GO:0002694", "GO:0051241", "GO:0051239", "GO:0050868", "GO:0022408", "GO:0070663", "GO:0050865", "GO:0048523", "GO:0048519", "GO:0032945", "GO:0048585", "GO:0051250", "GO:0051249", "GO:0038023", "GO:0005515", "GO:0003674", "GO:0005488", "GO:0060089" ]
[ "GO:0008150", "GO:0065007", "GO:0050789", "GO:0048519", "GO:0002683", "GO:0050794", "GO:0048583", "GO:0002682", "GO:0051241", "GO:0051239", "GO:0048523", "GO:0048585", "GO:0050777", "GO:0002695", "GO:0050776", "GO:0050866", "GO:0042127", "GO:0007162", "GO:0008285", "GO:0030155", "GO:0002694", "GO:0050865", "GO:0022407", "GO:0070664", "GO:0022408", "GO:0070663", "GO:0051250", "GO:0051249", "GO:0050670", "GO:0050863", "GO:0032944", "GO:0050672", "GO:1903037", "GO:1903038", "GO:0050868", "GO:0032945", "GO:0042130", "GO:0042129" ]
[ "GO:0003674", "GO:0005488", "GO:0060089", "GO:0038023", "GO:0005515" ]
null
[ "IPR008096", "IPR040216", "IPR007110", "IPR036179", "IPR013783", "IPR003599", "IPR013106" ]
af_db/AF-A0A096MJE4-F1-model_v4.cif.gz
10116.ENSRNOP00000073071
[ "10116.ENSRNOP00000001110", "10116.ENSRNOP00000000733", "10116.ENSRNOP00000034235", "10116.ENSRNOP00000031382", "10116.ENSRNOP00000064850", "10116.ENSRNOP00000016664", "10116.ENSRNOP00000035610", "10116.ENSRNOP00000006246", "10116.ENSRNOP00000048351", "10116.ENSRNOP00000021915", "10116.ENSRNOP00000014163", "10116.ENSRNOP00000070664", "10116.ENSRNOP00000021615", "10116.ENSRNOP00000029803", "10116.ENSRNOP00000004590", "10116.ENSRNOP00000013732", "10116.ENSRNOP00000067189", "10116.ENSRNOP00000073801", "10116.ENSRNOP00000056412", "10116.ENSRNOP00000001162", "10116.ENSRNOP00000023327", "10116.ENSRNOP00000029992", "10116.ENSRNOP00000010029", "10116.ENSRNOP00000003733", "10116.ENSRNOP00000003969", "10116.ENSRNOP00000009917", "10116.ENSRNOP00000013701", "10116.ENSRNOP00000050172", "10116.ENSRNOP00000040429", "10116.ENSRNOP00000010121", "10116.ENSRNOP00000036799", "10116.ENSRNOP00000064455", "10116.ENSRNOP00000052022", "10116.ENSRNOP00000026556", "10116.ENSRNOP00000051906", "10116.ENSRNOP00000004406", "10116.ENSRNOP00000041842", "10116.ENSRNOP00000071837", "10116.ENSRNOP00000018776", "10116.ENSRNOP00000059867", "10116.ENSRNOP00000017042", "10116.ENSRNOP00000036771", "10116.ENSRNOP00000050320", "10116.ENSRNOP00000063859", "10116.ENSRNOP00000073093", "10116.ENSRNOP00000066383", "10116.ENSRNOP00000025743", "10116.ENSRNOP00000049249", "10116.ENSRNOP00000070231", "10116.ENSRNOP00000074881", "10116.ENSRNOP00000012936", "10116.ENSRNOP00000003129", "10116.ENSRNOP00000052371", "10116.ENSRNOP00000027251", "10116.ENSRNOP00000002089", "10116.ENSRNOP00000038369", "10116.ENSRNOP00000051602", "10116.ENSRNOP00000009000", "10116.ENSRNOP00000003998", "10116.ENSRNOP00000020094" ]
[ { "protein2": "10116.ENSRNOP00000001110", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 59, "experimental": 0, "database": 0, "textmining": 748, "combined_score": 752 }, { "protein2": "10116.ENSRNOP00000000733", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 265, "database": 500, "textmining": 285, "combined_score": 720 }, { "protein2": "10116.ENSRNOP00000034235", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 135, "experimental": 0, "database": 0, "textmining": 732, "combined_score": 758 }, { "protein2": "10116.ENSRNOP00000031382", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 93, "experimental": 0, "database": 900, "textmining": 710, "combined_score": 971 }, { "protein2": "10116.ENSRNOP00000064850", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 0, "textmining": 770, "combined_score": 769 }, { "protein2": "10116.ENSRNOP00000016664", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 54, "experimental": 0, "database": 0, "textmining": 749, "combined_score": 752 }, { "protein2": "10116.ENSRNOP00000035610", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 0, "database": 0, "textmining": 699, "combined_score": 703 }, { "protein2": "10116.ENSRNOP00000006246", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 111, "experimental": 0, "database": 0, "textmining": 857, "combined_score": 867 }, { "protein2": "10116.ENSRNOP00000048351", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 119, "database": 0, "textmining": 865, "combined_score": 880 }, { "protein2": "10116.ENSRNOP00000021915", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 119, "experimental": 119, "database": 0, "textmining": 950, "combined_score": 958 }, { "protein2": "10116.ENSRNOP00000014163", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 144, "experimental": 0, "database": 0, "textmining": 724, "combined_score": 754 }, { "protein2": "10116.ENSRNOP00000070664", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 0, "textmining": 755, "combined_score": 779 }, { "protein2": "10116.ENSRNOP00000021615", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 99, "database": 0, "textmining": 706, "combined_score": 727 }, { "protein2": "10116.ENSRNOP00000029803", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 115, "experimental": 0, "database": 0, "textmining": 749, "combined_score": 768 }, { "protein2": "10116.ENSRNOP00000004590", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 0, "textmining": 704, "combined_score": 704 }, { "protein2": "10116.ENSRNOP00000013732", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 85, "experimental": 0, "database": 0, "textmining": 830, "combined_score": 838 }, { "protein2": "10116.ENSRNOP00000067189", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 116, "experimental": 0, "database": 0, "textmining": 836, "combined_score": 848 }, { "protein2": "10116.ENSRNOP00000073801", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 81, "experimental": 65, "database": 0, "textmining": 948, "combined_score": 951 }, { "protein2": "10116.ENSRNOP00000056412", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 72, "experimental": 0, "database": 0, "textmining": 806, "combined_score": 811 }, { "protein2": "10116.ENSRNOP00000001162", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 236, "experimental": 0, "database": 0, "textmining": 792, "combined_score": 834 }, { "protein2": "10116.ENSRNOP00000023327", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 115, "experimental": 0, "database": 0, "textmining": 908, "combined_score": 914 }, { "protein2": "10116.ENSRNOP00000029992", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 125, "database": 0, "textmining": 758, "combined_score": 781 }, { "protein2": "10116.ENSRNOP00000010029", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 301, "experimental": 0, "database": 0, "textmining": 766, "combined_score": 829 }, { "protein2": "10116.ENSRNOP00000003733", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 0, "database": 0, "textmining": 745, "combined_score": 752 }, { "protein2": "10116.ENSRNOP00000003969", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 0, "database": 0, "textmining": 702, "combined_score": 728 }, { "protein2": "10116.ENSRNOP00000009917", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 203, "experimental": 0, "database": 0, "textmining": 910, "combined_score": 925 }, { "protein2": "10116.ENSRNOP00000013701", "neighborhood": 0, "fusion": 0, "cooccurence": 128, "coexpression": 352, "experimental": 0, "database": 0, "textmining": 875, "combined_score": 923 }, { "protein2": "10116.ENSRNOP00000050172", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 85, "experimental": 0, "database": 0, "textmining": 768, "combined_score": 778 }, { "protein2": "10116.ENSRNOP00000040429", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 72, "experimental": 0, "database": 0, "textmining": 806, "combined_score": 811 }, { "protein2": "10116.ENSRNOP00000010121", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 180, "experimental": 0, "database": 0, "textmining": 672, "combined_score": 719 }, { "protein2": "10116.ENSRNOP00000036799", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 0, "textmining": 732, "combined_score": 734 }, { "protein2": "10116.ENSRNOP00000064455", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 564, "experimental": 0, "database": 0, "textmining": 947, "combined_score": 975 }, { "protein2": "10116.ENSRNOP00000052022", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 99, "experimental": 0, "database": 0, "textmining": 904, "combined_score": 909 }, { "protein2": "10116.ENSRNOP00000026556", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 90, "experimental": 0, "database": 0, "textmining": 712, "combined_score": 727 }, { "protein2": "10116.ENSRNOP00000051906", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 286, "experimental": 0, "database": 0, "textmining": 726, "combined_score": 795 }, { "protein2": "10116.ENSRNOP00000004406", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 145, "experimental": 0, "database": 0, "textmining": 675, "combined_score": 709 }, { "protein2": "10116.ENSRNOP00000041842", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 60, "experimental": 0, "database": 500, "textmining": 834, "combined_score": 915 }, { "protein2": "10116.ENSRNOP00000071837", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 100, "experimental": 100, "database": 500, "textmining": 402, "combined_score": 725 }, { "protein2": "10116.ENSRNOP00000018776", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 0, "textmining": 323, "combined_score": 807 }, { "protein2": "10116.ENSRNOP00000059867", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 60, "experimental": 0, "database": 900, "textmining": 262, "combined_score": 924 }, { "protein2": "10116.ENSRNOP00000017042", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 0, "textmining": 819, "combined_score": 820 }, { "protein2": "10116.ENSRNOP00000036771", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 109, "experimental": 119, "database": 0, "textmining": 940, "combined_score": 948 }, { "protein2": "10116.ENSRNOP00000050320", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 176, "experimental": 0, "database": 0, "textmining": 875, "combined_score": 892 }, { "protein2": "10116.ENSRNOP00000063859", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 76, "experimental": 0, "database": 0, "textmining": 712, "combined_score": 722 }, { "protein2": "10116.ENSRNOP00000073093", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 0, "database": 0, "textmining": 696, "combined_score": 700 }, { "protein2": "10116.ENSRNOP00000066383", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 214, "experimental": 0, "database": 0, "textmining": 728, "combined_score": 777 }, { "protein2": "10116.ENSRNOP00000025743", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 116, "experimental": 0, "database": 0, "textmining": 893, "combined_score": 901 }, { "protein2": "10116.ENSRNOP00000049249", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 89, "experimental": 0, "database": 0, "textmining": 881, "combined_score": 887 }, { "protein2": "10116.ENSRNOP00000070231", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 312, "experimental": 65, "database": 500, "textmining": 180, "combined_score": 700 }, { "protein2": "10116.ENSRNOP00000074881", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 150, "experimental": 0, "database": 0, "textmining": 822, "combined_score": 842 }, { "protein2": "10116.ENSRNOP00000012936", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 110, "experimental": 100, "database": 500, "textmining": 501, "combined_score": 773 }, { "protein2": "10116.ENSRNOP00000003129", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 132, "experimental": 788, "database": 900, "textmining": 998, "combined_score": 999 }, { "protein2": "10116.ENSRNOP00000052371", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 118, "experimental": 0, "database": 0, "textmining": 757, "combined_score": 776 }, { "protein2": "10116.ENSRNOP00000027251", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 182, "experimental": 0, "database": 0, "textmining": 825, "combined_score": 851 }, { "protein2": "10116.ENSRNOP00000002089", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 792, "database": 900, "textmining": 999, "combined_score": 999 }, { "protein2": "10116.ENSRNOP00000038369", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 65, "database": 500, "textmining": 562, "combined_score": 777 }, { "protein2": "10116.ENSRNOP00000051602", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 0, "textmining": 753, "combined_score": 754 }, { "protein2": "10116.ENSRNOP00000009000", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 0, "textmining": 728, "combined_score": 728 }, { "protein2": "10116.ENSRNOP00000003998", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 123, "experimental": 0, "database": 0, "textmining": 685, "combined_score": 712 }, { "protein2": "10116.ENSRNOP00000020094", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 97, "experimental": 0, "database": 0, "textmining": 690, "combined_score": 708 } ]
A0A096MK21
Vesicle-associated membrane protein 4
null
Rattus norvegicus (Rat)
52
null
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLCVLSPARSLILVNP
[ "GO:0051234", "GO:1900242", "GO:0051649", "GO:0030100", "GO:0051641", "GO:0016189", "GO:0016050", "GO:0016043", "GO:0071840", "GO:0009987", "GO:0060627", "GO:0051179", "GO:0065007", "GO:0016192", "GO:0051049", "GO:0008150", "GO:0048284", "GO:0016197", "GO:0046907", "GO:0099532", "GO:0051128", "GO:0006996", "GO:0050789", "GO:0007032", "GO:0010256", "GO:1903421", "GO:0032879", "GO:0006810", "GO:0050794" ]
[ "GO:0008150", "GO:0009987", "GO:0051179", "GO:0065007", "GO:0050789", "GO:0051234", "GO:0051641", "GO:0071840", "GO:0032879", "GO:0050794", "GO:0051649", "GO:0016043", "GO:0060627", "GO:0051049", "GO:0046907", "GO:0051128", "GO:0006810", "GO:0030100", "GO:0016192", "GO:0016197", "GO:0006996", "GO:0010256", "GO:1903421", "GO:1900242", "GO:0016050", "GO:0048284", "GO:0099532", "GO:0007032", "GO:0016189" ]
null
null
[ "IPR042887" ]
af_db/AF-A0A096MK21-F1-model_v4.cif.gz
null
null
null
A0A096MK86
Pappalysin
null
Rattus norvegicus (Rat)
1,623
null
MRLWSWVLRLGLLSAALGCGLAERPRRARRDPRAVRPPRPAAGPATCATRAARGRRASPPPPPGGAWEAVRVPRRRQQRAARGAEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQKSPAVITGLYDKCSYTSRDRGWVMGIHTISDQGNRDPRYFFSLKTDRARKVTTIDAHRSYLPGQWVHLAATYDGRLMKLYMNGAQVATSAEQVGGIFSPLTQKCKVLMLGGSALNHNFRGHIEHFSLWKVARTQREILSDMETRGLHTPLPQLLLQENWDNVKRTWSPMKDGHSPQVEFSNAHGFLLDTNLEPPLCGQTLCDNTEVISSYNQLPSFRQSKVVRYRVVNIYDDHHENPTVSWQQIDFQHQQLAEAFQHYNISWELDVLDINSSSLRHRLILANCDISKIGDEKCDPECNHTLTGHDGGDCRQLRYPAFMKKQQNGACDMDCNYERFNFDGGECCDPDITDVTKTCFDPDSPHRAYLDVNELKNILKLDGSTHLNIFFANSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGIPGHTHTMIHEIGHSLGLYHIFRGISEIQSCSDPCMETEPSFETGDLCNDTNPAPKHKFCGDPGPGNDTCGFHGFFDTPYNNFMSYADDDCTDSFTPNQVSRMHCYLDLVYQSWQPSRKPAPVALAPQIVGHTTDSVMLEWFPPIDGHFFERELGSACDLCLEGRILVQYAFNASSPMPCGPSGHWSPREAEGHPDVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQGCYLELEFRYPLVPESLTIWVTFVSSDWDSSGAVNDIKLLTVSGKNISLGPQNVFCDIPLTIRLRDVSEEVYGIQIYTLDEHLEIDAAMLTSAVDSPLCLQCKPLQYKVLRDPPLLDDVGSLLHLNRRFMDMDLKLGNVYQYRIITISGNEESEPSPAAIYTHGSGYCGDGVIQKDQGEECDDMNKVNGDGCSLFCKQEVSFNCIDEPSRCYFHDGDGMCEEFEQKTSIKDCGVYTPQGFLDQWASNASVSHQDQQCPGWVVIGQPAASQVCRTKVIDLSEGISQHAWYPCTINYPYYQLPQTTFWLQTYFSQPMVAAAVIIHLVTDGTYYGDQKQETISVQLLDTKDQSHDLGLHVLSCRNNPLIIPVVHDLSQPFYHSQAVHVSFSSPLVAISGVALRSFDNFDPVTLSSCQRGETYSPAEQSCVHFACEATDCPELTVENASLNCSSSHRYHGAQCTVSCQTGYVLQIQRDDELIKSQVGPSVTVTCTEGKWNKQVACEPVDCGIPDHHHVYAASFSCPEGTTFGRRCSFQCRHPAQLKGNNSFLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSLCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGTCVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGRGSNTIHCRKDGTWSGSFHVCREMQGQCSAPNQLNSHLKLQCPDGYAIGSECATSCLDHNSESIILPVNLTVRDIPHWMNPTRVQRIVCTAGLQWYPHPARIHCVKGCESERKKDRKKGRKKAKEEEEEEEEEEEEEEEEEEEEKREREHCFNFHTTANKIYFSASSYSSKEKYGT
[ "GO:0008152", "GO:0032354", "GO:0048545", "GO:0031960", "GO:0009057", "GO:1901700", "GO:0044706", "GO:0044238", "GO:0008150", "GO:0042221", "GO:0007565", "GO:0051384", "GO:0071548", "GO:0014070", "GO:1901654", "GO:1901575", "GO:0071704", "GO:0019538", "GO:1901564", "GO:0050896", "GO:0034698", "GO:1901565", "GO:0043170", "GO:0010033", "GO:0009725", "GO:0033993", "GO:0009056", "GO:0000003", "GO:0009719", "GO:0032501", "GO:0030163", "GO:0006807", "GO:0044703", "GO:0022414", "GO:0110165", "GO:0005575", "GO:0005576", "GO:0005615" ]
[ "GO:0008150", "GO:0008152", "GO:0050896", "GO:0000003", "GO:0032501", "GO:0022414", "GO:0044706", "GO:0044238", "GO:0042221", "GO:0071704", "GO:0009056", "GO:0009719", "GO:0006807", "GO:0044703", "GO:1901700", "GO:0007565", "GO:1901575", "GO:0019538", "GO:1901564", "GO:0043170", "GO:0010033", "GO:0009725", "GO:0048545", "GO:0009057", "GO:0014070", "GO:1901654", "GO:0034698", "GO:1901565", "GO:0033993", "GO:0030163", "GO:0032354", "GO:0031960", "GO:0071548", "GO:0051384" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005576", "GO:0005615" ]
[ "IPR013320", "IPR006558", "IPR024079", "IPR011936", "IPR000800", "IPR043543", "IPR008754", "IPR035976", "IPR000436" ]
null
null
null
null
A0A0A6YW14
Immunoglobulin heavy constant delta
null
Mus musculus (Mouse)
291
null
XNEKGPDMFLLSECKAPEENEKINLGCLVIGSQPLKISWEPKKSSIVEHVFPSEMRNGNYTMVLQVTVLASELNLNHTCTINKPKRKEKPFKFPESWDSQSSKRVTPTLQAKNHSTEATKAITTKKDIEGAMAPSNLTVNILTTSTHPEMSSWLLCEVSGFFPENIHLMWLSVHSKMKSTNFVTANPTPQPGGTFQTWSVLRLPVALSSSLDTYTCVVEHEASKTKLNASKSLAISGIVNTIQHSCIMDEQSDSYMDLEEENGLWPTMCTFVALFLLTLLYSGFVTFIKVK
[ "GO:0008152", "GO:0042100", "GO:0002449", "GO:0032946", "GO:0019724", "GO:0048856", "GO:0065007", "GO:0002696", "GO:0001775", "GO:0007275", "GO:0002250", "GO:0050670", "GO:0048518", "GO:0050776", "GO:0008150", "GO:0046651", "GO:0051251", "GO:0042127", "GO:0002440", "GO:0016445", "GO:0070661", "GO:0045321", "GO:0002200", "GO:0050896", "GO:0002520", "GO:0050789", "GO:0032944", "GO:0008283", "GO:0002566", "GO:0006955", "GO:0051240", "GO:0048731", "GO:0002684", "GO:0050794", "GO:0030888", "GO:0002460", "GO:0048583", "GO:0032502", "GO:0002376", "GO:0002682", "GO:0009987", "GO:0002443", "GO:0002694", "GO:0002252", "GO:0051239", "GO:0070665", "GO:0050864", "GO:0016064", "GO:0071704", "GO:0030890", "GO:0050871", "GO:0070663", "GO:0050865", "GO:0043170", "GO:0016446", "GO:0032943", "GO:0050867", "GO:0046649", "GO:0010467", "GO:0050671", "GO:0008284", "GO:0032501", "GO:0042113", "GO:0051249", "GO:0002377", "GO:0048522", "GO:0009897", "GO:0098552", "GO:0098797", "GO:0005575", "GO:0016020", "GO:0019814", "GO:0032991", "GO:0098802", "GO:0043235", "GO:0019815", "GO:0110165", "GO:0009986", "GO:0071944", "GO:0098796", "GO:0005886", "GO:0003823", "GO:0003674", "GO:0005488" ]
[ "GO:0008150", "GO:0008152", "GO:0065007", "GO:0048518", "GO:0050896", "GO:0050789", "GO:0032502", "GO:0002376", "GO:0009987", "GO:0032501", "GO:0048856", "GO:0001775", "GO:0007275", "GO:0002440", "GO:0045321", "GO:0002200", "GO:0002520", "GO:0008283", "GO:0006955", "GO:0051240", "GO:0002684", "GO:0050794", "GO:0048583", "GO:0002682", "GO:0002252", "GO:0051239", "GO:0071704", "GO:0048522", "GO:0002696", "GO:0002250", "GO:0050776", "GO:0042127", "GO:0016445", "GO:0070661", "GO:0002566", "GO:0048731", "GO:0002443", "GO:0002694", "GO:0050865", "GO:0043170", "GO:0050867", "GO:0046649", "GO:0008284", "GO:0002377", "GO:0002449", "GO:0046651", "GO:0051251", "GO:0002460", "GO:0070665", "GO:0070663", "GO:0016446", "GO:0032943", "GO:0010467", "GO:0042113", "GO:0051249", "GO:0042100", "GO:0032946", "GO:0019724", "GO:0050670", "GO:0032944", "GO:0050864", "GO:0050871", "GO:0050671", "GO:0030888", "GO:0016064", "GO:0030890" ]
[ "GO:0003674", "GO:0005488", "GO:0003823" ]
[ "GO:0005575", "GO:0032991", "GO:0110165", "GO:0098552", "GO:0016020", "GO:0019814", "GO:0043235", "GO:0009986", "GO:0071944", "GO:0098796", "GO:0009897", "GO:0098797", "GO:0098802", "GO:0019815", "GO:0005886" ]
[ "IPR007110", "IPR036179", "IPR013783", "IPR003006", "IPR003597", "IPR050380" ]
null
null
null
null
A0A0B4JCT2
Uncharacterized protein, isoform B
null
Drosophila melanogaster (Fruit fly)
298
Secreted {ECO:0000256|ARBA:ARBA00004613}.
MLDTKWPPLLLLLMLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDAHIVRITTARRTMILNELNEYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVVAEGGWQGDPLPPSSPSDPPNPEAPIPVEYHTEDEVIKATLEQMFAEYKECSMRDIIAFSPPNNRILRLRVSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNFVRTNDVNAPVYQSGDRPATECRSGRNPVFINLCSVNEIYDSSNLAGLF
[ "GO:0046692", "GO:0019953", "GO:0070727", "GO:0051641", "GO:0009987", "GO:0065008", "GO:0060180", "GO:0019098", "GO:0065007", "GO:0045924", "GO:0051179", "GO:0044706", "GO:0007610", "GO:0008150", "GO:0008104", "GO:0007320", "GO:0032504", "GO:0007620", "GO:0007617", "GO:0048609", "GO:0046008", "GO:0000003", "GO:0032501", "GO:0033036", "GO:0044703", "GO:0022414", "GO:0110165", "GO:0005575", "GO:0005576", "GO:0005615" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0051179", "GO:0000003", "GO:0032501", "GO:0022414", "GO:0019953", "GO:0051641", "GO:0065008", "GO:0019098", "GO:0044706", "GO:0007610", "GO:0032504", "GO:0048609", "GO:0033036", "GO:0044703", "GO:0046692", "GO:0070727", "GO:0045924", "GO:0007320", "GO:0007617", "GO:0060180", "GO:0008104", "GO:0007620", "GO:0046008" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005576", "GO:0005615" ]
[ "IPR014044", "IPR035940", "IPR034763" ]
af_db/AF-A0A0B4JCT2-F1-model_v4.cif.gz
7227.FBpp0292065
[ "7227.FBpp0087981", "7227.FBpp0311920", "7227.FBpp0080094", "7227.FBpp0073360", "7227.FBpp0079747", "7227.FBpp0307765", "7227.FBpp0077865", "7227.FBpp0075075", "7227.FBpp0084682", "7227.FBpp0078186", "7227.FBpp0289812", "7227.FBpp0082132", "7227.FBpp0111336", "7227.FBpp0310285", "7227.FBpp0074676", "7227.FBpp0290920", "7227.FBpp0082175", "7227.FBpp0311436", "7227.FBpp0071627", "7227.FBpp0079094", "7227.FBpp0082964", "7227.FBpp0084648", "7227.FBpp0084296", "7227.FBpp0309553", "7227.FBpp0081145", "7227.FBpp0296953", "7227.FBpp0077990", "7227.FBpp0309670", "7227.FBpp0071719", "7227.FBpp0309468", "7227.FBpp0110067", "7227.FBpp0072820", "7227.FBpp0080316", "7227.FBpp0079321", "7227.FBpp0080342", "7227.FBpp0079493", "7227.FBpp0081936", "7227.FBpp0080979", "7227.FBpp0072204", "7227.FBpp0087560", "7227.FBpp0311918", "7227.FBpp0311741", "7227.FBpp0310033", "7227.FBpp0079692", "7227.FBpp0293434", "7227.FBpp0084107", "7227.FBpp0075572", "7227.FBpp0084612", "7227.FBpp0078786", "7227.FBpp0293427", "7227.FBpp0079243", "7227.FBpp0079787", "7227.FBpp0307721", "7227.FBpp0298277", "7227.FBpp0077991", "7227.FBpp0076270" ]
[ { "protein2": "7227.FBpp0087981", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 895, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 895 }, { "protein2": "7227.FBpp0311920", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 856, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 856 }, { "protein2": "7227.FBpp0080094", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 839, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 839 }, { "protein2": "7227.FBpp0073360", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 703, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 703 }, { "protein2": "7227.FBpp0079747", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 458, "experimental": 0, "database": 0, "textmining": 491, "combined_score": 712 }, { "protein2": "7227.FBpp0307765", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 314, "experimental": 0, "database": 0, "textmining": 917, "combined_score": 940 }, { "protein2": "7227.FBpp0077865", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 856, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 856 }, { "protein2": "7227.FBpp0075075", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 836, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 836 }, { "protein2": "7227.FBpp0084682", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 348, "experimental": 0, "database": 0, "textmining": 834, "combined_score": 887 }, { "protein2": "7227.FBpp0078186", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 801, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 801 }, { "protein2": "7227.FBpp0289812", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 886, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 886 }, { "protein2": "7227.FBpp0082132", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 913, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 913 }, { "protein2": "7227.FBpp0111336", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 837, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 837 }, { "protein2": "7227.FBpp0310285", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 886, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 886 }, { "protein2": "7227.FBpp0074676", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 850, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 850 }, { "protein2": "7227.FBpp0290920", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 0, "textmining": 917, "combined_score": 930 }, { "protein2": "7227.FBpp0082175", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 836, "experimental": 0, "database": 0, "textmining": 51, "combined_score": 837 }, { "protein2": "7227.FBpp0311436", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 848, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 848 }, { "protein2": "7227.FBpp0071627", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 744, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 744 }, { "protein2": "7227.FBpp0079094", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 712, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 712 }, { "protein2": "7227.FBpp0082964", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 849, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 848 }, { "protein2": "7227.FBpp0084648", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 706, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 706 }, { "protein2": "7227.FBpp0084296", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 843, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 843 }, { "protein2": "7227.FBpp0309553", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 379, "experimental": 0, "database": 0, "textmining": 626, "combined_score": 757 }, { "protein2": "7227.FBpp0081145", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 843, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 843 }, { "protein2": "7227.FBpp0296953", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 929, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 929 }, { "protein2": "7227.FBpp0077990", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 413, "experimental": 0, "database": 0, "textmining": 658, "combined_score": 790 }, { "protein2": "7227.FBpp0309670", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 821, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 820 }, { "protein2": "7227.FBpp0071719", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 700, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 700 }, { "protein2": "7227.FBpp0309468", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 340, "experimental": 0, "database": 0, "textmining": 900, "combined_score": 931 }, { "protein2": "7227.FBpp0110067", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 175, "experimental": 0, "database": 0, "textmining": 668, "combined_score": 714 }, { "protein2": "7227.FBpp0072820", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 237, "experimental": 0, "database": 0, "textmining": 791, "combined_score": 833 }, { "protein2": "7227.FBpp0080316", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 726, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 726 }, { "protein2": "7227.FBpp0079321", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 271, "experimental": 0, "database": 0, "textmining": 669, "combined_score": 748 }, { "protein2": "7227.FBpp0080342", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 0, "textmining": 828, "combined_score": 843 }, { "protein2": "7227.FBpp0079493", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 833, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 833 }, { "protein2": "7227.FBpp0081936", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 709, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 709 }, { "protein2": "7227.FBpp0080979", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 567, "experimental": 0, "database": 0, "textmining": 430, "combined_score": 742 }, { "protein2": "7227.FBpp0072204", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 853, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 853 }, { "protein2": "7227.FBpp0087560", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 201, "experimental": 0, "database": 0, "textmining": 916, "combined_score": 930 }, { "protein2": "7227.FBpp0311918", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 851, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 851 }, { "protein2": "7227.FBpp0311741", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 589, "experimental": 0, "database": 0, "textmining": 433, "combined_score": 757 }, { "protein2": "7227.FBpp0310033", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 859, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 859 }, { "protein2": "7227.FBpp0079692", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 855, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 855 }, { "protein2": "7227.FBpp0293434", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 709, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 709 }, { "protein2": "7227.FBpp0084107", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 718, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 718 }, { "protein2": "7227.FBpp0075572", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 267, "experimental": 0, "database": 0, "textmining": 834, "combined_score": 873 }, { "protein2": "7227.FBpp0084612", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 848, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 848 }, { "protein2": "7227.FBpp0078786", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 497, "experimental": 0, "database": 0, "textmining": 660, "combined_score": 821 }, { "protein2": "7227.FBpp0293427", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 868, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 868 }, { "protein2": "7227.FBpp0079243", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 479, "experimental": 0, "database": 0, "textmining": 603, "combined_score": 784 }, { "protein2": "7227.FBpp0079787", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 750, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 750 }, { "protein2": "7227.FBpp0307721", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 850, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 850 }, { "protein2": "7227.FBpp0298277", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 855, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 855 }, { "protein2": "7227.FBpp0077991", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 257, "experimental": 0, "database": 0, "textmining": 893, "combined_score": 917 }, { "protein2": "7227.FBpp0076270", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 753, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 753 } ]
A0A0B4JDB9
Eukaryotic translation initiation factor 4E homologous protein, isoform D
null
Drosophila melanogaster (Fruit fly)
242
null
MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQHTYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQFLVGDEICGVVLQTKYPEDSLSVWHRTATDMTSTTRIRDTLRRILNIPLTTALEYKIHCDSLKYVSMPRRQNHKLGNLFYRNRYGFNSRYGKS
[ "GO:0062013", "GO:0065008", "GO:0017148", "GO:0019218", "GO:0065007", "GO:0051172", "GO:0032352", "GO:0010565", "GO:0048518", "GO:0045966", "GO:0046886", "GO:0050810", "GO:0045940", "GO:0008150", "GO:0034248", "GO:0010556", "GO:0032350", "GO:0050789", "GO:0031325", "GO:0019222", "GO:0051246", "GO:0090031", "GO:0010605", "GO:0090030", "GO:0046885", "GO:2000112", "GO:0009889", "GO:0050794", "GO:0051248", "GO:0062012", "GO:0031326", "GO:0051171", "GO:0009893", "GO:0007554", "GO:0010893", "GO:0046889", "GO:0060255", "GO:0007553", "GO:0031323", "GO:0009890", "GO:0006417", "GO:0046890", "GO:0010558", "GO:0080090", "GO:0031327", "GO:0010817", "GO:2000113", "GO:0031324", "GO:0045834", "GO:0019216", "GO:0048523", "GO:0048519", "GO:0010566", "GO:0009891", "GO:0031328", "GO:0010629", "GO:0010468", "GO:0034249", "GO:0045998", "GO:0009892", "GO:0048522", "GO:0010608", "GO:0045182", "GO:0003676", "GO:0005488", "GO:0003723", "GO:0030371", "GO:0000340", "GO:0000339", "GO:0097159", "GO:0003674", "GO:1901363", "GO:0005515" ]
[ "GO:0008150", "GO:0065007", "GO:0048518", "GO:0050789", "GO:0048519", "GO:0065008", "GO:0019222", "GO:0050794", "GO:0009893", "GO:0048523", "GO:0009892", "GO:0048522", "GO:0062013", "GO:0051172", "GO:0032352", "GO:0032350", "GO:0031325", "GO:0010605", "GO:0009889", "GO:0062012", "GO:0051171", "GO:0060255", "GO:0031323", "GO:0009890", "GO:0080090", "GO:0010817", "GO:0031324", "GO:0045834", "GO:0009891", "GO:0010565", "GO:0045966", "GO:0046886", "GO:0045940", "GO:0034248", "GO:0010556", "GO:0051246", "GO:0046885", "GO:0051248", "GO:0031326", "GO:0046889", "GO:0007553", "GO:0046890", "GO:0010558", "GO:0031327", "GO:0019216", "GO:0031328", "GO:0010629", "GO:0010468", "GO:0034249", "GO:0017148", "GO:0019218", "GO:0050810", "GO:0090031", "GO:0090030", "GO:2000112", "GO:0007554", "GO:0010893", "GO:0006417", "GO:2000113", "GO:0010566", "GO:0045998", "GO:0010608" ]
[ "GO:0003674", "GO:0045182", "GO:0005488", "GO:0030371", "GO:0097159", "GO:1901363", "GO:0005515", "GO:0003676", "GO:0003723", "GO:0000339", "GO:0000340" ]
null
[ "IPR023398", "IPR001040" ]
af_db/AF-A0A0B4JDB9-F1-model_v4.cif.gz
null
null
null
A0A0B4K621
Rfx, isoform G
null
Drosophila melanogaster (Fruit fly)
860
null
MHSRYGFDCQTRHYQQHQQTHHQHHHHHHPNPPCSIPLESPPTPPVISPSAAAAVAYSNLLEKCRCKQSVAANPVPAPPAQLQLQLHHHHHHHHHQTFVASASATSYSNCSALGLGSRTGSGSGSGSGTGSTPSTSSLANSSCAAATNISGGSSNATMYHHHHRRHNNLSYCGVSGQEQNYQVQYVDSELYHSNSSQTQMTYPFCPVGDYQGNGQTAYYSTTGQYGTTSSAGGSSNGAHSTTLPYLVPVEEGILLNGSAHSLSQSQSQSHGRDSPHSLTEVAYIQEAQSTPQTPTSTTTTHSASGGSLGTGGGGASPDSDQSALGSSNKIASATIKWLSRNYETADGVSLPRSTLYNHYMQHCSEHKLEPVNAASFGKLIRSVFSGLRTRRLGTRGNSKYHYYGIRIKPGSLLNSQAMDDKQMLAAGYGPSSDGTGGPGSGPMVSVTSSTAGQLTGSNGLGGGHGQRHSNGTKKHTFKPETYEACIQYIGDGTSALPSFPPIELNHSFNSELTLEDVDTFRGLYREHCESFLDAVLNLEFNTVEFLLRDFWRASDNNNLDECEEEKYLSKTKLYLLCHCAEVQKFVREVDYQFYQNTVDVIIPDVLRSIPNALTQAIRNFAKNLEIWLCESMLGVPEQLAQIKTSAVSAFCQTLRRYTSLNHLAQAARAVLQNGAQISQMLSDLNRVDFHNVQEQAAWVSQCAPAVVQRLESDFKAALQQQSSLEQWASWLQLVVESAMEEYNGKPTYARAARQFLLKWSFYSSMIIRDLTLRSASSFGSFHLIRLLFDEYMFYLVEHKIAEAQDKTAIAVICERMKKDMDFEFECQFAYITSDTEHQTTPSSASSGGDVGNEAKRLKQE
[ "GO:0032989", "GO:0000902", "GO:0048667", "GO:0048869", "GO:0048856", "GO:0065007", "GO:0022008", "GO:0007275", "GO:0007605", "GO:0009653", "GO:0000904", "GO:0030030", "GO:0008150", "GO:0007399", "GO:0010556", "GO:0050789", "GO:0048468", "GO:0019222", "GO:0030154", "GO:0016358", "GO:0031175", "GO:0032990", "GO:0048731", "GO:0009889", "GO:0050794", "GO:0051171", "GO:0031326", "GO:0048812", "GO:0048699", "GO:1903506", "GO:0032502", "GO:0060255", "GO:0009987", "GO:0031323", "GO:0016043", "GO:0019219", "GO:0071840", "GO:0050877", "GO:0048813", "GO:2001141", "GO:0080090", "GO:0120039", "GO:0051252", "GO:0120036", "GO:0050954", "GO:0048858", "GO:0006355", "GO:0030182", "GO:0003008", "GO:0007600", "GO:0010468", "GO:0032501", "GO:0048666", "GO:0003676", "GO:0003677", "GO:0097159", "GO:0005488", "GO:1901363", "GO:0003674", "GO:0043565" ]
[ "GO:0008150", "GO:0065007", "GO:0050789", "GO:0032502", "GO:0009987", "GO:0032501", "GO:0048869", "GO:0048856", "GO:0007275", "GO:0009653", "GO:0019222", "GO:0050794", "GO:0071840", "GO:0003008", "GO:0032989", "GO:0000902", "GO:0048468", "GO:0030154", "GO:0016358", "GO:0048731", "GO:0009889", "GO:0051171", "GO:0060255", "GO:0031323", "GO:0016043", "GO:0050877", "GO:0080090", "GO:0022008", "GO:0000904", "GO:0030030", "GO:0007399", "GO:0010556", "GO:0032990", "GO:0031326", "GO:0019219", "GO:0048813", "GO:0051252", "GO:0048858", "GO:0030182", "GO:0007600", "GO:0010468", "GO:0048666", "GO:0048667", "GO:0031175", "GO:0048699", "GO:2001141", "GO:0120039", "GO:0120036", "GO:0050954", "GO:0006355", "GO:0007605", "GO:0048812", "GO:1903506" ]
[ "GO:0003674", "GO:0005488", "GO:0097159", "GO:1901363", "GO:0003676", "GO:0003677", "GO:0043565" ]
null
[ "IPR003150", "IPR039779", "IPR036388", "IPR036390" ]
af_db/AF-A0A0B4K621-F1-model_v4.cif.gz
null
null
null
A0A0B4K6N2
Forkhead box P, isoform C
null
Drosophila melanogaster (Fruit fly)
520
Nucleus {ECO:0000256|ARBA:ARBA00004123, ECO:0000256|PROSITE-ProRule:PRU00089}.
MHRIHDDEYSEDAKESDFKSSIQKEISVKSRHQISIPDICSDAVKNNCFPPTGFLNNSITFASHVVKCSSPASSIDESSTAAQQHESNPHMHIQGQHMMAPVPDLGFYNVPEFISEQEKLMFSDAERFLRSKDNEVCNNDFSYMHDEFAMRKYYHPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQAMMHHLYLSKQLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQTNSPSPLNLPMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVPTDKNPCDNCTQHCTSLPPGADNPLDSNNPNDLGRIGCLPYCGSDGLSKASKDYSNMDSGMIESNSHLTIDEYSTNMYESSANEHNR
[ "GO:0035106", "GO:0008049", "GO:0016545", "GO:0040011", "GO:0019098", "GO:0050890", "GO:0048065", "GO:0050877", "GO:0007612", "GO:0008150", "GO:0007619", "GO:0032504", "GO:0007617", "GO:0060179", "GO:0007611", "GO:0003008", "GO:0000003", "GO:0032501", "GO:0007610", "GO:0045433", "GO:0022414", "GO:0042803", "GO:0042802", "GO:0005488", "GO:0003674", "GO:0005515", "GO:0046983" ]
[ "GO:0008150", "GO:0040011", "GO:0000003", "GO:0032501", "GO:0022414", "GO:0019098", "GO:0032504", "GO:0003008", "GO:0007610", "GO:0050877", "GO:0007617", "GO:0007611", "GO:0050890", "GO:0007612", "GO:0007619", "GO:0060179", "GO:0035106", "GO:0008049", "GO:0048065", "GO:0045433", "GO:0016545" ]
[ "GO:0003674", "GO:0005488", "GO:0005515", "GO:0042802", "GO:0046983", "GO:0042803" ]
null
[ "IPR001766", "IPR050998", "IPR032354", "IPR036388", "IPR036390" ]
af_db/AF-A0A0B4K6N2-F1-model_v4.cif.gz
7227.FBpp0293409
null
null
A0A0B4K711
N-acetylgalactosaminide beta-1,3-galactosyltransferase (EC 2.4.1.122)
null
Drosophila melanogaster (Fruit fly)
444
Membrane {ECO:0000256|ARBA:ARBA00004606}; Single-pass type II membrane protein {ECO:0000256|ARBA:ARBA00004606}.
MSETIYCLAPRSKNRSVFTLIAGLVVGYCLAQIFSSIAPHESLYPYLSRRFSDSQVATGGQLAPEQSGLKHDHRNDNVSVAEQLKKEVRILCWVMTNPTNHKKKARHVKRTWGKRCNILLFMSSGADEELPTVKLDVGEGRENLWAKVKEAFKYVYHHHYNDADFFYKADDDTYAVIENMRYMLYPYNPETPVHFGFKFKPFVKQGYMSGGAGYILSREALRRFVVEGIPNPKMCLPGTVVNEDIEIGRCMENLNVTAGDSRDEIGRGRMFPFIPEHHLIPAKADKNFWYWNYLYYKTDDGLDCCSDLAISFHYVAPNSFYVLDYLIYHLKPYGLLRSLEPLPAKLKVGQFLPPPVEARGRLASNEDSADDYDRIYTTTTEKPKEPDAREMDSKEVEKEDAKYREKLSKEDEEREDSRKTDNDSEYTEEETEKRSKSKETSKEN
[ "GO:0008152", "GO:0036211", "GO:1901566", "GO:0044249", "GO:0009987", "GO:0009059", "GO:0006486", "GO:0009058", "GO:0044238", "GO:0009101", "GO:0044237", "GO:0043412", "GO:0008150", "GO:1901564", "GO:1901576", "GO:0034645", "GO:0071704", "GO:1901137", "GO:0009100", "GO:0044260", "GO:0043170", "GO:0043413", "GO:1901135", "GO:0019538", "GO:0006807", "GO:0070085", "GO:0005794", "GO:0043229", "GO:0043226", "GO:0005622", "GO:0110165", "GO:0005797", "GO:0031985", "GO:0005737", "GO:0005575", "GO:0043227", "GO:0012505", "GO:0031984", "GO:0043231", "GO:0098791", "GO:0005795", "GO:0008378", "GO:0016740", "GO:0048531", "GO:0003674", "GO:0003824", "GO:0016757", "GO:0016758" ]
[ "GO:0008150", "GO:0008152", "GO:0009987", "GO:0009058", "GO:0044238", "GO:0044237", "GO:0071704", "GO:0006807", "GO:0070085", "GO:0044249", "GO:1901564", "GO:1901576", "GO:0044260", "GO:0043170", "GO:0043413", "GO:1901135", "GO:0019538", "GO:0036211", "GO:1901566", "GO:0009059", "GO:0006486", "GO:0043412", "GO:0034645", "GO:1901137", "GO:0009100", "GO:0009101" ]
[ "GO:0003674", "GO:0003824", "GO:0016740", "GO:0016757", "GO:0016758", "GO:0008378", "GO:0048531" ]
[ "GO:0005575", "GO:0110165", "GO:0043226", "GO:0005622", "GO:0005737", "GO:0012505", "GO:0031984", "GO:0005794", "GO:0043229", "GO:0043227", "GO:0098791", "GO:0031985", "GO:0043231", "GO:0005795", "GO:0005797" ]
[ "IPR026050", "IPR003378" ]
af_db/AF-A0A0B4K711-F1-model_v4.cif.gz
null
null
null
A0A0B4K7I2
Smooth, isoform T
null
Drosophila melanogaster (Fruit fly)
552
null
MPYNGASNGSGASGAGGGGATIVVTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLYVATLSTPQQHVSHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHHQQQLVAPAQSHNLYQFKEPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN
[ "GO:0032989", "GO:0009605", "GO:0040011", "GO:0000902", "GO:0048667", "GO:0048869", "GO:0048856", "GO:0022008", "GO:0008343", "GO:0007275", "GO:0009653", "GO:0008340", "GO:0000904", "GO:0007411", "GO:0008150", "GO:0030030", "GO:0042221", "GO:0007399", "GO:0050896", "GO:0048468", "GO:0042330", "GO:0030154", "GO:0031175", "GO:0097485", "GO:0032990", "GO:0048731", "GO:0048812", "GO:0048699", "GO:0007631", "GO:0032502", "GO:0009987", "GO:0016043", "GO:0071840", "GO:0030534", "GO:0120039", "GO:0120036", "GO:0061564", "GO:0006935", "GO:0048858", "GO:0007409", "GO:0030182", "GO:0032501", "GO:0048666", "GO:0007610", "GO:0005622", "GO:0031981", "GO:0043229", "GO:0043226", "GO:0110165", "GO:0043231", "GO:0070013", "GO:0043233", "GO:0005575", "GO:0043227", "GO:0031974", "GO:0005634", "GO:0005654" ]
[ "GO:0008150", "GO:0040011", "GO:0050896", "GO:0032502", "GO:0009987", "GO:0032501", "GO:0009605", "GO:0048869", "GO:0048856", "GO:0007275", "GO:0009653", "GO:0008340", "GO:0042221", "GO:0042330", "GO:0071840", "GO:0007610", "GO:0032989", "GO:0000902", "GO:0048468", "GO:0030154", "GO:0048731", "GO:0007631", "GO:0016043", "GO:0030534", "GO:0006935", "GO:0022008", "GO:0008343", "GO:0000904", "GO:0030030", "GO:0007399", "GO:0097485", "GO:0032990", "GO:0048858", "GO:0030182", "GO:0048666", "GO:0048667", "GO:0007411", "GO:0031175", "GO:0048699", "GO:0120039", "GO:0120036", "GO:0048812", "GO:0061564", "GO:0007409" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0031974", "GO:0005654", "GO:0043229", "GO:0043233", "GO:0043227", "GO:0043231", "GO:0070013", "GO:0031981", "GO:0005634" ]
[ "IPR055204", "IPR012677", "IPR021790", "IPR035979", "IPR000504" ]
af_db/AF-A0A0B4K7I2-F1-model_v4.cif.gz
7227.FBpp0300947
[ "7227.FBpp0300969", "7227.FBpp0297632", "7227.FBpp0075684", "7227.FBpp0089363", "7227.FBpp0290145", "7227.FBpp0303793", "7227.FBpp0301731", "7227.FBpp0073610" ]
[ { "protein2": "7227.FBpp0300969", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 994, "database": 0, "textmining": 0, "combined_score": 994 }, { "protein2": "7227.FBpp0297632", "neighborhood": 0, "fusion": 0, "cooccurence": 118, "coexpression": 147, "experimental": 534, "database": 400, "textmining": 346, "combined_score": 837 }, { "protein2": "7227.FBpp0075684", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 263, "experimental": 103, "database": 540, "textmining": 143, "combined_score": 704 }, { "protein2": "7227.FBpp0089363", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 320, "experimental": 475, "database": 400, "textmining": 262, "combined_score": 820 }, { "protein2": "7227.FBpp0290145", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 133, "experimental": 268, "database": 400, "textmining": 407, "combined_score": 743 }, { "protein2": "7227.FBpp0303793", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 295, "experimental": 48, "database": 540, "textmining": 148, "combined_score": 701 }, { "protein2": "7227.FBpp0301731", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 994, "database": 0, "textmining": 0, "combined_score": 994 }, { "protein2": "7227.FBpp0073610", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 731, "database": 0, "textmining": 0, "combined_score": 731 } ]
A0A0B4K7M0
Phosphatidylinositol 4-phosphate 5-kinase 59B, isoform H (EC 2.7.1.68)
null
Drosophila melanogaster (Fruit fly)
756
null
MASGDGDTINTIDMDSSSASQAKLAEPSNASTDHVGNSSPDLGNRPNRASSKADKERKIGHRRVGEGGEITYKKIQTSQIMGSIQLGIQHTVGSLASKPKRDLLMMDFWEIESITFPPEGSSLTPAHHYSEFRYKIYAPIAFRYFRDLFGIQPDDFMMSMCTSPLRELSNPGASGSIFYLTTDDEFIIKTVQHKEGEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCLQTSNAKNIRLVVMNNLLPSSVKMHLKYDLKGSTFKRKANKAERAKKSPTYKDLDFMEQHPNGIFLEAETYAALIKTIQRDCTVLESFKIMDYSLLLGVHNLDVALKEKQSEQRKPLRAPLAEDSDVDADDPLDGDAATGISRNKSVNRQRLVAHSTAMESIQAESEPIDDEEDVPPGGIPARSEKGERLLLYIGIIDILQSYRLKKKLEHTFKSIIHDGETVSVCRPSFYAQRFQNFMAKTVFRKIPSPLKHSPSKRKSLSKAIQRSIDSDNEVASRPVHASHSHSSGKIHQPAKPPTTEPTPAGAAGGAERGATALGPATTSGASERAPPPVKQRTPAASNLKTRVPPPVPPRGSPRRKDAQDRTTPGTTPSCSSTPPPAFDDISEDSSNKNSSSSIGRRSHHHHHHHQQSQQHQQSYYLDRKMNIGPAYRGSYKEDIVSVSEVHLDTLLAVDTSSSSQYGSRGGLAWTPPASGEGSTPTWTEGTPSFTDSSSSGDLDNFSPINSSKIDRHKPTVEEAINSLSAGMIN
[ "GO:0009581", "GO:0009605", "GO:0071478", "GO:0009628", "GO:0050793", "GO:0065008", "GO:0065007", "GO:0009416", "GO:0051963", "GO:1903725", "GO:0007603", "GO:0048518", "GO:0104004", "GO:0008150", "GO:0010562", "GO:0019220", "GO:0050807", "GO:0050896", "GO:0050789", "GO:0010511", "GO:0031325", "GO:0019222", "GO:0009314", "GO:1901888", "GO:0071214", "GO:0009889", "GO:0050794", "GO:0009584", "GO:0031326", "GO:0009893", "GO:0051716", "GO:0046889", "GO:0009987", "GO:0009582", "GO:0010513", "GO:0023052", "GO:0050803", "GO:0031323", "GO:0045937", "GO:0046890", "GO:0071073", "GO:0051606", "GO:0080090", "GO:0008582", "GO:0051128", "GO:0071071", "GO:0045834", "GO:0019216", "GO:0007602", "GO:0009891", "GO:0031328", "GO:1903727", "GO:0007154", "GO:0007165", "GO:0040008", "GO:0048638", "GO:0051174", "GO:0044087", "GO:1904396", "GO:0071482", "GO:0048522", "GO:0009583", "GO:0098858", "GO:0033583", "GO:0098590", "GO:0042995", "GO:0005575", "GO:0031253", "GO:0016020", "GO:0120025", "GO:0016028", "GO:0035997", "GO:0110165", "GO:0005902", "GO:0031528", "GO:0071944", "GO:0035996", "GO:0005886" ]
[ "GO:0008150", "GO:0065007", "GO:0048518", "GO:0050896", "GO:0050789", "GO:0009987", "GO:0023052", "GO:0009605", "GO:0009628", "GO:0050793", "GO:0065008", "GO:0019222", "GO:0050794", "GO:0009893", "GO:0051716", "GO:0051606", "GO:0007154", "GO:0007165", "GO:0040008", "GO:0048522", "GO:0009581", "GO:0104004", "GO:0031325", "GO:0009314", "GO:0071214", "GO:0009889", "GO:0009582", "GO:0050803", "GO:0031323", "GO:0080090", "GO:0051128", "GO:0045834", "GO:0007602", "GO:0009891", "GO:0048638", "GO:0044087", "GO:0071478", "GO:0009416", "GO:0007603", "GO:0010562", "GO:0050807", "GO:1901888", "GO:0031326", "GO:0046889", "GO:0046890", "GO:0008582", "GO:0019216", "GO:0031328", "GO:1903727", "GO:0051174", "GO:0009583", "GO:0051963", "GO:1903725", "GO:0019220", "GO:0010511", "GO:0009584", "GO:0010513", "GO:0045937", "GO:0071073", "GO:0071071", "GO:1904396", "GO:0071482" ]
null
[ "GO:0005575", "GO:0110165", "GO:0042995", "GO:0016020", "GO:0071944", "GO:0098590", "GO:0120025", "GO:0005886", "GO:0098858", "GO:0031253", "GO:0016028", "GO:0033583", "GO:0005902", "GO:0031528", "GO:0035996", "GO:0035997" ]
[ "IPR027483", "IPR002498", "IPR027484", "IPR023610" ]
af_db/AF-A0A0B4K7M0-F1-model_v4.cif.gz
null
null
null
A0A0B4K7W6
Without children, isoform C
null
Drosophila melanogaster (Fruit fly)
712
null
MSTKMGINTGKGGVGGKKSGSGTMLPVISTVQSLASGETEARIGNLTVRRKRGRPRESGTSSPPLSMPGVHPPAQRGRPRKHAVDYSARSPSPTMSGGSSHMGIPVRRNTTTTMDFGPATVTETKIITVPPYPKAVRNVNISCKPLTVTQGEQCSPDVRDCATQTEKDYSNKVLIPVPVPIFVPQPMYMYSAPFPVPVPIPLPIPVPIFIPTTRNTAQGILKEIKKIQDKMPEDPLEAELLMMAEMVAEEKHESDSDSDNEIKPDPGLVALQYQNSLESVAQQQQQQQVVDVSGAGHNPYGDDMLQIALKMATGDYDNHHQTSTVDLETSMTANTISSQSPMGHDGMGQMGVHHLDQQHHMLDATQRTARGRKRGVGVVMDPPNRNSRSPVKRQRGGEMDHSALQQQSQQAQQPQEKPDAQMFLKYTFGVNAWKQWVMTKNADIEKSSMRRRPFKTELLQMTADELNYSLCLFVKEVRKPNGTEYAPDTIYYLVLGIQQYLYVNGRIDNIFYDPYYERFTECLDEVARKFSVLYNDSQYIVTRVEEEHLWECKQLGAHSPHVLLSTLMFFNTKHFNLTTVEEHMQLSFSHIMKHWKRSSQNSKVPGSRNVLLRFYPPQAGLDANPRKKKVYEQQENEENPLRCPVRLYEFYLSKCPESVKTRNDVFYLQPERSCVPDSPVWYSTQALGQDALQRMLHRVKMVKEINIALLTT
[ "GO:0008152", "GO:0042180", "GO:0006357", "GO:1901615", "GO:0048856", "GO:0002165", "GO:0007275", "GO:1901362", "GO:0009058", "GO:0008205", "GO:1901576", "GO:0010556", "GO:0050789", "GO:0019222", "GO:0008202", "GO:0006694", "GO:0016126", "GO:1901617", "GO:0060255", "GO:0042445", "GO:0006066", "GO:0044249", "GO:2001141", "GO:0071704", "GO:0010817", "GO:1902653", "GO:0006355", "GO:0046165", "GO:0042446", "GO:0010468", "GO:0032501", "GO:0009791", "GO:0016125", "GO:1902652", "GO:0065008", "GO:0065007", "GO:0044237", "GO:1901360", "GO:0008150", "GO:0006629", "GO:0044283", "GO:0044281", "GO:0006697", "GO:0009889", "GO:0050794", "GO:0051171", "GO:0031326", "GO:1903506", "GO:0032502", "GO:0045455", "GO:0009987", "GO:0031323", "GO:0019219", "GO:0042181", "GO:0080090", "GO:0051252", "GO:0045456", "GO:0008610", "GO:0044238", "GO:0005622", "GO:0043226", "GO:0098687", "GO:0005700", "GO:0000791", "GO:0005575", "GO:0000785", "GO:0043231", "GO:0032991", "GO:0005694", "GO:0043229", "GO:0110165", "GO:0043232", "GO:0043227", "GO:0005634", "GO:0005705", "GO:0043228", "GO:0003682", "GO:0003674", "GO:0005488", "GO:0005515" ]
[ "GO:0008150", "GO:0008152", "GO:0050789", "GO:0032501", "GO:0065007", "GO:0032502", "GO:0009987", "GO:0048856", "GO:0007275", "GO:0009058", "GO:0019222", "GO:0042445", "GO:0071704", "GO:0009791", "GO:0065008", "GO:0044237", "GO:0044281", "GO:0050794", "GO:0044238", "GO:0042180", "GO:1901615", "GO:0002165", "GO:1901576", "GO:0060255", "GO:0006066", "GO:0044249", "GO:0010817", "GO:0042446", "GO:1901360", "GO:0006629", "GO:0044283", "GO:0009889", "GO:0051171", "GO:0045455", "GO:0031323", "GO:0080090", "GO:1901362", "GO:0008205", "GO:0010556", "GO:0008202", "GO:1901617", "GO:0046165", "GO:0010468", "GO:0016125", "GO:1902652", "GO:0031326", "GO:0019219", "GO:0042181", "GO:0051252", "GO:0045456", "GO:0008610", "GO:0006694", "GO:0016126", "GO:2001141", "GO:1902653", "GO:0006355", "GO:0006697", "GO:0006357", "GO:1903506" ]
[ "GO:0003674", "GO:0005488", "GO:0003682", "GO:0005515" ]
[ "GO:0005575", "GO:0032991", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0098687", "GO:0000785", "GO:0000791", "GO:0043229", "GO:0043227", "GO:0005705", "GO:0043228", "GO:0043231", "GO:0043232", "GO:0005694", "GO:0005634", "GO:0005700" ]
[ "IPR021893", "IPR051284" ]
af_db/AF-A0A0B4K7W6-F1-model_v4.cif.gz
null
null
null
A0A0B4K852
Smooth, isoform M
null
Drosophila melanogaster (Fruit fly)
497
null
MPYNGASNGSGASGAGGGGATIVVTEGPQNKKIRTGVQQPGENDVHMHARSTPQQNQQQALMNKSNDDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPIKEIGNGRSPLLQEPLYEPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAWNNAASEGMIEKENEVDTKVDIYN
[ "GO:0032989", "GO:0009605", "GO:0040011", "GO:0000902", "GO:0048667", "GO:0048869", "GO:0048856", "GO:0022008", "GO:0008343", "GO:0007275", "GO:0009653", "GO:0008340", "GO:0000904", "GO:0007411", "GO:0008150", "GO:0030030", "GO:0042221", "GO:0007399", "GO:0050896", "GO:0048468", "GO:0042330", "GO:0030154", "GO:0031175", "GO:0097485", "GO:0032990", "GO:0048731", "GO:0048812", "GO:0048699", "GO:0007631", "GO:0032502", "GO:0009987", "GO:0016043", "GO:0071840", "GO:0030534", "GO:0120039", "GO:0120036", "GO:0061564", "GO:0006935", "GO:0048858", "GO:0007409", "GO:0030182", "GO:0032501", "GO:0048666", "GO:0007610", "GO:0005622", "GO:0031981", "GO:0043229", "GO:0043226", "GO:0110165", "GO:0043231", "GO:0070013", "GO:0043233", "GO:0005575", "GO:0043227", "GO:0031974", "GO:0005634", "GO:0005654" ]
[ "GO:0008150", "GO:0040011", "GO:0050896", "GO:0032502", "GO:0009987", "GO:0032501", "GO:0009605", "GO:0048869", "GO:0048856", "GO:0007275", "GO:0009653", "GO:0008340", "GO:0042221", "GO:0042330", "GO:0071840", "GO:0007610", "GO:0032989", "GO:0000902", "GO:0048468", "GO:0030154", "GO:0048731", "GO:0007631", "GO:0016043", "GO:0030534", "GO:0006935", "GO:0022008", "GO:0008343", "GO:0000904", "GO:0030030", "GO:0007399", "GO:0097485", "GO:0032990", "GO:0048858", "GO:0030182", "GO:0048666", "GO:0048667", "GO:0007411", "GO:0031175", "GO:0048699", "GO:0120039", "GO:0120036", "GO:0048812", "GO:0061564", "GO:0007409" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0031974", "GO:0005654", "GO:0043229", "GO:0043233", "GO:0043227", "GO:0043231", "GO:0070013", "GO:0031981", "GO:0005634" ]
[ "IPR006536", "IPR055204", "IPR012677", "IPR021790", "IPR035979", "IPR000504" ]
af_db/AF-A0A0B4K852-F1-model_v4.cif.gz
null
null
null
A0A0B4KER3
Stac-like, isoform O
null
Drosophila melanogaster (Fruit fly)
1,156
Cell membrane, sarcolemma {ECO:0000256|ARBA:ARBA00004278}; Peripheral membrane protein {ECO:0000256|ARBA:ARBA00004278}; Cytoplasmic side {ECO:0000256|ARBA:ARBA00004278}. Cytoplasm {ECO:0000256|ARBA:ARBA00004496}.
MGISAHAAPASFWNHPRRIRRTPTSDRDGVDQCRPWICRRKDRRPAHPAANRPPESRVCGPSSTFRWDDWAAPAPRTRERATDCARMCMCTSRIPYSVARICARTTSMHSSRPASRSSSFIRRPLTRRQRMAVGGVTRRLWRTMRVYTIHQGRGVRRARAAQAVAAYLRDRRARIGKGWPAQGHGVRISATEQWADKPVVRRPGDPTRRVAAGAVPVLAERLPKVTGSSVKSSSGRRSRRRRIFGWRGPRGGSLSPQGGSMASYNGVLKDYSHSSLNEAFKSQNNVNFKLIKTVSDFSETLSRLYEEHATALQVAVSNYRKKNAELRKERPACHLAIFQAWETFLQEVETDSQACNDVASVLSRQVSRPMLDKSFHRKVQSRKIFTHRESFETIIAKTEEKLSKCRVDYKQCHLAHRQNPSQHSLTEYIDAHNAYVQQLHATNGMLEAYHTDTLPQQMQELEEIHNDLVAIVSDSLMQGAEVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQPSQAQKIPRRLFASPQAEVGEEAGDHNEMTPCLRNELVFDRHSTLSQRSALESLKREAIELELQIRQLQDSIEALNRTQTRGIEGQLYNKVNELQEDLSMKKFDLRAKQIHLAAIRAQKDLFVSKVEPTSPRNERKFSAATAPSMKTKWLKAFKSLKPAGSGSAQQADRRNGASSTASEPLRPNLDGSHHLQEYTYKKITACDVCSQILRGHTRQGLRCRICKLNAHGDCAPNLPRCQPKQKLLRRQKSTSELENRVDIEEETGADKSVQAKQMDGSVAGGSALPVPVLSERELGRAPPPDIPIVSVSELALQEQQQQQQQQQQQHQQQQRSLASVAQAAAVRAGRGVRPPPVAMPILGVQLQQQELQQQRGGLPVPSQDISSSSAPHSPRRQKLNLRMKSLSLDSPESSELHGQFRRRTQLPGTGASTSAGSGYYHGGSGGHLEHSTPPSNNSRLHWTNASKTITAPSSPSHPGRKLLYATRGMRGGSVDLPDEMEKSQSSASTSPCLSPKTHRLLPTNLYVIIYNFKARHADELDLKAGYKVTVIDNSDPDWWKGKVLGRVGYFPSKYCVRLNANEKPLQVTHNLQVSDSERGENLTLLRDQIVIQTGDEVNGMVMIRAAEHGQGYCPIKYLQEV
[ "GO:0032535", "GO:0090066", "GO:0016043", "GO:0065008", "GO:0071840", "GO:0008361", "GO:0009987", "GO:0065007", "GO:0008150", "GO:0045793" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0065008", "GO:0071840", "GO:0090066", "GO:0016043", "GO:0032535", "GO:0008361", "GO:0045793" ]
null
null
[ "IPR027267", "IPR046349", "IPR002219", "IPR036028", "IPR001452", "IPR039688" ]
af_db/AF-A0A0B4KER3-F1-model_v4.cif.gz
null
null
null
A0A060VTM4
Peptidoglycan recognition protein 6
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
491
null
MSGAQGVEDSMISPMEPHWKWCLTLLVVLVSAHTDTKVTSSQHMDDFIRVLEQVEYRNPGLQPVNACAGQLVSDEFMQHFLGTIREDSTSEAPVMDSNLSDFIGRAVRHQVTERGREEGVVLTADGTTVAMSPVLLGIEAGLVSKTRCQVRGLYPLTLARNLGLSFQRFHSSLLSHRLGPDGCWDDVTSPQVFTLSDKPSLATDALVNGGMDGVILGMEVSAQSQRPLKLSSLLRTYYCHHLEVEGLDTAPRLISRLRRENFRELARPPLLQRQVVRSLVLQRRLIDHSTMLSQEKEELTAVVREGIKEFVHKYMDCPAIIPRCQWGAAPYRGTPTPLSLPLSFMYIHHTYQPGQPCLTFQQCSADMRSMQRFHQDDRGWDDIGYSFVAGSDGYLYEGRGWHWQGAHTKGYNSKGYGVSFIGDYTSRLPSQQTMELVKDRLASCAVGGGRLVGNFTLYGHRQLVKTSCPGDALYSEITGWEHFGCVQYVQM
[ "GO:0031347", "GO:0009968", "GO:0065007", "GO:0010648", "GO:0050687", "GO:0023057", "GO:0002831", "GO:0031348", "GO:0048518", "GO:0050776", "GO:0008150", "GO:0045088", "GO:0039531", "GO:0010604", "GO:0050789", "GO:0019222", "GO:0010646", "GO:0002683", "GO:0010605", "GO:0080134", "GO:0050688", "GO:0050794", "GO:0009966", "GO:0048583", "GO:0009893", "GO:0070424", "GO:0060255", "GO:0039532", "GO:0002682", "GO:0023051", "GO:0001818", "GO:0032101", "GO:0051241", "GO:1900015", "GO:0062207", "GO:0010628", "GO:0051239", "GO:1902532", "GO:0001817", "GO:0002832", "GO:1900016", "GO:0070425", "GO:0048523", "GO:0048519", "GO:0048585", "GO:0010629", "GO:1902531", "GO:0010468", "GO:0009892", "GO:0032102", "GO:0110165", "GO:0005575", "GO:0005576", "GO:0005615" ]
[ "GO:0008150", "GO:0065007", "GO:0048518", "GO:0050789", "GO:0048519", "GO:0023057", "GO:0019222", "GO:0002683", "GO:0050794", "GO:0048583", "GO:0009893", "GO:0002682", "GO:0023051", "GO:0051241", "GO:0051239", "GO:0048523", "GO:0048585", "GO:0009892", "GO:0009968", "GO:0010648", "GO:0002831", "GO:0031348", "GO:0050776", "GO:0010604", "GO:0010646", "GO:0010605", "GO:0080134", "GO:0009966", "GO:0060255", "GO:0039532", "GO:0001818", "GO:0032101", "GO:0001817", "GO:0002832", "GO:0032102", "GO:0031347", "GO:0050687", "GO:0045088", "GO:0050688", "GO:1900015", "GO:0062207", "GO:0010628", "GO:1902532", "GO:1900016", "GO:0070425", "GO:0010629", "GO:1902531", "GO:0010468", "GO:0039531", "GO:0070424" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005576", "GO:0005615" ]
[ "IPR036505", "IPR002502", "IPR015510", "IPR006619" ]
af_db/AF-A0A060VTM4-F1-model_v4.cif.gz
8022.A0A060VTM4
[ "8022.A0A060YX49", "8022.A0A060VYI4", "8022.A0A060WC23", "8022.A0A060WCW2", "8022.A0A060YA80", "8022.A0A060XRN8", "8022.A0A060WHV6", "8022.A0A060W772", "8022.A0A060WNW5", "8022.A0A060WNJ5", "8022.A0A060XLV6", "8022.A0A060VSX6", "8022.A0A060YQG1", "8022.A0A060XBP3", "8022.A0A060WBY2", "8022.A0A060WGC6", "8022.A0A060WAQ6", "8022.A0A060W791" ]
[ { "protein2": "8022.A0A060YX49", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 164, "database": 760, "textmining": 86, "combined_score": 806 }, { "protein2": "8022.A0A060VYI4", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 0, "combined_score": 752 }, { "protein2": "8022.A0A060WC23", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 176, "combined_score": 841 }, { "protein2": "8022.A0A060WCW2", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 0, "combined_score": 752 }, { "protein2": "8022.A0A060YA80", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 176, "combined_score": 841 }, { "protein2": "8022.A0A060XRN8", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 0, "combined_score": 752 }, { "protein2": "8022.A0A060WHV6", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 61, "combined_score": 757 }, { "protein2": "8022.A0A060W772", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 164, "database": 760, "textmining": 86, "combined_score": 806 }, { "protein2": "8022.A0A060WNW5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 164, "database": 760, "textmining": 86, "combined_score": 806 }, { "protein2": "8022.A0A060WNJ5", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 61, "combined_score": 757 }, { "protein2": "8022.A0A060XLV6", "neighborhood": 0, "fusion": 0, "cooccurence": 142, "coexpression": 55, "experimental": 0, "database": 827, "textmining": 269, "combined_score": 883 }, { "protein2": "8022.A0A060VSX6", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 61, "combined_score": 757 }, { "protein2": "8022.A0A060YQG1", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 61, "combined_score": 757 }, { "protein2": "8022.A0A060XBP3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 164, "database": 760, "textmining": 86, "combined_score": 806 }, { "protein2": "8022.A0A060WBY2", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 0, "combined_score": 752 }, { "protein2": "8022.A0A060WGC6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 164, "database": 760, "textmining": 86, "combined_score": 806 }, { "protein2": "8022.A0A060WAQ6", "neighborhood": 0, "fusion": 0, "cooccurence": 69, "coexpression": 56, "experimental": 0, "database": 832, "textmining": 364, "combined_score": 893 }, { "protein2": "8022.A0A060W791", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 164, "database": 760, "textmining": 86, "combined_score": 806 } ]
A0A060X5E8
Phospholipid/glycerol acyltransferase domain-containing protein
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
398
Membrane {ECO:0000256|ARBA:ARBA00004370}.
MKLPNKQHHSSENEDGSDLPPPFRNPFVHELRFTPLEKIRIGVMTVTVFPVRLFFAVLLMLLAWPFAFAASLGRSELAVETETWWRRICDIALRGIMRAMWFCGGFHWVTVKGEPAPPSQAPILTLAPHSSYFDAIPVTMTMASIVMKTESKNIPVWGTLIKFIRPVFVSRSDQDSRKKTVEEIKRRAHAGGEWPQIMIFPEGTCTNRSCLITFKPGAFIPAVPVQPVVLRYPNRMDTITWTWQGPGAFEILWLTLCQFHNPIEIEYLPLYTPSEEEKNNPALFANNVRSIMAKALELPITDLSFDDCQLSLAKGPMRVPSNSSLLQFNRLARRLGLRAGTTDTVLEQQASKARKLWGYTLGLGDFAHYLDLPVTDMLTELHSLFNQWELWKHTYSVY
[ "GO:0008152", "GO:1901566", "GO:0006650", "GO:0006662", "GO:1901503", "GO:0009058", "GO:0008654", "GO:0044237", "GO:0008150", "GO:1901576", "GO:1901564", "GO:0046486", "GO:0006629", "GO:0006663", "GO:0044281", "GO:0046504", "GO:0006644", "GO:0097384", "GO:0008611", "GO:0046485", "GO:0019637", "GO:0006807", "GO:0090407", "GO:0044255", "GO:0044249", "GO:0009987", "GO:0006796", "GO:0046474", "GO:0018904", "GO:0071704", "GO:0046469", "GO:0008610", "GO:0045017", "GO:0044238", "GO:0006793", "GO:0042175", "GO:0005622", "GO:0031090", "GO:0043226", "GO:0005783", "GO:0005575", "GO:0016020", "GO:0043231", "GO:0005789", "GO:0031984", "GO:0043229", "GO:0110165", "GO:0071944", "GO:0005737", "GO:0043227", "GO:0012505", "GO:0005886", "GO:0098827", "GO:0016747", "GO:0016740", "GO:0003674", "GO:0016407", "GO:0016746", "GO:0003824", "GO:0047179" ]
[ "GO:0008150", "GO:0008152", "GO:0009987", "GO:0009058", "GO:0044237", "GO:0044281", "GO:0006807", "GO:0071704", "GO:0044238", "GO:1901576", "GO:1901564", "GO:0006629", "GO:0019637", "GO:0044255", "GO:0044249", "GO:0018904", "GO:0006793", "GO:1901566", "GO:0006662", "GO:1901503", "GO:0046486", "GO:0046504", "GO:0006644", "GO:0097384", "GO:0046485", "GO:0090407", "GO:0006796", "GO:0046469", "GO:0008610", "GO:0045017", "GO:0006650", "GO:0008654", "GO:0006663", "GO:0008611", "GO:0046474" ]
[ "GO:0003674", "GO:0003824", "GO:0016740", "GO:0016746", "GO:0016747", "GO:0016407", "GO:0047179" ]
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0016020", "GO:0031984", "GO:0071944", "GO:0005737", "GO:0012505", "GO:0042175", "GO:0031090", "GO:0005783", "GO:0043229", "GO:0043227", "GO:0005886", "GO:0098827", "GO:0043231", "GO:0005789" ]
[ "IPR045252", "IPR002123" ]
af_db/AF-A0A060X5E8-F1-model_v4.cif.gz
8022.A0A060X5E8
[ "8022.A0A060XZG5", "8022.A0A060WMA0", "8022.A0A060YP76", "8022.A0A060Y209", "8022.A0A060YNP0", "8022.A0A060WXJ9", "8022.A0A060XBF4", "8022.A0A060Z178", "8022.A0A060XJE3", "8022.A0A060Y525", "8022.A0A060ZEA0", "8022.A0A060WKI9", "8022.A0A060WAM9", "8022.A0A060Y3S3", "8022.A0A060YPN4", "8022.A0A060WAH0", "8022.A0A060VYJ7", "8022.A0A060VY33", "8022.A0A060WWB8", "8022.A0A060W780", "8022.A0A060ZF19", "8022.A0A060VWE7", "8022.A0A060VWG7", "8022.A0A060X8I3", "8022.A0A060X1Q1", "8022.A0A060W2M5", "8022.A0A060X8F2", "8022.A0A060W5A1", "8022.A0A060WGS1", "8022.A0A060Y022", "8022.A0A060YG60", "8022.A0A060YR49", "8022.A0A060XJF5", "8022.A0A060VML4", "8022.A0A060XCL6", "8022.A0A060Z8E6", "8022.A0A060YWG6", "8022.A0A060YPX7", "8022.A0A060Z769", "8022.A0A060WCZ0", "8022.A0A060X836", "8022.A0A060XI24", "8022.A0A060VYB1", "8022.A0A060X1J7", "8022.A0A060Y7U0", "8022.A0A060XN56", "8022.A0A060W3M6", "8022.A0A060YLF9", "8022.A0A060X659", "8022.A0A060VWY0", "8022.A0A060XQT7", "8022.A0A060YCR0", "8022.A0A060XZ81", "8022.A0A060ZCK2", "8022.A0A060XEP9", "8022.A0A060X5K2", "8022.A0A060WTF2", "8022.A0A060XR98", "8022.A0A060XEI7", "8022.A0A060YZH2", "8022.A0A060YKM8", "8022.A0A060XM30", "8022.A0A060Y4G9", "8022.A0A060WXB6", "8022.A0A060Z5I3", "8022.A0A060Y2K1", "8022.A0A060Y2H4", "8022.A0A060XFT6", "8022.A0A060W3V3", "8022.A0A060Y6G2", "8022.A0A060W8Z2", "8022.A0A060XKJ6", "8022.A0A060X4H7", "8022.A0A060Z370", "8022.A0A060VZH3", "8022.A0A060YQM4", "8022.A0A060WDA7", "8022.A0A060YAJ2", "8022.A0A060XLF8", "8022.A0A060X5H9", "8022.A0A060YK16", "8022.A0A060X754", "8022.A0A060W3X0", "8022.A0A060XN93", "8022.A0A060YCG4", "8022.A0A060X9R9", "8022.A0A060Y5Z4", "8022.A0A060XTV7", "8022.A0A060VXV4", "8022.A0A060XE36", "8022.A0A060WE92", "8022.A0A060Z2V6", "8022.A0A060WG53", "8022.A0A060Z3A6", "8022.A0A060Z1S9", "8022.A0A060ZFN7", "8022.A0A060XNK8", "8022.A0A060WK44", "8022.A0A060WAZ2", "8022.A0A060X101", "8022.A0A060Z9W8", "8022.A0A060WCJ4", "8022.A0A060W6W8", "8022.A0A060WDQ0", "8022.A0A060VU79", "8022.A0A060XI36", "8022.A0A060XT39" ]
[ { "protein2": "8022.A0A060XZG5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 135, "combined_score": 843 }, { "protein2": "8022.A0A060WMA0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 44, "combined_score": 825 }, { "protein2": "8022.A0A060YP76", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 752 }, { "protein2": "8022.A0A060Y209", "neighborhood": 0, "fusion": 0, "cooccurence": 80, "coexpression": 0, "experimental": 0, "database": 831, "textmining": 0, "combined_score": 838 }, { "protein2": "8022.A0A060YNP0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 357, "database": 602, "textmining": 235, "combined_score": 792 }, { "protein2": "8022.A0A060WXJ9", "neighborhood": 101, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 148, "combined_score": 846 }, { "protein2": "8022.A0A060XBF4", "neighborhood": 101, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 148, "combined_score": 846 }, { "protein2": "8022.A0A060Z178", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 44, "combined_score": 825 }, { "protein2": "8022.A0A060XJE3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 834, "textmining": 89, "combined_score": 842 }, { "protein2": "8022.A0A060Y525", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 748 }, { "protein2": "8022.A0A060ZEA0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 782, "textmining": 112, "combined_score": 798 }, { "protein2": "8022.A0A060WKI9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 834, "textmining": 89, "combined_score": 842 }, { "protein2": "8022.A0A060WAM9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 835 }, { "protein2": "8022.A0A060Y3S3", "neighborhood": 101, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 125, "combined_score": 856 }, { "protein2": "8022.A0A060YPN4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 43, "combined_score": 832 }, { "protein2": "8022.A0A060WAH0", "neighborhood": 0, "fusion": 0, "cooccurence": 96, "coexpression": 0, "experimental": 158, "database": 844, "textmining": 137, "combined_score": 883 }, { "protein2": "8022.A0A060VYJ7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 782, "textmining": 112, "combined_score": 798 }, { "protein2": "8022.A0A060VY33", "neighborhood": 42, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 212, "combined_score": 856 }, { "protein2": "8022.A0A060WWB8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 47, "combined_score": 828 }, { "protein2": "8022.A0A060W780", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 151, "combined_score": 861 }, { "protein2": "8022.A0A060ZF19", "neighborhood": 63, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 165, "database": 824, "textmining": 115, "combined_score": 864 }, { "protein2": "8022.A0A060VWE7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 835 }, { "protein2": "8022.A0A060VWG7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 357, "database": 602, "textmining": 235, "combined_score": 792 }, { "protein2": "8022.A0A060X8I3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 357, "database": 602, "textmining": 235, "combined_score": 792 }, { "protein2": "8022.A0A060X1Q1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 224, "combined_score": 864 }, { "protein2": "8022.A0A060W2M5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 118, "database": 654, "textmining": 143, "combined_score": 715 }, { "protein2": "8022.A0A060X8F2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 118, "database": 827, "textmining": 143, "combined_score": 857 }, { "protein2": "8022.A0A060W5A1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 839, "textmining": 151, "combined_score": 857 }, { "protein2": "8022.A0A060WGS1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 748 }, { "protein2": "8022.A0A060Y022", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 86, "combined_score": 833 }, { "protein2": "8022.A0A060YG60", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060YR49", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 115, "combined_score": 838 }, { "protein2": "8022.A0A060XJF5", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 157, "combined_score": 848 }, { "protein2": "8022.A0A060VML4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 164, "combined_score": 864 }, { "protein2": "8022.A0A060XCL6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 834, "textmining": 86, "combined_score": 841 }, { "protein2": "8022.A0A060Z8E6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 86, "combined_score": 833 }, { "protein2": "8022.A0A060YWG6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 135, "combined_score": 843 }, { "protein2": "8022.A0A060YPX7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060Z769", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060WCZ0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 276, "combined_score": 869 }, { "protein2": "8022.A0A060X836", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 167, "combined_score": 847 }, { "protein2": "8022.A0A060XI24", "neighborhood": 101, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 148, "combined_score": 846 }, { "protein2": "8022.A0A060VYB1", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060X1J7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 835 }, { "protein2": "8022.A0A060Y7U0", "neighborhood": 139, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 232, "database": 534, "textmining": 180, "combined_score": 717 }, { "protein2": "8022.A0A060XN56", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 779, "textmining": 86, "combined_score": 789 }, { "protein2": "8022.A0A060W3M6", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060YLF9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 44, "combined_score": 825 }, { "protein2": "8022.A0A060X659", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 357, "database": 602, "textmining": 235, "combined_score": 792 }, { "protein2": "8022.A0A060VWY0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 118, "database": 827, "textmining": 143, "combined_score": 857 }, { "protein2": "8022.A0A060XQT7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 834, "textmining": 86, "combined_score": 841 }, { "protein2": "8022.A0A060YCR0", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060XZ81", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 151, "combined_score": 861 }, { "protein2": "8022.A0A060ZCK2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 829, "textmining": 47, "combined_score": 830 }, { "protein2": "8022.A0A060XEP9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 167, "combined_score": 847 }, { "protein2": "8022.A0A060X5K2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 772, "textmining": 112, "combined_score": 789 }, { "protein2": "8022.A0A060WTF2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 44, "combined_score": 825 }, { "protein2": "8022.A0A060XR98", "neighborhood": 147, "fusion": 0, "cooccurence": 0, "coexpression": 127, "experimental": 100, "database": 534, "textmining": 211, "combined_score": 708 }, { "protein2": "8022.A0A060XEI7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 135, "combined_score": 843 }, { "protein2": "8022.A0A060YZH2", "neighborhood": 147, "fusion": 0, "cooccurence": 0, "coexpression": 127, "experimental": 100, "database": 832, "textmining": 211, "combined_score": 894 }, { "protein2": "8022.A0A060YKM8", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 831, "textmining": 0, "combined_score": 833 }, { "protein2": "8022.A0A060XM30", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060Y4G9", "neighborhood": 139, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 232, "database": 534, "textmining": 180, "combined_score": 717 }, { "protein2": "8022.A0A060WXB6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 81, "combined_score": 839 }, { "protein2": "8022.A0A060Z5I3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 115, "combined_score": 838 }, { "protein2": "8022.A0A060Y2K1", "neighborhood": 0, "fusion": 0, "cooccurence": 88, "coexpression": 0, "experimental": 0, "database": 831, "textmining": 0, "combined_score": 839 }, { "protein2": "8022.A0A060Y2H4", "neighborhood": 0, "fusion": 0, "cooccurence": 97, "coexpression": 0, "experimental": 158, "database": 827, "textmining": 137, "combined_score": 871 }, { "protein2": "8022.A0A060XFT6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 835 }, { "protein2": "8022.A0A060W3V3", "neighborhood": 42, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 212, "combined_score": 856 }, { "protein2": "8022.A0A060Y6G2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 128, "combined_score": 840 }, { "protein2": "8022.A0A060W8Z2", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 157, "combined_score": 854 }, { "protein2": "8022.A0A060XKJ6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 834, "textmining": 89, "combined_score": 842 }, { "protein2": "8022.A0A060X4H7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 782, "textmining": 112, "combined_score": 798 }, { "protein2": "8022.A0A060Z370", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 782, "textmining": 112, "combined_score": 798 }, { "protein2": "8022.A0A060VZH3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 839, "textmining": 151, "combined_score": 857 }, { "protein2": "8022.A0A060YQM4", "neighborhood": 154, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 649, "textmining": 205, "combined_score": 743 }, { "protein2": "8022.A0A060WDA7", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 157, "combined_score": 848 }, { "protein2": "8022.A0A060YAJ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 151, "combined_score": 861 }, { "protein2": "8022.A0A060XLF8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 323, "combined_score": 889 }, { "protein2": "8022.A0A060X5H9", "neighborhood": 101, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 148, "combined_score": 846 }, { "protein2": "8022.A0A060YK16", "neighborhood": 63, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 165, "database": 824, "textmining": 115, "combined_score": 864 }, { "protein2": "8022.A0A060X754", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 357, "database": 602, "textmining": 235, "combined_score": 792 }, { "protein2": "8022.A0A060W3X0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 118, "database": 654, "textmining": 143, "combined_score": 715 }, { "protein2": "8022.A0A060XN93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 86, "combined_score": 833 }, { "protein2": "8022.A0A060YCG4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 748 }, { "protein2": "8022.A0A060X9R9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 118, "database": 654, "textmining": 143, "combined_score": 715 }, { "protein2": "8022.A0A060Y5Z4", "neighborhood": 114, "fusion": 0, "cooccurence": 0, "coexpression": 98, "experimental": 0, "database": 592, "textmining": 230, "combined_score": 715 }, { "protein2": "8022.A0A060XTV7", "neighborhood": 42, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 212, "combined_score": 856 }, { "protein2": "8022.A0A060VXV4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060XE36", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 748 }, { "protein2": "8022.A0A060WE92", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 835 }, { "protein2": "8022.A0A060Z2V6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 44, "combined_score": 832 }, { "protein2": "8022.A0A060WG53", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 84, "database": 827, "textmining": 132, "combined_score": 852 }, { "protein2": "8022.A0A060Z3A6", "neighborhood": 0, "fusion": 0, "cooccurence": 80, "coexpression": 0, "experimental": 0, "database": 831, "textmining": 0, "combined_score": 838 }, { "protein2": "8022.A0A060Z1S9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 115, "combined_score": 838 }, { "protein2": "8022.A0A060ZFN7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 782, "textmining": 112, "combined_score": 798 }, { "protein2": "8022.A0A060XNK8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 135, "combined_score": 843 }, { "protein2": "8022.A0A060WK44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 835 }, { "protein2": "8022.A0A060WAZ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 276, "combined_score": 869 }, { "protein2": "8022.A0A060X101", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060Z9W8", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 84, "database": 827, "textmining": 132, "combined_score": 852 }, { "protein2": "8022.A0A060WCJ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 167, "combined_score": 864 }, { "protein2": "8022.A0A060W6W8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 834, "textmining": 89, "combined_score": 842 }, { "protein2": "8022.A0A060WDQ0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 44, "combined_score": 825 }, { "protein2": "8022.A0A060VU79", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 323, "combined_score": 889 }, { "protein2": "8022.A0A060XI36", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 357, "database": 602, "textmining": 235, "combined_score": 792 }, { "protein2": "8022.A0A060XT39", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 } ]
A0A060X747
Estrogen receptor (ER) (ER-alpha) (Estradiol receptor) (Nuclear receptor subfamily 3 group A member 1)
The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. {ECO:0000256|ARBA:ARBA00003830, ECO:0000256|PIRNR:PIRNR002527}.
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
577
Nucleus {ECO:0000256|ARBA:ARBA00004123, ECO:0000256|PIRNR:PIRNR002527}.
MYPEETRGGGGAAAFNYLDGGYDYTAPAQGPAPLYYSTTPQDAHGPPSDGSMQSLGSSPTGPLVFVSSSPQLSPQLSPFLHPPSHHGLPSQSYYLETSSTPLYRSSVVTNQLSASEEKLCIASDRQQSYSAAGSGVRVFEMANETRYCAVCSDFASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTMDRNRRKSCQACRLRKCYEVGMVKGGLRKDRGGRVLRKDKRYCGPAGDREKPYGDLEHRTAPPQDGGRNSSSSLNGGGGWRGPRITMPPEQVLFLLQGAEPPALCSRQKVARPYTEVTMMTLLTSMADKELVHMIAWAKKITCFQELSLHDQVQLLESSWLEVLMIGLIWRSIHCPGKLIFAQDLILDRSEGDCVEGMAEIFDMLLATVSRFRMLKLKPEEFVCLKAIILLNSGAFSFCSNSVESLHNSSAVESMLDNITDALIHHISHSGASVQQQPRRQAQLLLLLSHIRHMSNKGMEHLYSIKCKNKVPLYDLLLEMLDGHRLQSPGKVAQAGEQTEGPSTTTTTSTGSSIGPMRGSQDTHIRSPGSGVLQYGSPSSDQMPIP
[ "GO:0050896", "GO:0032355", "GO:0010033", "GO:0033993", "GO:1901700", "GO:0008150", "GO:0042221", "GO:0014070", "GO:0005622", "GO:0043229", "GO:0043226", "GO:0110165", "GO:0005575", "GO:0043227", "GO:0005634", "GO:0043231", "GO:1903924", "GO:0005488", "GO:0003707", "GO:0005496", "GO:0030284", "GO:0038023", "GO:0097159", "GO:0003674", "GO:0008289", "GO:0060089" ]
[ "GO:0008150", "GO:0050896", "GO:0042221", "GO:0010033", "GO:1901700", "GO:0032355", "GO:0033993", "GO:0014070" ]
[ "GO:0003674", "GO:0005488", "GO:0060089", "GO:0038023", "GO:0097159", "GO:0008289", "GO:0003707", "GO:0005496", "GO:1903924", "GO:0030284" ]
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0043229", "GO:0043227", "GO:0043231", "GO:0005634" ]
[ "IPR024178", "IPR001292", "IPR046944", "IPR035500", "IPR000536", "IPR050200", "IPR001723", "IPR001628", "IPR013088" ]
af_db/AF-A0A060X747-F1-model_v4.cif.gz
8022.A0A060X747
[ "8022.A0A060W3W8", "8022.A0A060Y5T0", "8022.A0A060WXG7", "8022.A0A060WML1", "8022.A0A060ZGP1", "8022.A0A060VW47", "8022.A0A060W6B9", "8022.A0A060X5T8", "8022.A0A060XYX3", "8022.A0A060XUQ5", "8022.A0A060YTG7", "8022.A0A060WIA9", "8022.A0A060YVU8", "8022.A0A060Z3T5", "8022.A0A060WTN3", "8022.A0A060YX93", "8022.A0A060W6V4", "8022.A0A060ZAN2", "8022.A0A060WAQ1", "8022.A0A060WHW4", "8022.A0A060YFT3", "8022.A0A060Z1V8", "8022.A0A060VND2", "8022.A0A060VN52", "8022.A0A060YEV1", "8022.A0A060YEN1", "8022.A0A060WLW5", "8022.A0A060VX03", "8022.A0A060YKE5", "8022.A0A060WN55", "8022.A0A060XAV4", "8022.A0A060Z793", "8022.A0A060WN95", "8022.A0A060VVC5", "8022.A0A060Y0V2", "8022.A0A060W5Y1", "8022.A0A060YGL1", "8022.A0A060YKW8", "8022.A0A060W2Y7", "8022.A0A060X907", "8022.A0A060X6A4", "8022.A0A060WGA5", "8022.A0A060WAQ4", "8022.A0A060XVJ2", "8022.A0A060WMH5", "8022.A0A060WQR5", "8022.A0A060XAL0", "8022.A0A060XXR4", "8022.A0A060WX37", "8022.A0A060Z011", "8022.A0A060WMW9", "8022.A0A060XCU4", "8022.A0A060YAV2", "8022.A0A060YRR8", "8022.A0A060Z4W6", "8022.A0A060W0K6", "8022.A0A060WHX7", "8022.A0A060X5R5", "8022.A0A060WA02", "8022.A0A060Y5J3", "8022.A0A060XY33", "8022.A0A060YPZ8", "8022.A0A060WF44", "8022.A0A060X6T5", "8022.A0A060X709", "8022.A0A060ZZ16", "8022.A0A060Z753", "8022.A0A060X566", "8022.A0A060XFW6", "8022.A0A060Y8P3", "8022.A0A060XMQ8", "8022.A0A060YL79", "8022.A0A060WEQ5", "8022.A0A060Y1N2", "8022.A0A060Y1F8", "8022.A0A060XIU8", "8022.A0A060XMF7", "8022.A0A060VZ13", "8022.A0A060YV52", "8022.A0A061AFB7", "8022.A0A060YLT6", "8022.A0A060XZP8", "8022.A0A060VNE1", "8022.A0A060W5D0", "8022.A0A060X0J1", "8022.A0A060VMS2", "8022.A0A060WHY1", "8022.A0A060Y668", "8022.A0A060VX88", "8022.C1BGM4", "8022.A0A060WB70", "8022.A0A060XCG6", "8022.A0A060WU05", "8022.A0A060XBD1", "8022.A0A060YGE2", "8022.A0A060XX32", "8022.A0A060YLU1", "8022.A0A060YGN3", "8022.A0A060VX39", "8022.A0A060YP66", "8022.A0A060XPW0", "8022.A0A060YHY9", "8022.A0A060VU47", "8022.A0A060YFL4", "8022.A0A060WAD1", "8022.A0A060Z1K4", "8022.A0A060YI40", "8022.A0A060Y3L0", "8022.A0A060Z9X0", "8022.A0A060WM29", "8022.A0A060VVS7", "8022.A0A060VTW5", "8022.A0A060X643", "8022.A0A060WI77", "8022.A0A060VX43", "8022.A0A060Z886", "8022.A0A060X3V7", "8022.A0A060WBV0", "8022.A0A060ZEG1", "8022.A0A060Y9W2", "8022.A0A060YBL3", "8022.A0A060W9K2", "8022.A0A060WF58", "8022.A0A060YHM7", "8022.A0A060WUS8", "8022.A0A060WPL6", "8022.A0A060ZG95", "8022.A0A060Z9P8", "8022.A0A060WIM0", "8022.A0A060YLL3", "8022.A0A060Y6Y8", "8022.A0A060XRX2", "8022.A0A060Y4X6", "8022.A0A060WSF1", "8022.A0A060YBG9", "8022.A0A060VQ10", "8022.A0A060X706", "8022.A0A060Y1G5", "8022.A0A060VV08", "8022.A0A060YDR5", "8022.A0A060YVS2", "8022.A0A060XC56", "8022.A0A060XF24", "8022.A0A060WJ27" ]
[ { "protein2": "8022.A0A060W3W8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 538, "database": 434, "textmining": 186, "combined_score": 768 }, { "protein2": "8022.A0A060Y5T0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 301, "database": 433, "textmining": 308, "combined_score": 701 }, { "protein2": "8022.A0A060WXG7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 331, "database": 654, "textmining": 199, "combined_score": 798 }, { "protein2": "8022.A0A060WML1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 386, "database": 510, "textmining": 86, "combined_score": 700 }, { "protein2": "8022.A0A060ZGP1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 670, "database": 462, "textmining": 207, "combined_score": 846 }, { "protein2": "8022.A0A060VW47", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 538, "database": 434, "textmining": 186, "combined_score": 768 }, { "protein2": "8022.A0A060W6B9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 120, "combined_score": 805 }, { "protein2": "8022.A0A060X5T8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 772, "database": 0, "textmining": 207, "combined_score": 811 }, { "protein2": "8022.A0A060XYX3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 207, "database": 599, "textmining": 163, "combined_score": 710 }, { "protein2": "8022.A0A060XUQ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 670, "database": 462, "textmining": 207, "combined_score": 846 }, { "protein2": "8022.A0A060YTG7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 361, "database": 824, "textmining": 366, "combined_score": 922 }, { "protein2": "8022.A0A060WIA9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 120, "combined_score": 805 }, { "protein2": "8022.A0A060YVU8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 501, "textmining": 157, "combined_score": 712 }, { "protein2": "8022.A0A060Z3T5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 568, "textmining": 230, "combined_score": 782 }, { "protein2": "8022.A0A060WTN3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 271, "textmining": 487, "combined_score": 739 }, { "protein2": "8022.A0A060YX93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 351, "database": 760, "textmining": 143, "combined_score": 854 }, { "protein2": "8022.A0A060W6V4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 321, "database": 760, "textmining": 108, "combined_score": 841 }, { "protein2": "8022.A0A060ZAN2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 321, "database": 760, "textmining": 108, "combined_score": 841 }, { "protein2": "8022.A0A060WAQ1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 386, "database": 510, "textmining": 86, "combined_score": 705 }, { "protein2": "8022.A0A060WHW4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 331, "database": 654, "textmining": 199, "combined_score": 798 }, { "protein2": "8022.A0A060YFT3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 766, "database": 829, "textmining": 510, "combined_score": 978 }, { "protein2": "8022.A0A060Z1V8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 370, "database": 547, "textmining": 141, "combined_score": 733 }, { "protein2": "8022.A0A060VND2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 568, "textmining": 230, "combined_score": 782 }, { "protein2": "8022.A0A060VN52", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 568, "textmining": 230, "combined_score": 782 }, { "protein2": "8022.A0A060YEV1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 436, "textmining": 223, "combined_score": 814 }, { "protein2": "8022.A0A060YEN1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 568, "textmining": 230, "combined_score": 782 }, { "protein2": "8022.A0A060WLW5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 752, "database": 0, "textmining": 369, "combined_score": 836 }, { "protein2": "8022.A0A060VX03", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 120, "combined_score": 805 }, { "protein2": "8022.A0A060YKE5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 568, "textmining": 339, "combined_score": 813 }, { "protein2": "8022.A0A060WN55", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 54, "experimental": 366, "database": 610, "textmining": 84, "combined_score": 757 }, { "protein2": "8022.A0A060XAV4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 43, "experimental": 573, "database": 275, "textmining": 113, "combined_score": 702 }, { "protein2": "8022.A0A060Z793", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 388, "database": 425, "textmining": 308, "combined_score": 735 }, { "protein2": "8022.A0A060WN95", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 752, "database": 0, "textmining": 369, "combined_score": 836 }, { "protein2": "8022.A0A060VVC5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 596, "database": 275, "textmining": 89, "combined_score": 709 }, { "protein2": "8022.A0A060Y0V2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 110, "combined_score": 747 }, { "protein2": "8022.A0A060W5Y1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 538, "database": 434, "textmining": 186, "combined_score": 768 }, { "protein2": "8022.A0A060YGL1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 301, "database": 433, "textmining": 308, "combined_score": 701 }, { "protein2": "8022.A0A060YKW8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 43, "experimental": 573, "database": 275, "textmining": 113, "combined_score": 702 }, { "protein2": "8022.A0A060W2Y7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 175, "database": 674, "textmining": 216, "combined_score": 770 }, { "protein2": "8022.A0A060X907", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 501, "textmining": 157, "combined_score": 712 }, { "protein2": "8022.A0A060X6A4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 216, "combined_score": 826 }, { "protein2": "8022.A0A060WGA5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 388, "database": 425, "textmining": 308, "combined_score": 735 }, { "protein2": "8022.A0A060WAQ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 386, "database": 510, "textmining": 86, "combined_score": 700 }, { "protein2": "8022.A0A060XVJ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 721, "textmining": 113, "combined_score": 741 }, { "protein2": "8022.A0A060WMH5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 351, "database": 436, "textmining": 247, "combined_score": 700 }, { "protein2": "8022.A0A060WQR5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 370, "database": 547, "textmining": 141, "combined_score": 733 }, { "protein2": "8022.A0A060XAL0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 110, "combined_score": 747 }, { "protein2": "8022.A0A060XXR4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 321, "database": 760, "textmining": 108, "combined_score": 841 }, { "protein2": "8022.A0A060WX37", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 110, "combined_score": 747 }, { "protein2": "8022.A0A060Z011", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 118, "experimental": 581, "database": 676, "textmining": 272, "combined_score": 901 }, { "protein2": "8022.A0A060WMW9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 680, "database": 599, "textmining": 358, "combined_score": 910 }, { "protein2": "8022.A0A060XCU4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 110, "combined_score": 747 }, { "protein2": "8022.A0A060YAV2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 596, "database": 275, "textmining": 89, "combined_score": 709 }, { "protein2": "8022.A0A060YRR8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 110, "combined_score": 747 }, { "protein2": "8022.A0A060Z4W6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 120, "combined_score": 805 }, { "protein2": "8022.A0A060W0K6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 230, "combined_score": 781 }, { "protein2": "8022.A0A060WHX7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 216, "combined_score": 826 }, { "protein2": "8022.A0A060X5R5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 824, "textmining": 308, "combined_score": 957 }, { "protein2": "8022.A0A060WA02", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 721, "textmining": 135, "combined_score": 748 }, { "protein2": "8022.A0A060Y5J3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 86, "combined_score": 795 }, { "protein2": "8022.A0A060XY33", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 139, "database": 690, "textmining": 88, "combined_score": 735 }, { "protein2": "8022.A0A060YPZ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 596, "database": 275, "textmining": 89, "combined_score": 709 }, { "protein2": "8022.A0A060WF44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 568, "textmining": 230, "combined_score": 782 }, { "protein2": "8022.A0A060X6T5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 824, "textmining": 308, "combined_score": 957 }, { "protein2": "8022.A0A060X709", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 331, "database": 654, "textmining": 199, "combined_score": 798 }, { "protein2": "8022.A0A060ZZ16", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 120, "combined_score": 805 }, { "protein2": "8022.A0A060Z753", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 118, "experimental": 581, "database": 676, "textmining": 272, "combined_score": 901 }, { "protein2": "8022.A0A060X566", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 110, "combined_score": 747 }, { "protein2": "8022.A0A060XFW6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 538, "database": 434, "textmining": 186, "combined_score": 768 }, { "protein2": "8022.A0A060Y8P3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 86, "combined_score": 795 }, { "protein2": "8022.A0A060XMQ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 54, "experimental": 366, "database": 610, "textmining": 84, "combined_score": 757 }, { "protein2": "8022.A0A060YL79", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 436, "textmining": 223, "combined_score": 814 }, { "protein2": "8022.A0A060WEQ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 568, "textmining": 230, "combined_score": 782 }, { "protein2": "8022.A0A060Y1N2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 361, "database": 824, "textmining": 366, "combined_score": 922 }, { "protein2": "8022.A0A060Y1F8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 721, "textmining": 135, "combined_score": 748 }, { "protein2": "8022.A0A060XIU8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 351, "database": 760, "textmining": 143, "combined_score": 854 }, { "protein2": "8022.A0A060XMF7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 670, "database": 462, "textmining": 207, "combined_score": 846 }, { "protein2": "8022.A0A060VZ13", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 423, "database": 824, "textmining": 369, "combined_score": 930 }, { "protein2": "8022.A0A060YV52", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 110, "combined_score": 747 }, { "protein2": "8022.A0A061AFB7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 230, "combined_score": 781 }, { "protein2": "8022.A0A060YLT6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 568, "textmining": 230, "combined_score": 782 }, { "protein2": "8022.A0A060XZP8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 670, "database": 462, "textmining": 207, "combined_score": 846 }, { "protein2": "8022.A0A060VNE1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 120, "combined_score": 805 }, { "protein2": "8022.A0A060W5D0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 201, "database": 599, "textmining": 233, "combined_score": 732 }, { "protein2": "8022.A0A060X0J1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 501, "textmining": 255, "combined_score": 746 }, { "protein2": "8022.A0A060VMS2", "neighborhood": 0, "fusion": 0, "cooccurence": 85, "coexpression": 71, "experimental": 0, "database": 676, "textmining": 112, "combined_score": 722 }, { "protein2": "8022.A0A060WHY1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 54, "experimental": 366, "database": 610, "textmining": 84, "combined_score": 757 }, { "protein2": "8022.A0A060Y668", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 388, "database": 425, "textmining": 308, "combined_score": 735 }, { "protein2": "8022.A0A060VX88", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 175, "database": 674, "textmining": 216, "combined_score": 770 }, { "protein2": "8022.C1BGM4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 156, "database": 690, "textmining": 0, "combined_score": 727 }, { "protein2": "8022.A0A060WB70", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 110, "combined_score": 747 }, { "protein2": "8022.A0A060XCG6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 321, "database": 760, "textmining": 108, "combined_score": 841 }, { "protein2": "8022.A0A060WU05", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 568, "textmining": 339, "combined_score": 813 }, { "protein2": "8022.A0A060XBD1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 230, "combined_score": 781 }, { "protein2": "8022.A0A060YGE2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 568, "textmining": 339, "combined_score": 813 }, { "protein2": "8022.A0A060XX32", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 538, "database": 434, "textmining": 186, "combined_score": 768 }, { "protein2": "8022.A0A060YLU1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 43, "experimental": 573, "database": 275, "textmining": 113, "combined_score": 702 }, { "protein2": "8022.A0A060YGN3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 120, "combined_score": 805 }, { "protein2": "8022.A0A060VX39", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 110, "combined_score": 747 }, { "protein2": "8022.A0A060YP66", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 271, "textmining": 487, "combined_score": 739 }, { "protein2": "8022.A0A060XPW0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 538, "database": 434, "textmining": 186, "combined_score": 768 }, { "protein2": "8022.A0A060YHY9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 596, "database": 275, "textmining": 89, "combined_score": 709 }, { "protein2": "8022.A0A060VU47", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 271, "textmining": 487, "combined_score": 739 }, { "protein2": "8022.A0A060YFL4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 436, "textmining": 223, "combined_score": 814 }, { "protein2": "8022.A0A060WAD1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 216, "combined_score": 826 }, { "protein2": "8022.A0A060Z1K4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 436, "textmining": 223, "combined_score": 814 }, { "protein2": "8022.A0A060YI40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 721, "textmining": 135, "combined_score": 748 }, { "protein2": "8022.A0A060Y3L0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 370, "database": 547, "textmining": 141, "combined_score": 733 }, { "protein2": "8022.A0A060Z9X0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 120, "combined_score": 805 }, { "protein2": "8022.A0A060WM29", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 568, "textmining": 230, "combined_score": 782 }, { "protein2": "8022.A0A060VVS7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 120, "combined_score": 805 }, { "protein2": "8022.A0A060VTW5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 120, "combined_score": 805 }, { "protein2": "8022.A0A060X643", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 670, "database": 462, "textmining": 207, "combined_score": 846 }, { "protein2": "8022.A0A060WI77", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 386, "database": 510, "textmining": 86, "combined_score": 700 }, { "protein2": "8022.A0A060VX43", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 230, "combined_score": 781 }, { "protein2": "8022.A0A060Z886", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 110, "combined_score": 747 }, { "protein2": "8022.A0A060X3V7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 230, "combined_score": 781 }, { "protein2": "8022.A0A060WBV0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 351, "database": 436, "textmining": 247, "combined_score": 700 }, { "protein2": "8022.A0A060ZEG1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 436, "textmining": 223, "combined_score": 814 }, { "protein2": "8022.A0A060Y9W2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 680, "database": 599, "textmining": 358, "combined_score": 910 }, { "protein2": "8022.A0A060YBL3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 670, "database": 462, "textmining": 207, "combined_score": 846 }, { "protein2": "8022.A0A060W9K2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 201, "database": 599, "textmining": 233, "combined_score": 732 }, { "protein2": "8022.A0A060WF58", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 568, "textmining": 339, "combined_score": 813 }, { "protein2": "8022.A0A060YHM7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 216, "combined_score": 826 }, { "protein2": "8022.A0A060WUS8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 351, "database": 760, "textmining": 143, "combined_score": 854 }, { "protein2": "8022.A0A060WPL6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 386, "database": 510, "textmining": 86, "combined_score": 700 }, { "protein2": "8022.A0A060ZG95", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 118, "experimental": 581, "database": 676, "textmining": 272, "combined_score": 901 }, { "protein2": "8022.A0A060Z9P8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 547, "textmining": 120, "combined_score": 805 }, { "protein2": "8022.A0A060WIM0", "neighborhood": 0, "fusion": 0, "cooccurence": 81, "coexpression": 58, "experimental": 0, "database": 676, "textmining": 87, "combined_score": 709 }, { "protein2": "8022.A0A060YLL3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 386, "database": 510, "textmining": 86, "combined_score": 705 }, { "protein2": "8022.A0A060Y6Y8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 670, "database": 462, "textmining": 207, "combined_score": 846 }, { "protein2": "8022.A0A060XRX2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 139, "database": 690, "textmining": 0, "combined_score": 721 }, { "protein2": "8022.A0A060Y4X6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 86, "combined_score": 795 }, { "protein2": "8022.A0A060WSF1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 331, "database": 654, "textmining": 199, "combined_score": 798 }, { "protein2": "8022.A0A060YBG9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 423, "database": 824, "textmining": 369, "combined_score": 930 }, { "protein2": "8022.A0A060VQ10", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 540, "textmining": 110, "combined_score": 747 }, { "protein2": "8022.A0A060X706", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 386, "database": 510, "textmining": 86, "combined_score": 700 }, { "protein2": "8022.A0A060Y1G5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 54, "experimental": 366, "database": 610, "textmining": 84, "combined_score": 757 }, { "protein2": "8022.A0A060VV08", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 721, "textmining": 113, "combined_score": 741 }, { "protein2": "8022.A0A060YDR5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 207, "database": 599, "textmining": 163, "combined_score": 710 }, { "protein2": "8022.A0A060YVS2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 501, "textmining": 157, "combined_score": 712 }, { "protein2": "8022.A0A060XC56", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 43, "experimental": 573, "database": 275, "textmining": 113, "combined_score": 702 }, { "protein2": "8022.A0A060XF24", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 351, "database": 760, "textmining": 135, "combined_score": 853 }, { "protein2": "8022.A0A060WJ27", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 386, "database": 510, "textmining": 86, "combined_score": 705 } ]
A0A060X9D7
Alpha-2B adrenergic receptor (Alpha-2B adrenoreceptor)
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
484
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
MASPLNSACSVGLGDTNGSTSGLSLPCNQSVSSLQLAPYSPESTALFATAITLMVVFTIVGNILVIIAVLTSHALRGPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFKSLWCEIYLALDVLFCTSSIVHLCAISLDRYLSISRVTYSRQRTPMRIKASIVVVWLISAIISFPPLLSLNKSEPGGEGSERGPQCQLNDERWYILYSTVGSFFAPCLIMILVYMRIYQIAKQRTQNPPGEPRKDGVGSMPHKTTSVRPPTLAVTPSPSPDQANETPSPHIPTTQNLLHAPVLSLAPTPTTTSPPTSPLDPSPSLKKYNNNMDSSNSSDSDMENEEGGRTGVNNPSMAGSAGIHSPATIQKYRDIIATSKGARLVAGRRSKPESTPGAARRKAMVNREKRFTFVLAVVIGVFVVCWFPFFFSYSLQAICPETCSLPDPLFKFFFWIGYCNSCLNPVIYTIFNQDFRKAFKKILCKNTKGTFF
[ "GO:0051716", "GO:0051602", "GO:0009628", "GO:0009987", "GO:0051952", "GO:0065007", "GO:0023052", "GO:1903530", "GO:0032811", "GO:0033604", "GO:0051046", "GO:0051049", "GO:0051051", "GO:0008150", "GO:0071875", "GO:0050896", "GO:0050789", "GO:0014060", "GO:0051953", "GO:0050433", "GO:0048523", "GO:0048519", "GO:0007186", "GO:0051048", "GO:0032879", "GO:1903531", "GO:0007154", "GO:0007165", "GO:0050794" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0023052", "GO:0050896", "GO:0050789", "GO:0048519", "GO:0051716", "GO:0009628", "GO:0051051", "GO:0048523", "GO:0032879", "GO:0007154", "GO:0007165", "GO:0050794", "GO:0051602", "GO:1903530", "GO:0051049", "GO:0051953", "GO:0007186", "GO:0051048", "GO:1903531", "GO:0051952", "GO:0033604", "GO:0051046", "GO:0071875", "GO:0050433", "GO:0032811", "GO:0014060" ]
null
null
[ "IPR002233", "IPR000276", "IPR017452" ]
af_db/AF-A0A060X9D7-F1-model_v4.cif.gz
8022.A0A060X9D7
[ "8022.A0A060WGC3", "8022.A0A060WHA4", "8022.A0A060Y8H5", "8022.A0A060Y2Z0", "8022.Q7SZV5", "8022.A0A060XSB8", "8022.A0A060YR57", "8022.A0A060XN60", "8022.A0A060Y1H7", "8022.A0A060Z6I0", "8022.C1BH40", "8022.A0A060Z6E2", "8022.A0A060Z1D1", "8022.A0A060XPS3", "8022.A0A060WEW9", "8022.A0A060WMN1", "8022.A0A060VPZ9", "8022.A0A060WL89", "8022.A0A060WVZ9", "8022.A0A060YP44", "8022.A0A060W8V2", "8022.A0A060XRQ9", "8022.A0A060X2G9", "8022.A0A060ZAK0", "8022.A0A060WXC1", "8022.A0A060XVD9", "8022.A0A060XC17" ]
[ { "protein2": "8022.A0A060WGC3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060WHA4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 155, "experimental": 267, "database": 571, "textmining": 86, "combined_score": 724 }, { "protein2": "8022.A0A060Y8H5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 608, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060Y2Z0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.Q7SZV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 387, "database": 568, "textmining": 86, "combined_score": 736 }, { "protein2": "8022.A0A060XSB8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060YR57", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060XN60", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 572, "textmining": 0, "combined_score": 709 }, { "protein2": "8022.A0A060Y1H7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060Z6I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 523, "textmining": 88, "combined_score": 716 }, { "protein2": "8022.C1BH40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 626, "database": 567, "textmining": 0, "combined_score": 833 }, { "protein2": "8022.A0A060Z6E2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060Z1D1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 626, "database": 567, "textmining": 0, "combined_score": 833 }, { "protein2": "8022.A0A060XPS3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060WEW9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060WMN1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060VPZ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 572, "textmining": 0, "combined_score": 709 }, { "protein2": "8022.A0A060WL89", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060WVZ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060YP44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 523, "textmining": 88, "combined_score": 716 }, { "protein2": "8022.A0A060W8V2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 608, "textmining": 0, "combined_score": 736 }, { "protein2": "8022.A0A060XRQ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060X2G9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060ZAK0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 89, "combined_score": 751 }, { "protein2": "8022.A0A060WXC1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060XVD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 291, "database": 783, "textmining": 0, "combined_score": 839 }, { "protein2": "8022.A0A060XC17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 571, "textmining": 0, "combined_score": 708 } ]
A0A060XC03
Beta-2 adrenergic receptor (Beta-2 adrenoreceptor)
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
401
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}. Early endosome {ECO:0000256|ARBA:ARBA00004412}. Golgi apparatus {ECO:0000256|ARBA:ARBA00004555}.
MESVSTPAVFNLSDLSVEMNSSSRQWSYSEYSEAVAVLLGILMALLVMCIVFGNVLVITAIVRFQRLQTVTNMFITSLACADLVMGLLVVPFGACYILLNTWHFGSFLCEFWTAADVLCVTASIETLCVIALDRYLAITSPLRYPSLLTKRKACVVVVTVWGVAALISFLPIHMKWWVSDEPEALSCLEDAHCCDFNTNAAYAVASSVVSFYIPLAVMAFVYGRVFQEARKQLEKIRGSEGRFHAQMIDNNQGQDGGNGKRPKFCLKEHKALKTLGIIMGTFTLCWLPFFVLNVVVTIWKVDNIKMPFRILNWIGYANSAFNPLIYCRSPEFRYAFQEILCLRGAAFPTNGYIYRGHSLRLSPKDKPGSLSNNVGTVELGSLSSVTNINGYCNNPPLASIV
[ "GO:0043434", "GO:1901652", "GO:0051952", "GO:0065007", "GO:1903530", "GO:0032811", "GO:0033604", "GO:0051049", "GO:0051051", "GO:0008150", "GO:0042221", "GO:0010243", "GO:0050896", "GO:1901698", "GO:0050789", "GO:0050433", "GO:0009719", "GO:0032879", "GO:0007186", "GO:0050794", "GO:0051716", "GO:0009987", "GO:0023052", "GO:1901700", "GO:0051046", "GO:0071875", "GO:0014060", "GO:0051953", "GO:0048523", "GO:0048519", "GO:0010033", "GO:0009725", "GO:0051048", "GO:0007154", "GO:1903531", "GO:0007165" ]
[ "GO:0008150", "GO:0065007", "GO:0050896", "GO:0050789", "GO:0009987", "GO:0023052", "GO:0048519", "GO:0051051", "GO:0042221", "GO:0009719", "GO:0032879", "GO:0050794", "GO:0051716", "GO:0048523", "GO:0007154", "GO:0007165", "GO:1903530", "GO:0051049", "GO:1901698", "GO:0007186", "GO:1901700", "GO:0051953", "GO:0010033", "GO:0009725", "GO:0051048", "GO:1903531", "GO:0043434", "GO:1901652", "GO:0051952", "GO:0033604", "GO:0010243", "GO:0050433", "GO:0051046", "GO:0071875", "GO:0032811", "GO:0014060" ]
null
null
[ "IPR002233", "IPR000332", "IPR000276", "IPR017452" ]
af_db/AF-A0A060XC03-F1-model_v4.cif.gz
8022.A0A060XC03
[ "8022.A0A060Z6G3", "8022.A0A060YHK9", "8022.A0A060WVI0", "8022.A0A060VX07", "8022.A0A060XFJ9", "8022.A0A060XJ06", "8022.A0A060YPP2", "8022.A0A060ZE50", "8022.A0A060XAN6", "8022.A0A060XB81", "8022.A0A060WLD6", "8022.A0A060XBN9", "8022.A0A060WSN3", "8022.A0A060Y3R9", "8022.A0A060XBV2", "8022.A0A060W476", "8022.A0A060ZAK0", "8022.A0A060YJ99", "8022.A0A060WHG5", "8022.A0A060XRA0", "8022.A0A060YC25", "8022.A0A061A7Q4", "8022.A0A060WRL9", "8022.A0A060YV89", "8022.A0A060W8T4", "8022.A0A060W6W6", "8022.A0A060X5U6", "8022.A0A060W0Q4", "8022.A0A060VXS0", "8022.A0A060XLX4", "8022.A0A060WF25", "8022.A0A060XVD9", "8022.A0A060XC17", "8022.A0A060WVH7", "8022.A0A060YK59", "8022.A0A060X2B4", "8022.A0A060WXK5", "8022.A0A060Y433", "8022.A0A060VWI9", "8022.A0A060WHT5", "8022.A0A060XIC8", "8022.A0A060XLH0", "8022.A0A060XH49", "8022.A0A060WCN9", "8022.A0A060YR93", "8022.A0A060XLR8", "8022.A0A060W808", "8022.B2KL82", "8022.A0A060WJ93", "8022.A0A060Z480", "8022.A0A060Z8T5", "8022.A0A060YP44", "8022.A0A060Y3C6", "8022.A0A060YAW4", "8022.A0A060ZG63", "8022.A0A060XUD4", "8022.A0A060WVD9", "8022.A0A060XCL5", "8022.A0A060XA34", "8022.A0A060YL43", "8022.A0A060ZEF4", "8022.A0A060VWA0", "8022.A0A060YEE1", "8022.A0A060Z6I0", "8022.C1BH40", "8022.A0A060Z1I0", "8022.A0A060WIZ5", "8022.A0A060Z6T3", "8022.A0A060VPW7", "8022.A0A060W0D6", "8022.A0A060XB37", "8022.A0A060Z1D1", "8022.A0A060WE78", "8022.A0A060VXM2", "8022.A0A060VZ80", "8022.A0A060XGM0", "8022.A0A060YWJ1", "8022.A0A060WSX0", "8022.A0A060XTK7", "8022.A0A060Z2C2", "8022.A0A060WDT4", "8022.A0A060YU11", "8022.A0A060WHA4", "8022.Q7T2I7", "8022.A0A060XJN8", "8022.A0A060Y8H5", "8022.A0A060XG51", "8022.A0A060W066", "8022.A0A060Y3I4", "8022.A0A060VW67", "8022.A0A060Y8R0", "8022.A0A060WP41", "8022.A0A060Z2S8", "8022.A0A060VY52", "8022.Q7SZV5", "8022.A0A060Z4B9", "8022.A0A060Y7L4", "8022.A0A060W081" ]
[ { "protein2": "8022.A0A060Z6G3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060YHK9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060WVI0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060VX07", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060XFJ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 63, "combined_score": 829 }, { "protein2": "8022.A0A060XJ06", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060YPP2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060ZE50", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060XAN6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 225, "database": 832, "textmining": 130, "combined_score": 876 }, { "protein2": "8022.A0A060XB81", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060WLD6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 46, "experimental": 0, "database": 825, "textmining": 62, "combined_score": 829 }, { "protein2": "8022.A0A060XBN9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 59, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 838 }, { "protein2": "8022.A0A060WSN3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 241, "database": 827, "textmining": 86, "combined_score": 869 }, { "protein2": "8022.A0A060Y3R9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 779, "textmining": 86, "combined_score": 789 }, { "protein2": "8022.A0A060XBV2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060W476", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060ZAK0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 832, "textmining": 89, "combined_score": 902 }, { "protein2": "8022.A0A060YJ99", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 829, "textmining": 62, "combined_score": 891 }, { "protein2": "8022.A0A060WHG5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060XRA0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060YC25", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A061A7Q4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060WRL9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 844, "textmining": 162, "combined_score": 961 }, { "protein2": "8022.A0A060YV89", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 241, "database": 827, "textmining": 86, "combined_score": 869 }, { "protein2": "8022.A0A060W8T4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060W6W6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 829, "textmining": 62, "combined_score": 891 }, { "protein2": "8022.A0A060X5U6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 46, "experimental": 0, "database": 825, "textmining": 62, "combined_score": 829 }, { "protein2": "8022.A0A060W0Q4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060VXS0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060XLX4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060WF25", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060XVD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 291, "database": 783, "textmining": 0, "combined_score": 839 }, { "protein2": "8022.A0A060XC17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 571, "textmining": 0, "combined_score": 708 }, { "protein2": "8022.A0A060WVH7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 825, "textmining": 62, "combined_score": 889 }, { "protein2": "8022.A0A060YK59", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060X2B4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060WXK5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060Y433", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060VWI9", "neighborhood": 0, "fusion": 0, "cooccurence": 83, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 89, "combined_score": 843 }, { "protein2": "8022.A0A060WHT5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060XIC8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060XLH0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060XH49", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 89, "combined_score": 835 }, { "protein2": "8022.A0A060WCN9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 110, "combined_score": 839 }, { "protein2": "8022.A0A060YR93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060XLR8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060W808", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.B2KL82", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 844, "textmining": 162, "combined_score": 961 }, { "protein2": "8022.A0A060WJ93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060Z480", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060Z8T5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060YP44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 827, "textmining": 89, "combined_score": 897 }, { "protein2": "8022.A0A060Y3C6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060YAW4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060ZG63", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060XUD4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060WVD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 829, "textmining": 62, "combined_score": 891 }, { "protein2": "8022.A0A060XCL5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 250, "database": 827, "textmining": 109, "combined_score": 874 }, { "protein2": "8022.A0A060XA34", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060YL43", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 825, "textmining": 62, "combined_score": 889 }, { "protein2": "8022.A0A060ZEF4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060VWA0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060YEE1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060Z6I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 827, "textmining": 89, "combined_score": 897 }, { "protein2": "8022.C1BH40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 751, "database": 523, "textmining": 0, "combined_score": 876 }, { "protein2": "8022.A0A060Z1I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060WIZ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060Z6T3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060VPW7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 250, "database": 827, "textmining": 109, "combined_score": 874 }, { "protein2": "8022.A0A060W0D6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 46, "experimental": 0, "database": 825, "textmining": 62, "combined_score": 829 }, { "protein2": "8022.A0A060XB37", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 167, "combined_score": 849 }, { "protein2": "8022.A0A060Z1D1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 751, "database": 523, "textmining": 0, "combined_score": 876 }, { "protein2": "8022.A0A060WE78", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060VXM2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 59, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 838 }, { "protein2": "8022.A0A060VZ80", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 825, "textmining": 62, "combined_score": 889 }, { "protein2": "8022.A0A060XGM0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 110, "combined_score": 839 }, { "protein2": "8022.A0A060YWJ1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 593, "textmining": 162, "combined_score": 898 }, { "protein2": "8022.A0A060WSX0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 829, "textmining": 62, "combined_score": 891 }, { "protein2": "8022.A0A060XTK7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060Z2C2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 844, "textmining": 162, "combined_score": 961 }, { "protein2": "8022.A0A060WDT4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060YU11", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060WHA4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 267, "database": 832, "textmining": 87, "combined_score": 881 }, { "protein2": "8022.Q7T2I7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 167, "combined_score": 849 }, { "protein2": "8022.A0A060XJN8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060Y8H5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 571, "textmining": 0, "combined_score": 708 }, { "protein2": "8022.A0A060XG51", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 748, "database": 419, "textmining": 86, "combined_score": 854 }, { "protein2": "8022.A0A060W066", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 779, "textmining": 86, "combined_score": 789 }, { "protein2": "8022.A0A060Y3I4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060VW67", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 81, "combined_score": 832 }, { "protein2": "8022.A0A060Y8R0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060WP41", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060Z2S8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060VY52", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.Q7SZV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 387, "database": 831, "textmining": 124, "combined_score": 901 }, { "protein2": "8022.A0A060Z4B9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060Y7L4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060W081", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 } ]
A0A060XV00
Alpha-2B adrenergic receptor (Alpha-2B adrenoreceptor)
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
489
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
MASPLDSACSVELGNTNSSTSGSSLPCNQSVSSLQLAPYSPEATALFATAITLMIVFTIVGNIFVIIAVLTSRALRGPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFKSLWCEIYLALDVLFCTSSIAHLCAISLDRYLSISRVTYSRQRTPMRIKASIVVVWLISAIISFPPLLSLNKSEPGGEGSERGPQCQLNDERWYILYSTVGSFFAPCLIMILVYMRIYQIAKQRTQNPPGEPRKDGVGSIPHKTSSIRPPTLAITPSLSPDQANETPPSSPTPNNLLHPPDPSLAPTPTTTSPPTSPMGPSHSSAKPKDGEKKGKKGKKGKNSDSDMEHEGGGRRGVNTPSMAGSPGIHSPATIQKYRDMIATSKGARLVAGRRSKPDTTPGAARRKAMVNREKRFTFVLAVVIGVFVVCWFPFFFSYSLQAICPETCALPDPLFKFFFWIGYCNSCLNPVIYTIFNQDFRKAFKKILCKNTKGTFF
[ "GO:0051716", "GO:0051602", "GO:0009628", "GO:0009987", "GO:0051952", "GO:0065007", "GO:0023052", "GO:1903530", "GO:0032811", "GO:0033604", "GO:0051046", "GO:0051049", "GO:0051051", "GO:0008150", "GO:0071875", "GO:0050896", "GO:0050789", "GO:0014060", "GO:0051953", "GO:0050433", "GO:0048523", "GO:0048519", "GO:0007186", "GO:0051048", "GO:0032879", "GO:1903531", "GO:0007154", "GO:0007165", "GO:0050794" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0023052", "GO:0050896", "GO:0050789", "GO:0048519", "GO:0051716", "GO:0009628", "GO:0051051", "GO:0048523", "GO:0032879", "GO:0007154", "GO:0007165", "GO:0050794", "GO:0051602", "GO:1903530", "GO:0051049", "GO:0051953", "GO:0007186", "GO:0051048", "GO:1903531", "GO:0051952", "GO:0033604", "GO:0051046", "GO:0071875", "GO:0050433", "GO:0032811", "GO:0014060" ]
null
null
[ "IPR002233", "IPR000276", "IPR017452" ]
af_db/AF-A0A060XV00-F1-model_v4.cif.gz
8022.A0A060XV00
[ "8022.A0A060XSB8", "8022.A0A060YR57", "8022.Q7SZV5", "8022.A0A060Y2Z0", "8022.A0A060Y8H5", "8022.A0A060WHA4", "8022.A0A060WGC3", "8022.A0A060WMN1", "8022.A0A060XPS3", "8022.A0A060WEW9", "8022.A0A060Z1D1", "8022.A0A060Z6E2", "8022.A0A060Y1H7", "8022.C1BH40", "8022.A0A060Z6I0", "8022.A0A060XN60", "8022.A0A060YP44", "8022.A0A060WVZ9", "8022.A0A060VPZ9", "8022.A0A060WL89", "8022.A0A060XC17", "8022.A0A060XVD9", "8022.A0A060WXC1", "8022.A0A060ZAK0", "8022.A0A060X2G9", "8022.A0A060XRQ9", "8022.A0A060W8V2" ]
[ { "protein2": "8022.A0A060XSB8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060YR57", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.Q7SZV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 387, "database": 568, "textmining": 86, "combined_score": 736 }, { "protein2": "8022.A0A060Y2Z0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060Y8H5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 608, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060WHA4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 155, "experimental": 267, "database": 571, "textmining": 86, "combined_score": 724 }, { "protein2": "8022.A0A060WGC3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060WMN1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060XPS3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060WEW9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060Z1D1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 626, "database": 567, "textmining": 0, "combined_score": 833 }, { "protein2": "8022.A0A060Z6E2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060Y1H7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.C1BH40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 626, "database": 567, "textmining": 0, "combined_score": 833 }, { "protein2": "8022.A0A060Z6I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 523, "textmining": 88, "combined_score": 716 }, { "protein2": "8022.A0A060XN60", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 572, "textmining": 0, "combined_score": 709 }, { "protein2": "8022.A0A060YP44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 523, "textmining": 88, "combined_score": 716 }, { "protein2": "8022.A0A060WVZ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060VPZ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 572, "textmining": 0, "combined_score": 709 }, { "protein2": "8022.A0A060WL89", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060XC17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 571, "textmining": 0, "combined_score": 708 }, { "protein2": "8022.A0A060XVD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 291, "database": 783, "textmining": 0, "combined_score": 839 }, { "protein2": "8022.A0A060WXC1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060ZAK0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 89, "combined_score": 751 }, { "protein2": "8022.A0A060X2G9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060XRQ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060W8V2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 608, "textmining": 0, "combined_score": 736 } ]
A0A060Y1K9
Peptidoglycan recognition protein 6
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
478
null
MEPHWKWCLTLLVILVSAHTDTKVTSSQHMDDFIRVLEQVEDSNPGLEPVNVLRGLRRAAGLRDEFMQHFLGTIREDSTSEAPVMDSNLSDFIVRAMRHKVTERGREEGVVLTADGTTVAMSPVLLGIEAGLVSKTRCRVRGLYPLTLARNLGLSFQRFHSSLLSQRLGPDGCWDDVTSPQVFTLSDKPSLATDALVNGGMDGVILGIEVSAQSQRPLKLSSLLRRYYCHRLEGEGLDAAPRLISHLRRENFRELARPPLLQRQVVRSLVLQRRLIDHSTMLSQEKEELTAVVREGIKEFVHRYMDCPAIIPRCQWGAAPYRGTPTPLSLPLSFMYIHHTYQPGQPCLTFQQCSADMRSMQRFHQDDRGWDDIGYSFVAGSDGYLYEGRGWHWQGAHTKGYNSKGYGVSFIGDYTSSLPSEQTMELVRDRLASCAVGGGRLVGNFTLYGHRQLVKTSCPGDAFYSEITGWEHFGEVQN
[ "GO:0031347", "GO:0009968", "GO:0065007", "GO:0010648", "GO:0050687", "GO:0023057", "GO:0002831", "GO:0031348", "GO:0048518", "GO:0050776", "GO:0008150", "GO:0045088", "GO:0039531", "GO:0010604", "GO:0050789", "GO:0019222", "GO:0010646", "GO:0002683", "GO:0010605", "GO:0080134", "GO:0050688", "GO:0050794", "GO:0009966", "GO:0048583", "GO:0009893", "GO:0070424", "GO:0060255", "GO:0039532", "GO:0002682", "GO:0023051", "GO:0001818", "GO:0032101", "GO:0051241", "GO:1900015", "GO:0062207", "GO:0010628", "GO:0051239", "GO:1902532", "GO:0001817", "GO:0002832", "GO:1900016", "GO:0070425", "GO:0048523", "GO:0048519", "GO:0048585", "GO:0010629", "GO:1902531", "GO:0010468", "GO:0009892", "GO:0032102", "GO:0110165", "GO:0005575", "GO:0005576", "GO:0005615" ]
[ "GO:0008150", "GO:0065007", "GO:0048518", "GO:0050789", "GO:0048519", "GO:0023057", "GO:0019222", "GO:0002683", "GO:0050794", "GO:0048583", "GO:0009893", "GO:0002682", "GO:0023051", "GO:0051241", "GO:0051239", "GO:0048523", "GO:0048585", "GO:0009892", "GO:0009968", "GO:0010648", "GO:0002831", "GO:0031348", "GO:0050776", "GO:0010604", "GO:0010646", "GO:0010605", "GO:0080134", "GO:0009966", "GO:0060255", "GO:0039532", "GO:0001818", "GO:0032101", "GO:0001817", "GO:0002832", "GO:0032102", "GO:0031347", "GO:0050687", "GO:0045088", "GO:0050688", "GO:1900015", "GO:0062207", "GO:0010628", "GO:1902532", "GO:1900016", "GO:0070425", "GO:0010629", "GO:1902531", "GO:0010468", "GO:0039531", "GO:0070424" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005576", "GO:0005615" ]
[ "IPR036505", "IPR002502", "IPR015510", "IPR006619" ]
af_db/AF-A0A060Y1K9-F1-model_v4.cif.gz
8022.A0A060Y1K9
[ "8022.A0A060W772", "8022.A0A060WNW5", "8022.A0A060WNJ5", "8022.A0A060VSX6", "8022.A0A060XLV6", "8022.A0A060YQG1", "8022.A0A060XBP3", "8022.A0A060WBY2", "8022.A0A060WAQ6", "8022.A0A060WGC6", "8022.A0A060W791", "8022.A0A060YX49", "8022.A0A060VYI4", "8022.A0A060WC23", "8022.A0A060WCW2", "8022.A0A060YA80", "8022.A0A060XRN8", "8022.A0A060WHV6" ]
[ { "protein2": "8022.A0A060W772", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 164, "database": 760, "textmining": 86, "combined_score": 806 }, { "protein2": "8022.A0A060WNW5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 164, "database": 760, "textmining": 86, "combined_score": 806 }, { "protein2": "8022.A0A060WNJ5", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 61, "combined_score": 757 }, { "protein2": "8022.A0A060VSX6", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 61, "combined_score": 757 }, { "protein2": "8022.A0A060XLV6", "neighborhood": 0, "fusion": 0, "cooccurence": 144, "coexpression": 55, "experimental": 0, "database": 827, "textmining": 269, "combined_score": 884 }, { "protein2": "8022.A0A060YQG1", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 61, "combined_score": 757 }, { "protein2": "8022.A0A060XBP3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 164, "database": 760, "textmining": 86, "combined_score": 806 }, { "protein2": "8022.A0A060WBY2", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 0, "combined_score": 752 }, { "protein2": "8022.A0A060WAQ6", "neighborhood": 0, "fusion": 0, "cooccurence": 65, "coexpression": 56, "experimental": 0, "database": 832, "textmining": 364, "combined_score": 893 }, { "protein2": "8022.A0A060WGC6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 164, "database": 760, "textmining": 86, "combined_score": 806 }, { "protein2": "8022.A0A060W791", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 164, "database": 760, "textmining": 86, "combined_score": 806 }, { "protein2": "8022.A0A060YX49", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 164, "database": 760, "textmining": 86, "combined_score": 806 }, { "protein2": "8022.A0A060VYI4", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 0, "combined_score": 752 }, { "protein2": "8022.A0A060WC23", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 176, "combined_score": 841 }, { "protein2": "8022.A0A060WCW2", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 0, "combined_score": 752 }, { "protein2": "8022.A0A060YA80", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 176, "combined_score": 841 }, { "protein2": "8022.A0A060XRN8", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 0, "combined_score": 752 }, { "protein2": "8022.A0A060WHV6", "neighborhood": 102, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 61, "combined_score": 757 } ]
A0A060Y3B2
RNA helicase (EC 3.6.4.13)
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
678
Cytoplasm {ECO:0000256|ARBA:ARBA00004496}.
MADFGLYEYQEEVVQRALRGENIIIWLPTGGGKTRAAVYVAKKHLENNPGAKVAVLVNKVHLVDQHYNNEFNPYLGSDYSLVSISGDCDQKDFFGCEVKNSDLVICTAQILENALTNQEEGKHVELSQFTLLIIDECHHTHKEGVYNKIMARYVAQKLKGERRLPQILGLTASPGTGGAKSIKGAVEHVLQICANLDSVIVSSKVYAPELKKKVPRPRKRFDIVDRRPQDPFGDHLKFMMQFIHDFMALGPEFPVREFGTQEYEADVVILEKKGVTDRNRLLAQCALHLRQYNDALLINDTVRMVDAFRVLESYYSTKSSTAMDGTDFFLLGLYQENEVELRKLSGDARFENPKMGKLQNTLLEQFVQGGHSRGILFSKTRKSICCLYDWVSNNPALQRAGIRAAILTGAGNGINYMTQNEQKDTIRNFRLGSLNLLISTSVAEEGLDIPECNLVVRYGLLTNEIAQQQASGRARASDSVYSVVAQAGGREVRRELLNECLEDLTGRAIGEVQRMEPRDFQMKITDLQTEALLTRQLAEQLKLKKRSRFNAATVQLSCRGCFLPVALGHDIKVIENAHHVNINPDFERYYKTGGQPALKTFEDWEPGRVISCAACGRQWGMEMIYKNIALLPILAIENFAMETPEGRKLAKKWKNVEFTVEEFNFSTYCHNKFPNMLD
[ "GO:0006952", "GO:0009605", "GO:0043331", "GO:0002376", "GO:0006950", "GO:0008150", "GO:0042221", "GO:0014070", "GO:0043207", "GO:0043330", "GO:0050896", "GO:1901698", "GO:0010033", "GO:0051707", "GO:0045087", "GO:0006955", "GO:0009607", "GO:0098542", "GO:1902615", "GO:0044419", "GO:0005737", "GO:0005575", "GO:0005622", "GO:0110165", "GO:0048471", "GO:0003676", "GO:0097159", "GO:1901363", "GO:0005488", "GO:0003674", "GO:0003723", "GO:0003725" ]
[ "GO:0008150", "GO:0002376", "GO:0050896", "GO:0044419", "GO:0009605", "GO:0006950", "GO:0042221", "GO:0051707", "GO:0006955", "GO:0009607", "GO:0006952", "GO:0043207", "GO:1901698", "GO:0010033", "GO:0045087", "GO:0098542", "GO:1902615", "GO:0043331", "GO:0014070", "GO:0043330" ]
[ "GO:0003674", "GO:0005488", "GO:0097159", "GO:1901363", "GO:0003676", "GO:0003723", "GO:0003725" ]
[ "GO:0005575", "GO:0110165", "GO:0005737", "GO:0005622", "GO:0048471" ]
[ "IPR006935", "IPR014001", "IPR001650", "IPR027417", "IPR041204", "IPR038557", "IPR021673", "IPR051363" ]
af_db/AF-A0A060Y3B2-F1-model_v4.cif.gz
8022.A0A060Y3B2
[ "8022.A0A060WKG7", "8022.A0A060YP86", "8022.A0A060Y891", "8022.A0A060XMA3", "8022.A0A060X8M8", "8022.A0A060XJI1", "8022.A0A060XJ85", "8022.A0A060YZ26", "8022.A0A060YJZ6", "8022.A0A060XZL1", "8022.A0A060YNY0", "8022.A0A060YGR3", "8022.A0A060YZ88", "8022.A0A060XLY4", "8022.A0A060XL84", "8022.A0A060WQG6", "8022.A0A060WEB4", "8022.A0A060YK39", "8022.A0A060XY19", "8022.A0A060WH56", "8022.A0A060WW34", "8022.A0A060YC09", "8022.A0A060ZBM2", "8022.A0A060YLC4", "8022.A0A060WAB8", "8022.A0A060W266", "8022.A0A060Z1S1", "8022.A0A060XWW5", "8022.A0A060WP82", "8022.A0A060VWJ9", "8022.A0A060YRP9", "8022.A0A060WKE3", "8022.A0A060WZ23", "8022.A0A060WAI5", "8022.A0A060XUZ1", "8022.A0A060VRW6", "8022.A0A060Z5H7", "8022.A0A060XTY3", "8022.C1BFG2", "8022.A0A060ZHX0", "8022.A0A060XK45", "8022.A0A060XRR2", "8022.A0A060Z6F4", "8022.A0A060WD36", "8022.A0A060YNG8", "8022.A0A060WT92", "8022.A0A060Z655", "8022.A0A060XI12", "8022.A0A060Z4W8", "8022.A0A060X6S5", "8022.A0A060Y1N8", "8022.A0A060W5A5", "8022.A0A060WA73", "8022.A0A060WAL5", "8022.C1BG62", "8022.A0A060WKE6", "8022.A0A060W7K8", "8022.A0A060XDQ4", "8022.A0A060WS77", "8022.A0A060YEJ5", "8022.A0A060X2B7", "8022.A0A060WK21", "8022.A0A060WZW0", "8022.A0A060Y4K2", "8022.A0A060VPV4", "8022.A0A060Y6S6", "8022.A0A060WGE5", "8022.A0A060YX92", "8022.A0A060WVN0", "8022.A0A060XER0", "8022.A0A060Y135", "8022.A0A060WP39", "8022.A0A060XDM2", "8022.A0A060Z000", "8022.A0A060X1X7", "8022.A0A061AEY4", "8022.A0A060X5I3", "8022.A0A060YMR9", "8022.A0A060XW94", "8022.A0A060W6R9", "8022.A0A060Y5Y0", "8022.A0A060XTX7", "8022.A0A060YGN0", "8022.A0A060W8A7", "8022.A0A060X3S8", "8022.A0A060WG92", "8022.A0A060XXI9", "8022.A0A060Z173", "8022.A0A060Z0R5", "8022.A0A060XV19", "8022.A0A060W7E9", "8022.A0A060WAH7", "8022.A0A060X4P6", "8022.A0A060X656", "8022.A0A060W9X0", "8022.A0A060W9W8", "8022.A0A060WW06", "8022.A0A060ZDZ5", "8022.A0A060X2M8", "8022.A0A060XVQ5", "8022.A0A060ZEW9", "8022.A0A060XYH4", "8022.A0A060WHG0", "8022.A0A060XZH1", "8022.A0A060XVP1", "8022.A0A060XU58", "8022.A0A060Z320", "8022.A0A060ZXZ7", "8022.A0A060YFT4", "8022.A0A060YQV1", "8022.A0A060Y9V2", "8022.A0A060XX03", "8022.A0A060Y1E2", "8022.C1BI16", "8022.A0A060Y7H3", "8022.A0A060XNR8", "8022.A0A060XGN6", "8022.A0A060XXJ1", "8022.A0A060WAD4", "8022.A0A060X729", "8022.A0A060XBU0", "8022.A0A060YIJ3", "8022.A0A060WKD2", "8022.A0A060X0A0", "8022.A0A060Z6E8", "8022.A0A060YDW3", "8022.A0A060XYU5", "8022.A0A060XB77", "8022.A0A060W716", "8022.A0A060YE39", "8022.A0A060X0Z8", "8022.A0A060YW05", "8022.A0A060XUU8", "8022.A0A060XSK5", "8022.A0A060VU69", "8022.A0A060WRH2", "8022.A0A060YW55", "8022.A0A060WFX5", "8022.A0A060ZAM3", "8022.A0A060Y0H6", "8022.A0A060WE07", "8022.A0A060XPT1", "8022.A0A060XNV6", "8022.A0A060YST3", "8022.A0A060YQF1", "8022.A0A060XFH7", "8022.A0A060YHX9", "8022.A0A060WGY3", "8022.A0A060YI26", "8022.A0A060WM17", "8022.A0A060Z3S0", "8022.A0A060W5V1", "8022.A0A060VZM9", "8022.A0A060ZEB5", "8022.A0A060WF04", "8022.A0A060YT06", "8022.A0A060YHA2", "8022.C1BHI8", "8022.A0A060WAH4", "8022.A0A060XC88", "8022.A0A060WLM0", "8022.Q9PT09", "8022.A0A060YCF8", "8022.A0A060XWU6", "8022.A0A060WMT5", "8022.A0A060XTB8", "8022.A0A060VZX4", "8022.A0A060YR45", "8022.A0A060W1U5", "8022.A0A060XPN1", "8022.A0A060Y4Q1", "8022.A0A060Z819", "8022.A0A060YNT6", "8022.A0A060XCS7", "8022.A0A060WJD4", "8022.A0A060Z3Y6", "8022.A0A060ZQU3", "8022.A0A060WZ94", "8022.A0A060X8S8", "8022.A0A060WC46", "8022.A0A060XX02" ]
[ { "protein2": "8022.A0A060WKG7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 673, "database": 754, "textmining": 52, "combined_score": 917 }, { "protein2": "8022.A0A060YP86", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060Y891", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 180, "database": 772, "textmining": 218, "combined_score": 841 }, { "protein2": "8022.A0A060XMA3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060X8M8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 48, "experimental": 346, "database": 433, "textmining": 400, "combined_score": 759 }, { "protein2": "8022.A0A060XJI1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 675, "database": 785, "textmining": 230, "combined_score": 941 }, { "protein2": "8022.A0A060XJ85", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 690, "database": 547, "textmining": 238, "combined_score": 895 }, { "protein2": "8022.A0A060YZ26", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 86, "combined_score": 741 }, { "protein2": "8022.A0A060YJZ6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 758 }, { "protein2": "8022.A0A060XZL1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 180, "database": 772, "textmining": 218, "combined_score": 841 }, { "protein2": "8022.A0A060YNY0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060YGR3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 0, "textmining": 373, "combined_score": 706 }, { "protein2": "8022.A0A060YZ88", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060XLY4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 812, "database": 829, "textmining": 337, "combined_score": 976 }, { "protein2": "8022.A0A060XL84", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 673, "database": 754, "textmining": 52, "combined_score": 917 }, { "protein2": "8022.A0A060WQG6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 758 }, { "protein2": "8022.A0A060WEB4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 669, "database": 774, "textmining": 388, "combined_score": 950 }, { "protein2": "8022.A0A060YK39", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 616, "database": 721, "textmining": 208, "combined_score": 907 }, { "protein2": "8022.A0A060XY19", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 669, "database": 774, "textmining": 388, "combined_score": 950 }, { "protein2": "8022.A0A060WH56", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 747, "database": 824, "textmining": 420, "combined_score": 971 }, { "protein2": "8022.A0A060WW34", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 }, { "protein2": "8022.A0A060YC09", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 148, "experimental": 184, "database": 583, "textmining": 110, "combined_score": 707 }, { "protein2": "8022.A0A060ZBM2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 178, "database": 785, "textmining": 387, "combined_score": 884 }, { "protein2": "8022.A0A060YLC4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 450, "combined_score": 937 }, { "protein2": "8022.A0A060WAB8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 180, "database": 772, "textmining": 218, "combined_score": 841 }, { "protein2": "8022.A0A060W266", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 219, "database": 593, "textmining": 330, "combined_score": 768 }, { "protein2": "8022.A0A060Z1S1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 188, "database": 816, "textmining": 276, "combined_score": 882 }, { "protein2": "8022.A0A060XWW5", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 }, { "protein2": "8022.A0A060WP82", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060VWJ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 86, "combined_score": 741 }, { "protein2": "8022.A0A060YRP9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 690, "database": 547, "textmining": 238, "combined_score": 895 }, { "protein2": "8022.A0A060WKE3", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 679, "database": 0, "textmining": 279, "combined_score": 763 }, { "protein2": "8022.A0A060WZ23", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 775, "database": 489, "textmining": 90, "combined_score": 887 }, { "protein2": "8022.A0A060WAI5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 207, "database": 736, "textmining": 121, "combined_score": 799 }, { "protein2": "8022.A0A060XUZ1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 299, "database": 824, "textmining": 0, "combined_score": 871 }, { "protein2": "8022.A0A060VRW6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 219, "database": 593, "textmining": 330, "combined_score": 768 }, { "protein2": "8022.A0A060Z5H7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 683, "database": 0, "textmining": 309, "combined_score": 771 }, { "protein2": "8022.A0A060XTY3", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 199, "experimental": 694, "database": 0, "textmining": 384, "combined_score": 836 }, { "protein2": "8022.C1BFG2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 86, "combined_score": 741 }, { "protein2": "8022.A0A060ZHX0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 386, "database": 568, "textmining": 396, "combined_score": 841 }, { "protein2": "8022.A0A060XK45", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 207, "database": 736, "textmining": 121, "combined_score": 799 }, { "protein2": "8022.A0A060XRR2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 76, "experimental": 745, "database": 0, "textmining": 498, "combined_score": 871 }, { "protein2": "8022.A0A060Z6F4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 131, "experimental": 0, "database": 685, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060WD36", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 219, "database": 593, "textmining": 330, "combined_score": 768 }, { "protein2": "8022.A0A060YNG8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 450, "combined_score": 937 }, { "protein2": "8022.A0A060WT92", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 131, "experimental": 0, "database": 685, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060Z655", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 749, "database": 0, "textmining": 441, "combined_score": 853 }, { "protein2": "8022.A0A060XI12", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 690, "database": 547, "textmining": 238, "combined_score": 895 }, { "protein2": "8022.A0A060Z4W8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 690, "database": 547, "textmining": 238, "combined_score": 895 }, { "protein2": "8022.A0A060X6S5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 774, "experimental": 0, "database": 0, "textmining": 504, "combined_score": 883 }, { "protein2": "8022.A0A060Y1N8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060W5A5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 694, "textmining": 273, "combined_score": 768 }, { "protein2": "8022.A0A060WA73", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 666, "database": 0, "textmining": 342, "combined_score": 774 }, { "protein2": "8022.A0A060WAL5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 217, "experimental": 326, "database": 0, "textmining": 505, "combined_score": 715 }, { "protein2": "8022.C1BG62", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 749, "database": 435, "textmining": 0, "combined_score": 852 }, { "protein2": "8022.A0A060WKE6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 875, "experimental": 0, "database": 431, "textmining": 504, "combined_score": 961 }, { "protein2": "8022.A0A060W7K8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 616, "database": 721, "textmining": 208, "combined_score": 907 }, { "protein2": "8022.A0A060XDQ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 749, "database": 0, "textmining": 441, "combined_score": 853 }, { "protein2": "8022.A0A060WS77", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 679, "database": 0, "textmining": 279, "combined_score": 763 }, { "protein2": "8022.A0A060YEJ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 824, "textmining": 190, "combined_score": 851 }, { "protein2": "8022.A0A060X2B7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 207, "database": 736, "textmining": 121, "combined_score": 799 }, { "protein2": "8022.A0A060WK21", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060WZW0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 178, "database": 785, "textmining": 387, "combined_score": 884 }, { "protein2": "8022.A0A060Y4K2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 823, "experimental": 0, "database": 0, "textmining": 277, "combined_score": 868 }, { "protein2": "8022.A0A060VPV4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 666, "database": 0, "textmining": 342, "combined_score": 774 }, { "protein2": "8022.A0A060Y6S6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060WGE5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 875, "experimental": 0, "database": 431, "textmining": 504, "combined_score": 961 }, { "protein2": "8022.A0A060YX92", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 747, "database": 824, "textmining": 420, "combined_score": 971 }, { "protein2": "8022.A0A060WVN0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 219, "database": 593, "textmining": 330, "combined_score": 768 }, { "protein2": "8022.A0A060XER0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 180, "database": 772, "textmining": 218, "combined_score": 841 }, { "protein2": "8022.A0A060Y135", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060WP39", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 673, "database": 754, "textmining": 52, "combined_score": 917 }, { "protein2": "8022.A0A060XDM2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 207, "database": 736, "textmining": 121, "combined_score": 799 }, { "protein2": "8022.A0A060Z000", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 579, "database": 721, "textmining": 216, "combined_score": 899 }, { "protein2": "8022.A0A060X1X7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 217, "experimental": 326, "database": 0, "textmining": 505, "combined_score": 715 }, { "protein2": "8022.A0A061AEY4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 766, "database": 824, "textmining": 447, "combined_score": 975 }, { "protein2": "8022.A0A060X5I3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 675, "database": 785, "textmining": 268, "combined_score": 944 }, { "protein2": "8022.A0A060YMR9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 425, "experimental": 299, "database": 409, "textmining": 451, "combined_score": 851 }, { "protein2": "8022.A0A060XW94", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 684, "database": 824, "textmining": 340, "combined_score": 961 }, { "protein2": "8022.A0A060W6R9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060Y5Y0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 122, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 772 }, { "protein2": "8022.A0A060XTX7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 87, "combined_score": 741 }, { "protein2": "8022.A0A060YGN0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 207, "database": 736, "textmining": 121, "combined_score": 799 }, { "protein2": "8022.A0A060W8A7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 207, "database": 736, "textmining": 121, "combined_score": 799 }, { "protein2": "8022.A0A060X3S8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 802, "database": 829, "textmining": 504, "combined_score": 981 }, { "protein2": "8022.A0A060WG92", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060XXI9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 204, "database": 827, "textmining": 362, "combined_score": 904 }, { "protein2": "8022.A0A060Z173", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 188, "database": 816, "textmining": 276, "combined_score": 882 }, { "protein2": "8022.A0A060Z0R5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 706, "database": 824, "textmining": 441, "combined_score": 968 }, { "protein2": "8022.A0A060XV19", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 87, "combined_score": 741 }, { "protein2": "8022.A0A060W7E9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 299, "database": 829, "textmining": 0, "combined_score": 875 }, { "protein2": "8022.A0A060WAH7", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 199, "experimental": 694, "database": 0, "textmining": 384, "combined_score": 836 }, { "protein2": "8022.A0A060X4P6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 0, "textmining": 373, "combined_score": 706 }, { "protein2": "8022.A0A060X656", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 781, "experimental": 0, "database": 0, "textmining": 504, "combined_score": 887 }, { "protein2": "8022.A0A060W9X0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060W9W8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 48, "experimental": 346, "database": 433, "textmining": 400, "combined_score": 759 }, { "protein2": "8022.A0A060WW06", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 666, "database": 0, "textmining": 342, "combined_score": 774 }, { "protein2": "8022.A0A060ZDZ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 652, "database": 435, "textmining": 0, "combined_score": 794 }, { "protein2": "8022.A0A060X2M8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 131, "experimental": 0, "database": 685, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060XVQ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 758, "database": 824, "textmining": 370, "combined_score": 970 }, { "protein2": "8022.A0A060ZEW9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 222, "database": 832, "textmining": 150, "combined_score": 879 }, { "protein2": "8022.A0A060XYH4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 675, "database": 785, "textmining": 268, "combined_score": 944 }, { "protein2": "8022.A0A060WHG0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 87, "combined_score": 741 }, { "protein2": "8022.A0A060XZH1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060XVP1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 180, "database": 772, "textmining": 218, "combined_score": 841 }, { "protein2": "8022.A0A060XU58", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 755, "experimental": 0, "database": 0, "textmining": 126, "combined_score": 776 }, { "protein2": "8022.A0A060Z320", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 579, "database": 721, "textmining": 216, "combined_score": 899 }, { "protein2": "8022.A0A060ZXZ7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 288, "database": 832, "textmining": 505, "combined_score": 937 }, { "protein2": "8022.A0A060YFT4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 775, "database": 489, "textmining": 90, "combined_score": 887 }, { "protein2": "8022.A0A060YQV1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 240, "database": 827, "textmining": 505, "combined_score": 929 }, { "protein2": "8022.A0A060Y9V2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 774, "experimental": 0, "database": 0, "textmining": 504, "combined_score": 883 }, { "protein2": "8022.A0A060XX03", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 684, "database": 824, "textmining": 340, "combined_score": 961 }, { "protein2": "8022.A0A060Y1E2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 758 }, { "protein2": "8022.C1BI16", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 616, "database": 721, "textmining": 208, "combined_score": 907 }, { "protein2": "8022.A0A060Y7H3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 802, "database": 0, "textmining": 222, "combined_score": 839 }, { "protein2": "8022.A0A060XNR8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 675, "database": 785, "textmining": 230, "combined_score": 941 }, { "protein2": "8022.A0A060XGN6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 86, "combined_score": 741 }, { "protein2": "8022.A0A060XXJ1", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 }, { "protein2": "8022.A0A060WAD4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 48, "experimental": 346, "database": 433, "textmining": 400, "combined_score": 759 }, { "protein2": "8022.A0A060X729", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 616, "database": 721, "textmining": 208, "combined_score": 907 }, { "protein2": "8022.A0A060XBU0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 690, "database": 547, "textmining": 238, "combined_score": 895 }, { "protein2": "8022.A0A060YIJ3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 0, "textmining": 373, "combined_score": 706 }, { "protein2": "8022.A0A060WKD2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060X0A0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 148, "experimental": 184, "database": 583, "textmining": 110, "combined_score": 707 }, { "protein2": "8022.A0A060Z6E8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 672, "database": 0, "textmining": 396, "combined_score": 793 }, { "protein2": "8022.A0A060YDW3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 169, "experimental": 361, "database": 306, "textmining": 509, "combined_score": 794 }, { "protein2": "8022.A0A060XYU5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 758 }, { "protein2": "8022.A0A060XB77", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 679, "database": 0, "textmining": 279, "combined_score": 763 }, { "protein2": "8022.A0A060W716", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 616, "database": 721, "textmining": 208, "combined_score": 907 }, { "protein2": "8022.A0A060YE39", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 823, "experimental": 0, "database": 0, "textmining": 277, "combined_score": 868 }, { "protein2": "8022.A0A060X0Z8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 207, "database": 736, "textmining": 121, "combined_score": 799 }, { "protein2": "8022.A0A060YW05", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 366, "database": 824, "textmining": 220, "combined_score": 905 }, { "protein2": "8022.A0A060XUU8", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 }, { "protein2": "8022.A0A060XSK5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060VU69", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 122, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 772 }, { "protein2": "8022.A0A060WRH2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 758 }, { "protein2": "8022.A0A060YW55", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 425, "experimental": 299, "database": 409, "textmining": 451, "combined_score": 851 }, { "protein2": "8022.A0A060WFX5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 131, "experimental": 0, "database": 685, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060ZAM3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 815, "database": 829, "textmining": 451, "combined_score": 981 }, { "protein2": "8022.A0A060Y0H6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060WE07", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 856, "database": 829, "textmining": 450, "combined_score": 985 }, { "protein2": "8022.A0A060XPT1", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 }, { "protein2": "8022.A0A060XNV6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 122, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 772 }, { "protein2": "8022.A0A060YST3", "neighborhood": 46, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 779, "textmining": 86, "combined_score": 790 }, { "protein2": "8022.A0A060YQF1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 180, "database": 772, "textmining": 218, "combined_score": 841 }, { "protein2": "8022.A0A060XFH7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060YHX9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 188, "database": 816, "textmining": 276, "combined_score": 882 }, { "protein2": "8022.A0A060WGY3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 131, "experimental": 0, "database": 685, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060YI26", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060WM17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 666, "database": 0, "textmining": 342, "combined_score": 774 }, { "protein2": "8022.A0A060Z3S0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 766, "database": 824, "textmining": 447, "combined_score": 975 }, { "protein2": "8022.A0A060W5V1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 53, "experimental": 802, "database": 829, "textmining": 450, "combined_score": 980 }, { "protein2": "8022.A0A060VZM9", "neighborhood": 0, "fusion": 0, "cooccurence": 69, "coexpression": 628, "experimental": 471, "database": 862, "textmining": 512, "combined_score": 985 }, { "protein2": "8022.A0A060ZEB5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 240, "database": 827, "textmining": 505, "combined_score": 929 }, { "protein2": "8022.A0A060WF04", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 219, "database": 593, "textmining": 330, "combined_score": 768 }, { "protein2": "8022.A0A060YT06", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 824, "textmining": 190, "combined_score": 851 }, { "protein2": "8022.A0A060YHA2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 672, "database": 0, "textmining": 396, "combined_score": 793 }, { "protein2": "8022.C1BHI8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 86, "combined_score": 741 }, { "protein2": "8022.A0A060WAH4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 299, "database": 824, "textmining": 0, "combined_score": 871 }, { "protein2": "8022.A0A060XC88", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 148, "experimental": 184, "database": 583, "textmining": 110, "combined_score": 707 }, { "protein2": "8022.A0A060WLM0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 669, "database": 774, "textmining": 388, "combined_score": 950 }, { "protein2": "8022.Q9PT09", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 749, "database": 435, "textmining": 0, "combined_score": 852 }, { "protein2": "8022.A0A060YCF8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 847, "experimental": 471, "database": 839, "textmining": 507, "combined_score": 992 }, { "protein2": "8022.A0A060XWU6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 758, "database": 824, "textmining": 370, "combined_score": 970 }, { "protein2": "8022.A0A060WMT5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 386, "database": 568, "textmining": 396, "combined_score": 841 }, { "protein2": "8022.A0A060XTB8", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 199, "experimental": 694, "database": 0, "textmining": 384, "combined_score": 836 }, { "protein2": "8022.A0A060VZX4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 675, "database": 785, "textmining": 268, "combined_score": 944 }, { "protein2": "8022.A0A060YR45", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 366, "database": 824, "textmining": 220, "combined_score": 905 }, { "protein2": "8022.A0A060W1U5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 0, "database": 829, "textmining": 503, "combined_score": 913 }, { "protein2": "8022.A0A060XPN1", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 }, { "protein2": "8022.A0A060Y4Q1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 204, "database": 827, "textmining": 362, "combined_score": 904 }, { "protein2": "8022.A0A060Z819", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 188, "database": 816, "textmining": 276, "combined_score": 882 }, { "protein2": "8022.A0A060YNT6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060XCS7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 207, "database": 736, "textmining": 121, "combined_score": 799 }, { "protein2": "8022.A0A060WJD4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 706, "database": 824, "textmining": 441, "combined_score": 968 }, { "protein2": "8022.A0A060Z3Y6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 178, "database": 785, "textmining": 387, "combined_score": 884 }, { "protein2": "8022.A0A060ZQU3", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 679, "database": 0, "textmining": 279, "combined_score": 763 }, { "protein2": "8022.A0A060WZ94", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 675, "database": 785, "textmining": 230, "combined_score": 941 }, { "protein2": "8022.A0A060X8S8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 86, "combined_score": 741 }, { "protein2": "8022.A0A060WC46", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 386, "database": 568, "textmining": 396, "combined_score": 841 }, { "protein2": "8022.A0A060XX02", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 } ]
A0A060YAV5
Beta-2 adrenergic receptor (Beta-2 adrenoreceptor)
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
393
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
MEREREREREREEGGGGGXGEPGYSEVEMVLLGMLMSLLVVGIVFGNILVIIAIYRFQRLQNITNCFITSLACADLVMGLIVVPFGACYIIFNTWHFGSFWCEFWTATDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTKCKARVVVLLVWVIAGLISFLPIHMKWWISDDAEAKACIQNSNCCDFNTNTAYAITSSIISFYIPLVVMVFVYSRVFQEAKQQLRKIDRSEGRFHAHNNNMAGGGGGGGGGGGGTKFCLREHKALKTLGIIMGIFTLCWLPFFVLNVVVAIWKVGDIGLAFRILNWIGYANSAFNPLIYCRSPEFRYAFKEILCIKKVRFPNIGPTNGYVYSGHSWQTADGCSGRGEAGGCGAADRTDPNGNCSKGLTTVL
[ "GO:0043434", "GO:1901652", "GO:0051952", "GO:0065007", "GO:1903530", "GO:0032811", "GO:0033604", "GO:0051049", "GO:0051051", "GO:0008150", "GO:0042221", "GO:0010243", "GO:0050896", "GO:1901698", "GO:0050789", "GO:0050433", "GO:0009719", "GO:0032879", "GO:0007186", "GO:0050794", "GO:0051716", "GO:0009987", "GO:0023052", "GO:1901700", "GO:0051046", "GO:0071875", "GO:0014060", "GO:0051953", "GO:0048523", "GO:0048519", "GO:0010033", "GO:0009725", "GO:0051048", "GO:0007154", "GO:1903531", "GO:0007165" ]
[ "GO:0008150", "GO:0065007", "GO:0050896", "GO:0050789", "GO:0009987", "GO:0023052", "GO:0048519", "GO:0051051", "GO:0042221", "GO:0009719", "GO:0032879", "GO:0050794", "GO:0051716", "GO:0048523", "GO:0007154", "GO:0007165", "GO:1903530", "GO:0051049", "GO:1901698", "GO:0007186", "GO:1901700", "GO:0051953", "GO:0010033", "GO:0009725", "GO:0051048", "GO:1903531", "GO:0043434", "GO:1901652", "GO:0051952", "GO:0033604", "GO:0010243", "GO:0050433", "GO:0051046", "GO:0071875", "GO:0032811", "GO:0014060" ]
null
null
[ "IPR002233", "IPR000276", "IPR017452" ]
null
8022.A0A060YAV5
[ "8022.A0A060YAW4", "8022.A0A060Y3C6", "8022.A0A060Z8T5", "8022.A0A060YP44", "8022.A0A060Z480", "8022.A0A060WJ93", "8022.A0A060XCL5", "8022.A0A060XA34", "8022.A0A060WVD9", "8022.A0A060ZG63", "8022.A0A060XUD4", "8022.A0A060YR93", "8022.A0A060WCN9", "8022.B2KL82", "8022.A0A060XLR8", "8022.A0A060W808", "8022.A0A060WHT5", "8022.A0A060XH49", "8022.A0A060XLH0", "8022.A0A060XIC8", "8022.A0A060YK59", "8022.A0A060WVH7", "8022.A0A060Y433", "8022.A0A060VWI9", "8022.A0A060WXK5", "8022.A0A060X2B4", "8022.A0A060VXS0", "8022.A0A060XLX4", "8022.A0A060W0Q4", "8022.A0A060XC17", "8022.A0A060XVD9", "8022.A0A060WF25", "8022.A0A060XRA0", "8022.A0A060YC25", "8022.A0A060WHG5", "8022.A0A060YJ99", "8022.A0A060X5U6", "8022.A0A060W8T4", "8022.A0A060W6W6", "8022.A0A061A7Q4", "8022.A0A060WRL9", "8022.A0A060YV89", "8022.A0A060Y3R9", "8022.A0A060WSN3", "8022.A0A060XBN9", "8022.A0A060XAN6", "8022.A0A060XB81", "8022.A0A060WLD6", "8022.A0A060ZE50", "8022.A0A060YPP2", "8022.A0A060ZAK0", "8022.A0A060W476", "8022.A0A060XBV2", "8022.A0A060YHK9", "8022.A0A060Z6G3", "8022.A0A060XJ06", "8022.A0A060XFJ9", "8022.A0A060VX07", "8022.A0A060WVI0", "8022.A0A060Z4B9", "8022.A0A060W081", "8022.A0A060Y7L4", "8022.A0A060WP41", "8022.A0A060Y8R0", "8022.A0A060Y3I4", "8022.A0A060VW67", "8022.A0A060W066", "8022.A0A060XG51", "8022.Q7SZV5", "8022.A0A060VY52", "8022.A0A060Z2S8", "8022.Q7T2I7", "8022.A0A060Y8H5", "8022.A0A060XJN8", "8022.A0A060Z2C2", "8022.A0A060WHA4", "8022.A0A060YU11", "8022.A0A060WDT4", "8022.A0A060VXM2", "8022.A0A060WE78", "8022.A0A060WSX0", "8022.A0A060XTK7", "8022.A0A060YWJ1", "8022.A0A060VZ80", "8022.A0A060XGM0", "8022.A0A060W0D6", "8022.A0A060Z1D1", "8022.A0A060XB37", "8022.A0A060WIZ5", "8022.C1BH40", "8022.A0A060Z1I0", "8022.A0A060Z6I0", "8022.A0A060YEE1", "8022.A0A060VPW7", "8022.A0A060Z6T3", "8022.A0A060YL43", "8022.A0A060VWA0", "8022.A0A060ZEF4" ]
[ { "protein2": "8022.A0A060YAW4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060Y3C6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060Z8T5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060YP44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 827, "textmining": 89, "combined_score": 897 }, { "protein2": "8022.A0A060Z480", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060WJ93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060XCL5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 250, "database": 827, "textmining": 109, "combined_score": 874 }, { "protein2": "8022.A0A060XA34", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060WVD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 829, "textmining": 62, "combined_score": 891 }, { "protein2": "8022.A0A060ZG63", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060XUD4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060YR93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060WCN9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 110, "combined_score": 839 }, { "protein2": "8022.B2KL82", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 844, "textmining": 162, "combined_score": 961 }, { "protein2": "8022.A0A060XLR8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060W808", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060WHT5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060XH49", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 89, "combined_score": 835 }, { "protein2": "8022.A0A060XLH0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060XIC8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060YK59", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060WVH7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 825, "textmining": 62, "combined_score": 889 }, { "protein2": "8022.A0A060Y433", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060VWI9", "neighborhood": 0, "fusion": 0, "cooccurence": 81, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 89, "combined_score": 842 }, { "protein2": "8022.A0A060WXK5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060X2B4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060VXS0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060XLX4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060W0Q4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060XC17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 571, "textmining": 0, "combined_score": 708 }, { "protein2": "8022.A0A060XVD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 291, "database": 783, "textmining": 0, "combined_score": 839 }, { "protein2": "8022.A0A060WF25", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060XRA0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060YC25", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060WHG5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060YJ99", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 829, "textmining": 62, "combined_score": 891 }, { "protein2": "8022.A0A060X5U6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 46, "experimental": 0, "database": 825, "textmining": 62, "combined_score": 829 }, { "protein2": "8022.A0A060W8T4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060W6W6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 829, "textmining": 62, "combined_score": 891 }, { "protein2": "8022.A0A061A7Q4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060WRL9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 844, "textmining": 162, "combined_score": 961 }, { "protein2": "8022.A0A060YV89", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 241, "database": 827, "textmining": 86, "combined_score": 869 }, { "protein2": "8022.A0A060Y3R9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 779, "textmining": 86, "combined_score": 789 }, { "protein2": "8022.A0A060WSN3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 241, "database": 827, "textmining": 86, "combined_score": 869 }, { "protein2": "8022.A0A060XBN9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 59, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 838 }, { "protein2": "8022.A0A060XAN6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 225, "database": 832, "textmining": 130, "combined_score": 876 }, { "protein2": "8022.A0A060XB81", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060WLD6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 46, "experimental": 0, "database": 825, "textmining": 62, "combined_score": 829 }, { "protein2": "8022.A0A060ZE50", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060YPP2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060ZAK0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 832, "textmining": 89, "combined_score": 902 }, { "protein2": "8022.A0A060W476", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060XBV2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060YHK9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060Z6G3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060XJ06", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060XFJ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 63, "combined_score": 829 }, { "protein2": "8022.A0A060VX07", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060WVI0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060Z4B9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060W081", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060Y7L4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060WP41", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060Y8R0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060Y3I4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060VW67", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 81, "combined_score": 832 }, { "protein2": "8022.A0A060W066", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 779, "textmining": 86, "combined_score": 789 }, { "protein2": "8022.A0A060XG51", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 748, "database": 419, "textmining": 86, "combined_score": 854 }, { "protein2": "8022.Q7SZV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 387, "database": 831, "textmining": 124, "combined_score": 901 }, { "protein2": "8022.A0A060VY52", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060Z2S8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.Q7T2I7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 167, "combined_score": 849 }, { "protein2": "8022.A0A060Y8H5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 571, "textmining": 0, "combined_score": 708 }, { "protein2": "8022.A0A060XJN8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060Z2C2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 844, "textmining": 162, "combined_score": 961 }, { "protein2": "8022.A0A060WHA4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 267, "database": 832, "textmining": 87, "combined_score": 881 }, { "protein2": "8022.A0A060YU11", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060WDT4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060VXM2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 59, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 838 }, { "protein2": "8022.A0A060WE78", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060WSX0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 829, "textmining": 62, "combined_score": 891 }, { "protein2": "8022.A0A060XTK7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060YWJ1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 593, "textmining": 162, "combined_score": 898 }, { "protein2": "8022.A0A060VZ80", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 825, "textmining": 62, "combined_score": 889 }, { "protein2": "8022.A0A060XGM0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 110, "combined_score": 839 }, { "protein2": "8022.A0A060W0D6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 46, "experimental": 0, "database": 825, "textmining": 62, "combined_score": 829 }, { "protein2": "8022.A0A060Z1D1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 751, "database": 523, "textmining": 0, "combined_score": 876 }, { "protein2": "8022.A0A060XB37", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 167, "combined_score": 849 }, { "protein2": "8022.A0A060WIZ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.C1BH40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 751, "database": 523, "textmining": 0, "combined_score": 876 }, { "protein2": "8022.A0A060Z1I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060Z6I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 827, "textmining": 89, "combined_score": 897 }, { "protein2": "8022.A0A060YEE1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060VPW7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 250, "database": 827, "textmining": 109, "combined_score": 874 }, { "protein2": "8022.A0A060Z6T3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060YL43", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 825, "textmining": 62, "combined_score": 889 }, { "protein2": "8022.A0A060VWA0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060ZEF4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 } ]
A0A060YDW5
Alpha-2B adrenergic receptor (Alpha-2B adrenoreceptor)
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
446
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
MAMIPDITCLSGPRVNLNISFTFGPTPCNQTVLRTAPYSPEATALFATAITLMMILTIVGNILVIIAVLTSRSLRGPQNLFLVSLAAADILVATLIIPFSLANELQGYWAFRSLWCEIYLALDVLFCTSSIAHLCAISLDRYLSISRPVSYGAQRTPARIKAAIVVVWLLSAAISFPPLLSLDKSEGGVEVCELNNERWYILYSTIGSFFAPCLIMIGVYIKIYQIAKQHTRCPPGEKPNLNTTPGNAQLQHNRGEGGKADGQSKNAVPSKSLPVSSPSSPPPQSETQAKTPTGPQIEPQPQTQPSSPTSRQRNTTNDDSFSSGSEAEAEMSGKRKGWEGTGQPGKAQVTPMSRRKAMVNREKRFTFVLAVVIGVFVICWFPFFFSYSLQAICPETCTLPDPLFKFFFWIGYCNSCLNPVIYTIFNQDFRKAFKKILCRDTKGTNF
[ "GO:0051716", "GO:0051602", "GO:0009628", "GO:0009987", "GO:0051952", "GO:0065007", "GO:0023052", "GO:1903530", "GO:0032811", "GO:0033604", "GO:0051046", "GO:0051049", "GO:0051051", "GO:0008150", "GO:0071875", "GO:0050896", "GO:0050789", "GO:0014060", "GO:0051953", "GO:0050433", "GO:0048523", "GO:0048519", "GO:0007186", "GO:0051048", "GO:0032879", "GO:1903531", "GO:0007154", "GO:0007165", "GO:0050794" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0023052", "GO:0050896", "GO:0050789", "GO:0048519", "GO:0051716", "GO:0009628", "GO:0051051", "GO:0048523", "GO:0032879", "GO:0007154", "GO:0007165", "GO:0050794", "GO:0051602", "GO:1903530", "GO:0051049", "GO:0051953", "GO:0007186", "GO:0051048", "GO:1903531", "GO:0051952", "GO:0033604", "GO:0051046", "GO:0071875", "GO:0050433", "GO:0032811", "GO:0014060" ]
null
null
[ "IPR002233", "IPR000276", "IPR017452" ]
af_db/AF-A0A060YDW5-F1-model_v4.cif.gz
8022.A0A060YDW5
[ "8022.A0A060W8V2", "8022.A0A060XRQ9", "8022.A0A060ZAK0", "8022.A0A060X2G9", "8022.A0A060WXC1", "8022.A0A060XC17", "8022.A0A060XVD9", "8022.A0A060VPZ9", "8022.A0A060WL89", "8022.A0A060WVZ9", "8022.A0A060YP44", "8022.A0A060XN60", "8022.A0A060Y1H7", "8022.C1BH40", "8022.A0A060Z6I0", "8022.A0A060Z6E2", "8022.A0A060Z1D1", "8022.A0A060XPS3", "8022.A0A060WEW9", "8022.A0A060WMN1", "8022.A0A060WGC3", "8022.A0A060WHA4", "8022.A0A060Y8H5", "8022.Q7SZV5", "8022.A0A060Y2Z0", "8022.A0A060XSB8", "8022.A0A060YR57" ]
[ { "protein2": "8022.A0A060W8V2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 608, "textmining": 0, "combined_score": 736 }, { "protein2": "8022.A0A060XRQ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060ZAK0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 89, "combined_score": 751 }, { "protein2": "8022.A0A060X2G9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060WXC1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060XC17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 571, "textmining": 0, "combined_score": 708 }, { "protein2": "8022.A0A060XVD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 291, "database": 783, "textmining": 0, "combined_score": 839 }, { "protein2": "8022.A0A060VPZ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 572, "textmining": 0, "combined_score": 709 }, { "protein2": "8022.A0A060WL89", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060WVZ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060YP44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 523, "textmining": 88, "combined_score": 716 }, { "protein2": "8022.A0A060XN60", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 572, "textmining": 0, "combined_score": 709 }, { "protein2": "8022.A0A060Y1H7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.C1BH40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 626, "database": 567, "textmining": 0, "combined_score": 833 }, { "protein2": "8022.A0A060Z6I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 523, "textmining": 88, "combined_score": 716 }, { "protein2": "8022.A0A060Z6E2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060Z1D1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 626, "database": 567, "textmining": 0, "combined_score": 833 }, { "protein2": "8022.A0A060XPS3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060WEW9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060WMN1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060WGC3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060WHA4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 155, "experimental": 267, "database": 571, "textmining": 86, "combined_score": 724 }, { "protein2": "8022.A0A060Y8H5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 608, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.Q7SZV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 387, "database": 568, "textmining": 86, "combined_score": 736 }, { "protein2": "8022.A0A060Y2Z0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060XSB8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060YR57", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 } ]
A0A060YJC3
Sodium/potassium-transporting ATPase subunit alpha
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
992
Cell membrane, sarcolemma {ECO:0000256|ARBA:ARBA00004415}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004415}. Cell membrane {ECO:0000256|RuleBase:RU362084}; Multi-pass membrane protein {ECO:0000256|RuleBase:RU362084}.
MDELKKEVDLDDHKLTLDELNRKYGTDLSKGLSSAKAAENLARDGPNSLTPPPTTPEWVKFCKQMFGGFSMLLWTGALLCFLAYGIQAAMEDEPANDNLYLGVVLSAVVIVTGCFSYYQEAKSSKIMDSFKNLVPQQALVVRDGEKMNINAQQVVVGDLVEVKGGDRIPADLRIISASGCKVDNSSLTGESEPQTRTPDYSNDNPLETRNIAFFSTNCVEGTARGIVINTGDRTVMGRIATLASGLEVGRTPISIEIEHFIHIITGVAVFLGMSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGTSFDRSSATWAALARVAGLCNRAVFLAEQSGIPILKRDVAGDASESALLKCIELCCGSVQGMRDQYTKVAEIPFNSTNKYQLSVHLNKNEGESKHLLVMKGAPERILDRCSTILIQGKEQPLDDEMKDSFQNAYMELGGLGERVLGFCHFQLPDDQFAEGFQFDCEEVNFPTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNEVDPRDAKACVVHGGDLKDLSAEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSKTDKLVNERLISIAYGQIGMIQALAGFFTYFVILAENGFLPSRLLGIRVDWDNKFCNDLEDSYGQQWTYEQRKIVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMRNKILIFGLFEETALAAFLSYCPGMGIALRMYPLKPSWWFCAFPYSLLIFIYDEIRKLIIRRSPGGWVERETYY
[ "GO:0006970", "GO:0043434", "GO:1901652", "GO:0009628", "GO:1901700", "GO:0009651", "GO:0006950", "GO:0008150", "GO:0042538", "GO:0042221", "GO:0010243", "GO:0050896", "GO:1901698", "GO:0010033", "GO:0009725", "GO:0060416", "GO:0009719", "GO:0006972", "GO:0015399", "GO:0008556", "GO:0008554", "GO:0015079", "GO:0140358", "GO:0022890", "GO:0005215", "GO:0015662", "GO:1901702", "GO:0022853", "GO:0042626", "GO:0015075", "GO:0005391", "GO:0022857", "GO:0015318", "GO:0008324", "GO:0140657", "GO:0046873", "GO:0015081", "GO:0003674", "GO:0019829", "GO:0022804" ]
[ "GO:0008150", "GO:0050896", "GO:0009628", "GO:0006950", "GO:0042221", "GO:0009719", "GO:0006970", "GO:1901700", "GO:1901698", "GO:0010033", "GO:0009725", "GO:0043434", "GO:1901652", "GO:0009651", "GO:0010243", "GO:0006972", "GO:0042538", "GO:0060416" ]
[ "GO:0003674", "GO:0005215", "GO:0140657", "GO:0042626", "GO:0022857", "GO:0140358", "GO:1901702", "GO:0015075", "GO:0015318", "GO:0019829", "GO:0022804", "GO:0015399", "GO:0008556", "GO:0008554", "GO:0015079", "GO:0022890", "GO:0015662", "GO:0022853", "GO:0008324", "GO:0015081", "GO:0005391", "GO:0046873" ]
null
[ "IPR006068", "IPR004014", "IPR023299", "IPR018303", "IPR023298", "IPR008250", "IPR050510", "IPR036412", "IPR023214", "IPR005775", "IPR001757", "IPR044492" ]
af_db/AF-A0A060YJC3-F1-model_v4.cif.gz
8022.A0A060YJC3
[ "8022.A0A060XM52", "8022.A0A060YFB0", "8022.A0A060YI40", "8022.A0A060WZD8", "8022.A0A060VYP9", "8022.A0A060YEQ6", "8022.A0A060XCM7", "8022.A0A060ZIV0", "8022.A0A060VMX9", "8022.A0A060VV08", "8022.A0A060XUR5", "8022.A0A060W616", "8022.A0A060YU43", "8022.A0A060WM21", "8022.A0A060W5G5", "8022.A0A060YXW3", "8022.A0A060Z8B0", "8022.A0A060XAY3", "8022.A0A060Y7Y8", "8022.A0A060XKC6", "8022.A0A060X014", "8022.A0A060Z640", "8022.A0A060ZL40", "8022.A0A060YM41", "8022.A0A060Y1F8", "8022.A0A061AEV5", "8022.A0A060WA02", "8022.A0A060XVJ2", "8022.A0A060YYE6", "8022.A0A060Z2N8" ]
[ { "protein2": "8022.A0A060XM52", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060YFB0", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A060YI40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 750 }, { "protein2": "8022.A0A060WZD8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 660, "database": 451, "textmining": 88, "combined_score": 814 }, { "protein2": "8022.A0A060VYP9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 614, "database": 510, "textmining": 198, "combined_score": 835 }, { "protein2": "8022.A0A060YEQ6", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A060XCM7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 788, "textmining": 156, "combined_score": 907 }, { "protein2": "8022.A0A060ZIV0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 681, "database": 569, "textmining": 144, "combined_score": 876 }, { "protein2": "8022.A0A060VMX9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 574, "textmining": 120, "combined_score": 807 }, { "protein2": "8022.A0A060VV08", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 783, "textmining": 86, "combined_score": 795 }, { "protein2": "8022.A0A060XUR5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060W616", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 574, "textmining": 108, "combined_score": 804 }, { "protein2": "8022.A0A060YU43", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060WM21", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 574, "textmining": 108, "combined_score": 804 }, { "protein2": "8022.A0A060W5G5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 574, "textmining": 108, "combined_score": 804 }, { "protein2": "8022.A0A060YXW3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060Z8B0", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A060XAY3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 719, "textmining": 99, "combined_score": 869 }, { "protein2": "8022.A0A060Y7Y8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 699, "database": 671, "textmining": 178, "combined_score": 913 }, { "protein2": "8022.A0A060XKC6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060X014", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 719, "textmining": 99, "combined_score": 869 }, { "protein2": "8022.A0A060Z640", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060ZL40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 681, "database": 569, "textmining": 144, "combined_score": 876 }, { "protein2": "8022.A0A060YM41", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A060Y1F8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 750 }, { "protein2": "8022.A0A061AEV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 699, "database": 671, "textmining": 178, "combined_score": 913 }, { "protein2": "8022.A0A060WA02", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 764, "textmining": 86, "combined_score": 777 }, { "protein2": "8022.A0A060XVJ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 783, "textmining": 86, "combined_score": 795 }, { "protein2": "8022.A0A060YYE6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 699, "database": 671, "textmining": 178, "combined_score": 913 }, { "protein2": "8022.A0A060Z2N8", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 } ]
A0A060D9G1
Sodium/potassium-transporting ATPase subunit alpha
null
Salmo salar (Atlantic salmon)
876
Cell membrane {ECO:0000256|RuleBase:RU362084}; Multi-pass membrane protein {ECO:0000256|RuleBase:RU362084}. Membrane {ECO:0000256|ARBA:ARBA00004141}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004141}.
KQLFGGFCMLLWIGAVLCFMAHIIQVTSEEEPTNANLYLGLVLAVVVIITGCFSYYQEAKSSKIMDSFKNLVPQQALVVRDGEKKNINTEEVVVGDIVEVKGGDRIPADLRIISASGCKVDNSSLTGESEPQTRSPDFSNDNPLETRNIAFFSTNCVEGTARGIVINTGDHTIMGRIAALAMSLESGQTPLGIEIDHFIEIITGVSVFFGLTFLILSVILGYGWLPSIIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHDADTTENQSGTSFDKSSATWAALARVAGLCNRAVFLAEQNNVPILKRDVAGDASETALLKCIELCCGSVKDMREKYNKVVEIPFNSTNKYQLSIHENNMAGESNHLLVMKGAPERILDSCSTILLQGKEHPLDDEIKESFQKAYEELGGLGERVLGFSHFQLPDDQFPEGFDFDCEDVNFPTENLCFVGLMSMIDPPRAAVPDAVSKCRCAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEEIAARLKIPVSEVNPRDAKACVVHGGELKDMTAEELDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALRKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSITYTLSSKIPEMTPFLFLLLANIPLALGTVTILCIDLGTDMIPAISLAYEQAENDIMKRQPRNPKTDRLVNERLISVAYGQFGVMLAAAGFFTYFVIMAENGFYPMDLLGIRLDWENQYINDLEDSYGQQWTYESRKIIEFTCHTAYFAAVVIAQWAVLIVCKTRKNSFFQQGLMKNRVLIFGLCSESALALFL
[ "GO:0006970", "GO:0050896", "GO:0009628", "GO:0009651", "GO:0006950", "GO:0008150", "GO:0042538", "GO:0006972", "GO:0045178", "GO:0009925", "GO:0110165", "GO:0016323", "GO:0098590", "GO:0071944", "GO:0005575", "GO:0016020", "GO:0005886", "GO:0015399", "GO:0008556", "GO:0008554", "GO:0015079", "GO:0140358", "GO:0022890", "GO:0005215", "GO:0015662", "GO:1901702", "GO:0022853", "GO:0042626", "GO:0015075", "GO:0005391", "GO:0022857", "GO:0015318", "GO:0008324", "GO:0140657", "GO:0046873", "GO:0015081", "GO:0003674", "GO:0019829", "GO:0022804" ]
[ "GO:0008150", "GO:0050896", "GO:0009628", "GO:0006950", "GO:0006970", "GO:0009651", "GO:0006972", "GO:0042538" ]
[ "GO:0003674", "GO:0005215", "GO:0140657", "GO:0042626", "GO:0022857", "GO:0140358", "GO:1901702", "GO:0015075", "GO:0015318", "GO:0019829", "GO:0022804", "GO:0015399", "GO:0008556", "GO:0008554", "GO:0015079", "GO:0022890", "GO:0015662", "GO:0022853", "GO:0008324", "GO:0015081", "GO:0005391", "GO:0046873" ]
[ "GO:0005575", "GO:0110165", "GO:0045178", "GO:0071944", "GO:0016020", "GO:0009925", "GO:0098590", "GO:0005886", "GO:0016323" ]
[ "IPR006068", "IPR023299", "IPR018303", "IPR023298", "IPR008250", "IPR050510", "IPR036412", "IPR023214", "IPR005775", "IPR001757", "IPR044492" ]
af_db/AF-A0A060D9G1-F1-model_v4.cif.gz
null
null
null
A0A060W6G8
Alpha-2A adrenergic receptor (Alpha-2A adrenoreceptor)
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
390
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
MGCDNLTNSNGTLPARLPYTVQTSVPLTILVGILILLTVFGNVLVVIAVFTSRALRAPQNLFLVSLACADILVATLVMPFSLANELMGYWYFGQVWCEIYLALDVLFCTSSITHLCAISLDRYWSVTQAIEYNSKRTPRRIKCIVLFVWVLAAIISFPPLISMEKEGAKEEGPTCKINEEKWYIIFSSTASFFAPCVIMILVYVRIYQVAKKRTRAPTGERRRENNNPEKRNKRGRDGVEEDAEVNGLNMEEECSSSDGNENQCSIKMKRSKEKTKVCQVKLAEPSPKGDDAQQYVKVSRWKGRQNREKRFTFVLAVVMGVFVVCWFPFFFTYTLTAICDSCCVPESLFNFFFWFGYCNSSLNPVIYTIFNNDFRRSFKKILCKRDRRGL
[ "GO:0051716", "GO:0051602", "GO:0009628", "GO:0009987", "GO:0051952", "GO:0065007", "GO:0023052", "GO:1903530", "GO:0032811", "GO:0033604", "GO:0051046", "GO:0051049", "GO:0051051", "GO:0008150", "GO:0071875", "GO:0050896", "GO:0050789", "GO:0014060", "GO:0051953", "GO:0050433", "GO:0048523", "GO:0048519", "GO:0007186", "GO:0051048", "GO:0032879", "GO:1903531", "GO:0007154", "GO:0007165", "GO:0050794" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0023052", "GO:0050896", "GO:0050789", "GO:0048519", "GO:0051716", "GO:0009628", "GO:0051051", "GO:0048523", "GO:0032879", "GO:0007154", "GO:0007165", "GO:0050794", "GO:0051602", "GO:1903530", "GO:0051049", "GO:0051953", "GO:0007186", "GO:0051048", "GO:1903531", "GO:0051952", "GO:0033604", "GO:0051046", "GO:0071875", "GO:0050433", "GO:0032811", "GO:0014060" ]
null
null
[ "IPR002233", "IPR000276", "IPR017452" ]
af_db/AF-A0A060W6G8-F1-model_v4.cif.gz
8022.A0A060W6G8
[ "8022.A0A060WEW9", "8022.A0A060Z1D1", "8022.A0A060Z6E2", "8022.A0A060Z6I0", "8022.C1BH40", "8022.A0A060YR57", "8022.A0A060Y2Z0", "8022.Q7SZV5", "8022.A0A060Y8H5", "8022.A0A060WHA4", "8022.A0A060XVD9", "8022.A0A060XC17", "8022.A0A060ZAK0", "8022.A0A060W8V2", "8022.A0A060YP44", "8022.A0A060WL89" ]
[ { "protein2": "8022.A0A060WEW9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 579, "textmining": 0, "combined_score": 716 }, { "protein2": "8022.A0A060Z1D1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 626, "database": 523, "textmining": 0, "combined_score": 816 }, { "protein2": "8022.A0A060Z6E2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 579, "textmining": 0, "combined_score": 716 }, { "protein2": "8022.A0A060Z6I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 523, "textmining": 88, "combined_score": 716 }, { "protein2": "8022.C1BH40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 626, "database": 523, "textmining": 0, "combined_score": 816 }, { "protein2": "8022.A0A060YR57", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 579, "textmining": 0, "combined_score": 716 }, { "protein2": "8022.A0A060Y2Z0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 579, "textmining": 0, "combined_score": 716 }, { "protein2": "8022.Q7SZV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 387, "database": 568, "textmining": 86, "combined_score": 736 }, { "protein2": "8022.A0A060Y8H5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 596, "textmining": 0, "combined_score": 725 }, { "protein2": "8022.A0A060WHA4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 149, "experimental": 267, "database": 571, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060XVD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 291, "database": 783, "textmining": 0, "combined_score": 839 }, { "protein2": "8022.A0A060XC17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 571, "textmining": 0, "combined_score": 708 }, { "protein2": "8022.A0A060ZAK0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 89, "combined_score": 751 }, { "protein2": "8022.A0A060W8V2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 596, "textmining": 0, "combined_score": 728 }, { "protein2": "8022.A0A060YP44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 523, "textmining": 88, "combined_score": 716 }, { "protein2": "8022.A0A060WL89", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 579, "textmining": 0, "combined_score": 716 } ]
A0A060WT98
Chemokine interleukin-8-like domain-containing protein
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
95
Secreted {ECO:0000256|ARBA:ARBA00004613}.
MSIRMSASLVVVLLALLTITEGMSLRGMGADLRCRCIETESRRIGKLIKKVEMFPPSSHCRDTEIIATLSKSGQEICLDVSAPWVKKVIEKMLAK
[ "GO:0009743", "GO:0065007", "GO:0032928", "GO:0048518", "GO:0048870", "GO:0008150", "GO:0006954", "GO:0042221", "GO:2000145", "GO:0002523", "GO:2000377", "GO:0050896", "GO:0002685", "GO:0050900", "GO:0050789", "GO:0031325", "GO:0019222", "GO:0032930", "GO:0040017", "GO:0090322", "GO:0002684", "GO:0050794", "GO:0006952", "GO:0009893", "GO:0002376", "GO:0002682", "GO:0009987", "GO:0031323", "GO:0030335", "GO:1901700", "GO:0006950", "GO:0030334", "GO:1902624", "GO:2000379", "GO:1902622", "GO:0010033", "GO:2000147", "GO:0002687", "GO:0040012", "GO:0016477", "GO:0048522", "GO:0110165", "GO:0005575", "GO:0005576", "GO:0005615" ]
[ "GO:0008150", "GO:0065007", "GO:0048518", "GO:0050896", "GO:0050789", "GO:0002376", "GO:0009987", "GO:0048870", "GO:0042221", "GO:0050900", "GO:0019222", "GO:0040017", "GO:0002684", "GO:0050794", "GO:0009893", "GO:0002682", "GO:0006950", "GO:0040012", "GO:0048522", "GO:2000145", "GO:0002523", "GO:0002685", "GO:0031325", "GO:0006952", "GO:0031323", "GO:1901700", "GO:0010033", "GO:2000147", "GO:0002687", "GO:0016477", "GO:0009743", "GO:0006954", "GO:2000377", "GO:0030335", "GO:0030334", "GO:1902624", "GO:2000379", "GO:1902622", "GO:0032930", "GO:0090322", "GO:0032928" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005576", "GO:0005615" ]
[ "IPR039809", "IPR001089", "IPR001811", "IPR033899", "IPR036048" ]
af_db/AF-A0A060WT98-F1-model_v4.cif.gz
8022.A0A060WT98
[ "8022.A0A060VUU9", "8022.A0A060Y0D9", "8022.A0A060X5F3", "8022.A0A060WB80", "8022.A0A060W8I0", "8022.A0A060WDY2", "8022.A0A060X035", "8022.A0A060VW55", "8022.A0A060WQ51", "8022.Q64IC2", "8022.A0A060XGQ8", "8022.A0A060YWY6", "8022.A0A061A7B1", "8022.A0A060WZ17", "8022.A0A060XGI5", "8022.A0A060Z5E6", "8022.A0A060XPJ4", "8022.A0A060WNJ9", "8022.A0A060ZH67", "8022.A0A060YC27", "8022.A0A060VVA1", "8022.A4F345", "8022.A0A060WU43", "8022.A0A060WYC1", "8022.Q1G669", "8022.H1ZZ93", "8022.A0A060WFM4", "8022.A0A060VTH0", "8022.A0A060VSL8", "8022.A0A060Y097", "8022.A0A060XL04", "8022.A0A060YGE9", "8022.H1ZZ96", "8022.A0A060XKD8", "8022.A0A060XE26", "8022.A0A060YA11", "8022.A0A060VY72", "8022.A0A060W3U5", "8022.A0A061A6H0", "8022.A0A060WPR8", "8022.A0A060XF12", "8022.A0A060VPX8", "8022.A0A060WVB6", "8022.A0A060YAX3", "8022.A0A060XTS9", "8022.A0A060Y1V5", "8022.A0A060YXH5", "8022.A0A060YBB6", "8022.A0A060VQU0", "8022.A0A060XBF3", "8022.A0A060VZ13", "8022.A0A060YQ42", "8022.A0A060X2E2", "8022.A0A060XZ47", "8022.A0A060XW82", "8022.A0A060WCR4", "8022.A0A060Y453", "8022.A0A060YBG9" ]
[ { "protein2": "8022.A0A060VUU9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 506, "database": 736, "textmining": 136, "combined_score": 888 }, { "protein2": "8022.A0A060Y0D9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 419, "textmining": 246, "combined_score": 718 }, { "protein2": "8022.A0A060X5F3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 0, "database": 827, "textmining": 318, "combined_score": 878 }, { "protein2": "8022.A0A060WB80", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 0, "database": 614, "textmining": 338, "combined_score": 739 }, { "protein2": "8022.A0A060W8I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 44, "experimental": 0, "database": 832, "textmining": 148, "combined_score": 851 }, { "protein2": "8022.A0A060WDY2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 816, "textmining": 73, "combined_score": 825 }, { "protein2": "8022.A0A060X035", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 826, "textmining": 48, "combined_score": 832 }, { "protein2": "8022.A0A060VW55", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 789, "textmining": 87, "combined_score": 799 }, { "protein2": "8022.A0A060WQ51", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 179, "database": 831, "textmining": 493, "combined_score": 925 }, { "protein2": "8022.Q64IC2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 419, "textmining": 274, "combined_score": 729 }, { "protein2": "8022.A0A060XGQ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 104, "experimental": 932, "database": 609, "textmining": 375, "combined_score": 983 }, { "protein2": "8022.A0A060YWY6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 506, "database": 736, "textmining": 136, "combined_score": 888 }, { "protein2": "8022.A0A061A7B1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 506, "database": 736, "textmining": 136, "combined_score": 888 }, { "protein2": "8022.A0A060WZ17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 758, "database": 736, "textmining": 183, "combined_score": 948 }, { "protein2": "8022.A0A060XGI5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 825, "textmining": 74, "combined_score": 855 }, { "protein2": "8022.A0A060Z5E6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 419, "textmining": 220, "combined_score": 709 }, { "protein2": "8022.A0A060XPJ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 789, "textmining": 87, "combined_score": 799 }, { "protein2": "8022.A0A060WNJ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 115, "combined_score": 840 }, { "protein2": "8022.A0A060ZH67", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 87, "combined_score": 766 }, { "protein2": "8022.A0A060YC27", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 805, "textmining": 48, "combined_score": 811 }, { "protein2": "8022.A0A060VVA1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 785, "textmining": 74, "combined_score": 822 }, { "protein2": "8022.A4F345", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 308, "combined_score": 873 }, { "protein2": "8022.A0A060WU43", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 87, "combined_score": 766 }, { "protein2": "8022.A0A060WYC1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 826, "textmining": 48, "combined_score": 832 }, { "protein2": "8022.Q1G669", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 255, "experimental": 918, "database": 832, "textmining": 453, "combined_score": 993 }, { "protein2": "8022.H1ZZ93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 104, "experimental": 932, "database": 609, "textmining": 375, "combined_score": 983 }, { "protein2": "8022.A0A060WFM4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 789, "textmining": 87, "combined_score": 799 }, { "protein2": "8022.A0A060VTH0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 893, "database": 0, "textmining": 177, "combined_score": 908 }, { "protein2": "8022.A0A060VSL8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 0, "database": 827, "textmining": 389, "combined_score": 893 }, { "protein2": "8022.A0A060Y097", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 419, "textmining": 246, "combined_score": 718 }, { "protein2": "8022.A0A060XL04", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 439, "textmining": 297, "combined_score": 746 }, { "protein2": "8022.A0A060YGE9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 87, "combined_score": 766 }, { "protein2": "8022.H1ZZ96", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 893, "database": 0, "textmining": 177, "combined_score": 908 }, { "protein2": "8022.A0A060XKD8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 233, "database": 736, "textmining": 125, "combined_score": 807 }, { "protein2": "8022.A0A060XE26", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 789, "textmining": 87, "combined_score": 799 }, { "protein2": "8022.A0A060YA11", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 439, "textmining": 220, "combined_score": 719 }, { "protein2": "8022.A0A060VY72", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 805, "textmining": 48, "combined_score": 811 }, { "protein2": "8022.A0A060W3U5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 827, "textmining": 111, "combined_score": 841 }, { "protein2": "8022.A0A061A6H0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 506, "database": 736, "textmining": 136, "combined_score": 888 }, { "protein2": "8022.A0A060WPR8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 43, "experimental": 0, "database": 826, "textmining": 59, "combined_score": 829 }, { "protein2": "8022.A0A060XF12", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 87, "combined_score": 824 }, { "protein2": "8022.A0A060VPX8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 179, "database": 827, "textmining": 429, "combined_score": 913 }, { "protein2": "8022.A0A060WVB6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 932, "database": 736, "textmining": 186, "combined_score": 985 }, { "protein2": "8022.A0A060YAX3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 825, "textmining": 74, "combined_score": 855 }, { "protein2": "8022.A0A060XTS9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 785, "textmining": 74, "combined_score": 822 }, { "protein2": "8022.A0A060Y1V5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 179, "database": 827, "textmining": 429, "combined_score": 913 }, { "protein2": "8022.A0A060YXH5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 179, "database": 827, "textmining": 422, "combined_score": 912 }, { "protein2": "8022.A0A060YBB6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 702, "database": 419, "textmining": 220, "combined_score": 857 }, { "protein2": "8022.A0A060VQU0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 0, "database": 827, "textmining": 389, "combined_score": 893 }, { "protein2": "8022.A0A060XBF3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 827, "textmining": 111, "combined_score": 841 }, { "protein2": "8022.A0A060VZ13", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 0, "database": 827, "textmining": 126, "combined_score": 844 }, { "protein2": "8022.A0A060YQ42", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 816, "textmining": 75, "combined_score": 825 }, { "protein2": "8022.A0A060X2E2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 115, "combined_score": 840 }, { "protein2": "8022.A0A060XZ47", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 825, "textmining": 74, "combined_score": 855 }, { "protein2": "8022.A0A060XW82", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 43, "experimental": 0, "database": 826, "textmining": 59, "combined_score": 829 }, { "protein2": "8022.A0A060WCR4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 0, "database": 827, "textmining": 318, "combined_score": 878 }, { "protein2": "8022.A0A060Y453", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 233, "database": 736, "textmining": 125, "combined_score": 807 }, { "protein2": "8022.A0A060YBG9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 0, "database": 827, "textmining": 126, "combined_score": 844 } ]
A0A060Y8H0
Fructose-1,6-bisphosphatase 1 (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 1) (Liver FBPase)
Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations, acting as a rate-limiting enzyme in gluconeogenesis. Plays a role in regulating glucose sensing and insulin secretion of pancreatic beta-cells. Appears to modulate glycerol gluconeogenesis in liver. Important regulator of appetite and adiposity; increased expression of the protein in liver after nutrient excess increases circulating satiety hormones and reduces appetite-stimulating neuropeptides and thus seems to provide a feedback mechanism to limit weight gain. {ECO:0000256|ARBA:ARBA00037308}.
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
337
null
MSDRGSFDTNVVTLTRFVLEEGRKAKGTGELTTLLNSICTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDVLSNDLVINMIKSSFTSCVLVSEEDERALIVEPEKQGKYIVCFDPLDGSSNIDCLVSIGTIFAIYRKTTDDEPNEKDALQSGRHIVAAGYALYGSATMMVLSTGQGVNCFMLDPSIGEFILTDKDVKIKKRGKIYSLNEGYAQHFYPDVTEYLKKKKYPEDGSAPYGGRYVGSMVADVHRTLVYGGIFLYPANVKSPKGKLRLLYECNPMSFIIEQAGGMATTGEMNVLDIQPENIHQRVPVVLGSPEDVQEYIAIYKKTRM
[ "GO:0050896", "GO:0009743", "GO:0010033", "GO:1901700", "GO:0034284", "GO:0009749", "GO:0008150", "GO:0042221", "GO:0009746", "GO:0019203", "GO:0042578", "GO:0042132", "GO:0003824", "GO:0016788", "GO:0003674", "GO:0016791", "GO:0050308", "GO:0016787" ]
[ "GO:0008150", "GO:0050896", "GO:0042221", "GO:0010033", "GO:1901700", "GO:0009743", "GO:0034284", "GO:0009746", "GO:0009749" ]
[ "GO:0003674", "GO:0003824", "GO:0016787", "GO:0016788", "GO:0042578", "GO:0016791", "GO:0019203", "GO:0050308", "GO:0042132" ]
null
[ "IPR044015", "IPR000146", "IPR033391", "IPR028343", "IPR020548" ]
af_db/AF-A0A060Y8H0-F1-model_v4.cif.gz
8022.A0A060Y8H0
[ "8022.A0A060WUD2", "8022.A0A060Z1V4", "8022.A0A060WKL9", "8022.A0A060YVQ1", "8022.A0A060WN66", "8022.A0A060X451", "8022.A0A060Z1R4", "8022.A0A060W1Q7", "8022.A0A060YVM5", "8022.A0A060WTE4", "8022.A0A060XV20", "8022.A0A060Z9H8", "8022.A0A060Y149", "8022.A0A060XRV8", "8022.A0A060VNK8", "8022.A0A060XPQ5", "8022.A0A060Z2V0", "8022.A0A060Z5H7", "8022.A0A060VPR7", "8022.A0A060VMK2", "8022.A0A060YHN8", "8022.A0A060WHT6", "8022.A0A060WEA8", "8022.A0A060X554", "8022.A0A060WTT7", "8022.A0A060XDI7", "8022.A0A060Z2Q3", "8022.A0A060VNR1", "8022.A0A060Y572", "8022.A0A060XQD6", "8022.A0A060Y0E2", "8022.A0A060WKY9", "8022.A0A060VU68", "8022.A0A060Y5A1", "8022.A0A060Z8Y1", "8022.A0A060XH89", "8022.A0A060WBE2", "8022.A0A060YAU7", "8022.A0A060W078", "8022.A0A060VXB7", "8022.A0A060VVS9", "8022.A0A060XXJ7", "8022.A0A060VPT7", "8022.A0A060VTT5", "8022.A0A060VW41", "8022.A0A060YIV6", "8022.A0A060Z666", "8022.A0A060X0C8", "8022.A0A060XP04", "8022.A0A060YAR4", "8022.A0A060VZM1", "8022.A0A060YS35", "8022.A0A060Y974", "8022.A0A060Y6E6", "8022.A0A060XD08", "8022.A0A060X6L1", "8022.A0A060X6R6", "8022.A0A060XIP8", "8022.A0A060Y2F6", "8022.A0A060XFI2", "8022.A0A060YAI9", "8022.A0A060WDZ2", "8022.A0A060WWX4", "8022.A0A060VUG3", "8022.A0A060YIC2", "8022.A0A060YDE0", "8022.A0A060X7X1", "8022.A0A060Z098", "8022.A0A060XE19", "8022.A0A060YQT4", "8022.A0A060WET7", "8022.A0A060XQL0", "8022.A0A060Z973", "8022.A0A060Z8F9", "8022.A0A060Y6U5", "8022.A0A060YW82", "8022.A0A060YYC4", "8022.A0A060XHN5", "8022.A0A060WN41", "8022.A0A060WAF6", "8022.A0A060WBT3", "8022.A0A060WHB9", "8022.A0A060VVL9", "8022.A0A060X8A4", "8022.A0A060WPX1", "8022.A0A060X816", "8022.A0A060WVQ0", "8022.A0A060X6V3", "8022.A0A060ZPA8", "8022.A0A060VVZ9", "8022.A0A060Y9T0", "8022.A0A060VXR5", "8022.A0A060X1J6", "8022.A0A060X807", "8022.A0A060XVB1", "8022.A0A060YK26", "8022.A0A060YGA7", "8022.A0A060YKK6", "8022.A0A060W458", "8022.A0A060XBK0", "8022.A0A060YV08", "8022.A0A060W0T4", "8022.A0A060XEX5", "8022.A0A060XY35", "8022.A0A060VZK5", "8022.A0A060WV84", "8022.A0A060XTV2", "8022.A0A060Y7I6", "8022.A0A060X2I1", "8022.A0A060W147", "8022.A0A060XFS1", "8022.A0A060XZ30", "8022.A0A060YFA3", "8022.A0A060ZB08", "8022.A0A060ZAC2", "8022.A0A060Y3Q3", "8022.A0A060WUI1", "8022.A0A060YLD3", "8022.A0A060WBZ8", "8022.A0A060X1D5", "8022.A0A060W2P0", "8022.A0A060X567", "8022.A0A060YEC4", "8022.A0A060XB28", "8022.A0A060X323", "8022.A0A060VVE5", "8022.A0A060VYV2", "8022.A0A060X0T4", "8022.A0A060XEE3", "8022.A0A060Z6C0", "8022.A0A060X7Z0", "8022.A0A060X7A0", "8022.A0A060YTU9", "8022.A0A060YSX6", "8022.A0A060W9M9", "8022.A0A060YVM7", "8022.A0A060YZW8", "8022.A0A060Z7Y7", "8022.A0A060X3G2", "8022.A0A060YBF1", "8022.A0A060XQG3", "8022.A0A060WD05", "8022.A0A060ZEY9", "8022.A0A060YKF3", "8022.A0A060XNA5", "8022.A0A060WZJ0", "8022.A0A060VWF5", "8022.A0A060Y609", "8022.A0A060WDJ5", "8022.A0A060X713", "8022.A0A060W743", "8022.A0A060Y3N4", "8022.A0A060Y1A1", "8022.A0A060WI24", "8022.A0A060WFB8", "8022.A0A060X7J3", "8022.A0A060WV51", "8022.A0A060Z2J6" ]
[ { "protein2": "8022.A0A060WUD2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 785, "textmining": 0, "combined_score": 787 }, { "protein2": "8022.A0A060Z1V4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 783, "textmining": 199, "combined_score": 818 }, { "protein2": "8022.A0A060WKL9", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060YVQ1", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060WN66", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 785, "textmining": 0, "combined_score": 787 }, { "protein2": "8022.A0A060X451", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 568, "textmining": 411, "combined_score": 738 }, { "protein2": "8022.A0A060Z1R4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 51, "experimental": 0, "database": 736, "textmining": 123, "combined_score": 761 }, { "protein2": "8022.A0A060W1Q7", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 261, "combined_score": 880 }, { "protein2": "8022.A0A060YVM5", "neighborhood": 166, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 841, "textmining": 451, "combined_score": 928 }, { "protein2": "8022.A0A060WTE4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 220, "combined_score": 788 }, { "protein2": "8022.A0A060XV20", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 277, "database": 706, "textmining": 325, "combined_score": 861 }, { "protein2": "8022.A0A060Z9H8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060Y149", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 0, "database": 736, "textmining": 123, "combined_score": 768 }, { "protein2": "8022.A0A060XRV8", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 137, "experimental": 0, "database": 839, "textmining": 379, "combined_score": 907 }, { "protein2": "8022.A0A060VNK8", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 841, "textmining": 261, "combined_score": 891 }, { "protein2": "8022.A0A060XPQ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 715, "database": 0, "textmining": 326, "combined_score": 799 }, { "protein2": "8022.A0A060Z2V0", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 825, "textmining": 186, "combined_score": 856 }, { "protein2": "8022.A0A060Z5H7", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060VPR7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 220, "combined_score": 788 }, { "protein2": "8022.A0A060VMK2", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 862, "textmining": 308, "combined_score": 942 }, { "protein2": "8022.A0A060YHN8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 839, "textmining": 225, "combined_score": 881 }, { "protein2": "8022.A0A060WHT6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 80, "experimental": 0, "database": 670, "textmining": 309, "combined_score": 771 }, { "protein2": "8022.A0A060WEA8", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 137, "experimental": 0, "database": 816, "textmining": 379, "combined_score": 893 }, { "protein2": "8022.A0A060X554", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 568, "textmining": 411, "combined_score": 738 }, { "protein2": "8022.A0A060WTT7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 785, "textmining": 0, "combined_score": 787 }, { "protein2": "8022.A0A060XDI7", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 825, "textmining": 186, "combined_score": 856 }, { "protein2": "8022.A0A060Z2Q3", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060VNR1", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 825, "textmining": 186, "combined_score": 856 }, { "protein2": "8022.A0A060Y572", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 137, "experimental": 0, "database": 839, "textmining": 379, "combined_score": 907 }, { "protein2": "8022.A0A060XQD6", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060Y0E2", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060WKY9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 738, "database": 0, "textmining": 338, "combined_score": 819 }, { "protein2": "8022.A0A060VU68", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 352, "combined_score": 875 }, { "protein2": "8022.A0A060Y5A1", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060Z8Y1", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 839, "textmining": 308, "combined_score": 932 }, { "protein2": "8022.A0A060XH89", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 715, "database": 0, "textmining": 326, "combined_score": 799 }, { "protein2": "8022.A0A060WBE2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 827, "textmining": 275, "combined_score": 879 }, { "protein2": "8022.A0A060YAU7", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 137, "experimental": 0, "database": 839, "textmining": 379, "combined_score": 907 }, { "protein2": "8022.A0A060W078", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 738, "database": 0, "textmining": 338, "combined_score": 819 }, { "protein2": "8022.A0A060VXB7", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 825, "textmining": 186, "combined_score": 856 }, { "protein2": "8022.A0A060VVS9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 783, "textmining": 199, "combined_score": 818 }, { "protein2": "8022.A0A060XXJ7", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 505, "combined_score": 810 }, { "protein2": "8022.A0A060VPT7", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 277, "database": 706, "textmining": 325, "combined_score": 861 }, { "protein2": "8022.A0A060VTT5", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060VW41", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 75, "experimental": 0, "database": 670, "textmining": 378, "combined_score": 793 }, { "protein2": "8022.A0A060YIV6", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 841, "textmining": 261, "combined_score": 891 }, { "protein2": "8022.A0A060Z666", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 816, "textmining": 186, "combined_score": 848 }, { "protein2": "8022.A0A060X0C8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 839, "textmining": 225, "combined_score": 881 }, { "protein2": "8022.A0A060XP04", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 824, "textmining": 186, "combined_score": 855 }, { "protein2": "8022.A0A060YAR4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 75, "experimental": 0, "database": 670, "textmining": 378, "combined_score": 793 }, { "protein2": "8022.A0A060VZM1", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060YS35", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 862, "textmining": 308, "combined_score": 942 }, { "protein2": "8022.A0A060Y974", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 816, "textmining": 186, "combined_score": 848 }, { "protein2": "8022.A0A060Y6E6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 830, "textmining": 44, "combined_score": 830 }, { "protein2": "8022.A0A060XD08", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 839, "textmining": 308, "combined_score": 932 }, { "protein2": "8022.A0A060X6L1", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 568, "textmining": 411, "combined_score": 738 }, { "protein2": "8022.A0A060X6R6", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060XIP8", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060Y2F6", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 277, "database": 706, "textmining": 325, "combined_score": 861 }, { "protein2": "8022.A0A060XFI2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 155, "database": 816, "textmining": 0, "combined_score": 837 }, { "protein2": "8022.A0A060YAI9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 746, "database": 0, "textmining": 309, "combined_score": 816 }, { "protein2": "8022.A0A060WDZ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 352, "combined_score": 875 }, { "protein2": "8022.A0A060WWX4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 80, "experimental": 0, "database": 670, "textmining": 309, "combined_score": 771 }, { "protein2": "8022.A0A060VUG3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 352, "combined_score": 875 }, { "protein2": "8022.A0A060YIC2", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 261, "combined_score": 853 }, { "protein2": "8022.A0A060YDE0", "neighborhood": 175, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 0, "database": 830, "textmining": 505, "combined_score": 931 }, { "protein2": "8022.A0A060X7X1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 841, "textmining": 225, "combined_score": 883 }, { "protein2": "8022.A0A060Z098", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060XE19", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 839, "textmining": 225, "combined_score": 881 }, { "protein2": "8022.A0A060YQT4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 51, "experimental": 0, "database": 736, "textmining": 123, "combined_score": 761 }, { "protein2": "8022.A0A060WET7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 153, "database": 829, "textmining": 0, "combined_score": 848 }, { "protein2": "8022.A0A060XQL0", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 256, "database": 556, "textmining": 279, "combined_score": 751 }, { "protein2": "8022.A0A060Z973", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 785, "textmining": 0, "combined_score": 787 }, { "protein2": "8022.A0A060Z8F9", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 841, "textmining": 308, "combined_score": 933 }, { "protein2": "8022.A0A060Y6U5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 830, "textmining": 0, "combined_score": 845 }, { "protein2": "8022.A0A060YW82", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 90, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 720 }, { "protein2": "8022.A0A060YYC4", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 816, "textmining": 186, "combined_score": 848 }, { "protein2": "8022.A0A060XHN5", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 772, "textmining": 276, "combined_score": 874 }, { "protein2": "8022.A0A060WN41", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 836, "textmining": 225, "combined_score": 879 }, { "protein2": "8022.A0A060WAF6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060WBT3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 155, "database": 816, "textmining": 0, "combined_score": 837 }, { "protein2": "8022.A0A060WHB9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 839, "textmining": 225, "combined_score": 881 }, { "protein2": "8022.A0A060VVL9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 783, "textmining": 199, "combined_score": 818 }, { "protein2": "8022.A0A060X8A4", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060WPX1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 665, "database": 0, "textmining": 309, "combined_score": 758 }, { "protein2": "8022.A0A060X816", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060WVQ0", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 827, "textmining": 276, "combined_score": 904 }, { "protein2": "8022.A0A060X6V3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 841, "textmining": 225, "combined_score": 883 }, { "protein2": "8022.A0A060ZPA8", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060VVZ9", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 772, "textmining": 276, "combined_score": 874 }, { "protein2": "8022.A0A060Y9T0", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 816, "textmining": 186, "combined_score": 848 }, { "protein2": "8022.A0A060VXR5", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060X1J6", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060X807", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 746, "database": 0, "textmining": 309, "combined_score": 816 }, { "protein2": "8022.A0A060XVB1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060YK26", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060YGA7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 785, "textmining": 0, "combined_score": 787 }, { "protein2": "8022.A0A060YKK6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 779, "textmining": 391, "combined_score": 861 }, { "protein2": "8022.A0A060W458", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 256, "database": 556, "textmining": 279, "combined_score": 751 }, { "protein2": "8022.A0A060XBK0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060YV08", "neighborhood": 166, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 841, "textmining": 451, "combined_score": 928 }, { "protein2": "8022.A0A060W0T4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060XEX5", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 772, "textmining": 276, "combined_score": 874 }, { "protein2": "8022.A0A060XY35", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 839, "textmining": 308, "combined_score": 932 }, { "protein2": "8022.A0A060VZK5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 783, "textmining": 199, "combined_score": 818 }, { "protein2": "8022.A0A060WV84", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 772, "textmining": 276, "combined_score": 874 }, { "protein2": "8022.A0A060XTV2", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 256, "database": 556, "textmining": 279, "combined_score": 751 }, { "protein2": "8022.A0A060Y7I6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060X2I1", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060W147", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060XFS1", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060XZ30", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 862, "textmining": 261, "combined_score": 906 }, { "protein2": "8022.A0A060YFA3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 0, "database": 736, "textmining": 123, "combined_score": 768 }, { "protein2": "8022.A0A060ZB08", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 825, "textmining": 186, "combined_score": 856 }, { "protein2": "8022.A0A060ZAC2", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 841, "textmining": 308, "combined_score": 933 }, { "protein2": "8022.A0A060Y3Q3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 665, "database": 0, "textmining": 309, "combined_score": 758 }, { "protein2": "8022.A0A060WUI1", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 824, "textmining": 276, "combined_score": 903 }, { "protein2": "8022.A0A060YLD3", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 827, "textmining": 276, "combined_score": 904 }, { "protein2": "8022.A0A060WBZ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 862, "textmining": 225, "combined_score": 898 }, { "protein2": "8022.A0A060X1D5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 839, "textmining": 225, "combined_score": 881 }, { "protein2": "8022.A0A060W2P0", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060X567", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 825, "textmining": 186, "combined_score": 856 }, { "protein2": "8022.A0A060YEC4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 665, "database": 0, "textmining": 309, "combined_score": 758 }, { "protein2": "8022.A0A060XB28", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 660, "textmining": 276, "combined_score": 813 }, { "protein2": "8022.A0A060X323", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 277, "database": 706, "textmining": 325, "combined_score": 861 }, { "protein2": "8022.A0A060VVE5", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 824, "textmining": 276, "combined_score": 903 }, { "protein2": "8022.A0A060VYV2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 665, "database": 0, "textmining": 309, "combined_score": 758 }, { "protein2": "8022.A0A060X0T4", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060XEE3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 738, "database": 0, "textmining": 338, "combined_score": 819 }, { "protein2": "8022.A0A060Z6C0", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 261, "combined_score": 880 }, { "protein2": "8022.A0A060X7Z0", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 841, "textmining": 261, "combined_score": 891 }, { "protein2": "8022.A0A060X7A0", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060YTU9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 831, "textmining": 0, "combined_score": 832 }, { "protein2": "8022.A0A060YSX6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 155, "database": 816, "textmining": 0, "combined_score": 837 }, { "protein2": "8022.A0A060W9M9", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 261, "combined_score": 880 }, { "protein2": "8022.A0A060YVM7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 220, "combined_score": 788 }, { "protein2": "8022.A0A060YZW8", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 76, "experimental": 0, "database": 652, "textmining": 277, "combined_score": 750 }, { "protein2": "8022.A0A060Z7Y7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 839, "textmining": 225, "combined_score": 881 }, { "protein2": "8022.A0A060X3G2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 80, "experimental": 0, "database": 670, "textmining": 309, "combined_score": 771 }, { "protein2": "8022.A0A060YBF1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 51, "experimental": 0, "database": 736, "textmining": 123, "combined_score": 761 }, { "protein2": "8022.A0A060XQG3", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060WD05", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 827, "textmining": 275, "combined_score": 879 }, { "protein2": "8022.A0A060ZEY9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 0, "database": 736, "textmining": 123, "combined_score": 768 }, { "protein2": "8022.A0A060YKF3", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 261, "combined_score": 853 }, { "protein2": "8022.A0A060XNA5", "neighborhood": 49, "fusion": 0, "cooccurence": 0, "coexpression": 866, "experimental": 0, "database": 0, "textmining": 519, "combined_score": 933 }, { "protein2": "8022.A0A060WZJ0", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 220, "combined_score": 852 }, { "protein2": "8022.A0A060VWF5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 75, "experimental": 0, "database": 670, "textmining": 378, "combined_score": 793 }, { "protein2": "8022.A0A060Y609", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 220, "combined_score": 852 }, { "protein2": "8022.A0A060WDJ5", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 841, "textmining": 261, "combined_score": 891 }, { "protein2": "8022.A0A060X713", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 220, "combined_score": 852 }, { "protein2": "8022.A0A060W743", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 839, "textmining": 366, "combined_score": 893 }, { "protein2": "8022.A0A060Y3N4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060Y1A1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 746, "database": 0, "textmining": 309, "combined_score": 816 }, { "protein2": "8022.A0A060WI24", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 862, "textmining": 261, "combined_score": 906 }, { "protein2": "8022.A0A060WFB8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 832, "textmining": 225, "combined_score": 876 }, { "protein2": "8022.A0A060X7J3", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060WV51", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 836, "textmining": 225, "combined_score": 879 }, { "protein2": "8022.A0A060Z2J6", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 } ]
A0A060YK73
Sodium/potassium-transporting ATPase subunit alpha
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
534
Cell membrane {ECO:0000256|RuleBase:RU362084}; Multi-pass membrane protein {ECO:0000256|RuleBase:RU362084}. Membrane {ECO:0000256|ARBA:ARBA00004370}.
LSIHKNIVAGESNHLLVMKGAPERILDRCSTILIQGKEQTLNDELKEAFQNAYEELGGLGERVLGFCHFQLPDDQFAEGFQFDCEEVNFPTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLKIPVSEVNPRDAKACVVHGGELKDLSAEQLDDILAHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEEAENDIMKRQPRNPKTDKLVNERLISIAYGQIGMMQATAGFFTYFVILAENGFLPMDLLGMRVDWDNKIMNDMEDSYGQQWTYERRKIVEFTCHTAFFASIVVVQWADLIICKTRRNSILQQGMKNRILIFGLFEETALAVFLSYCPGMDVALRMYPLKPCWWFCALPYSLLIFLYDEGRRYILRRNPGGWVEQETYY
[ "GO:0006970", "GO:0043434", "GO:1901652", "GO:0009628", "GO:1901700", "GO:0009651", "GO:0006950", "GO:0008150", "GO:0042538", "GO:0042221", "GO:0010243", "GO:0050896", "GO:1901698", "GO:0010033", "GO:0009725", "GO:0060416", "GO:0009719", "GO:0006972", "GO:0015399", "GO:0008556", "GO:0008554", "GO:0015079", "GO:0140358", "GO:0022890", "GO:0005215", "GO:0015662", "GO:1901702", "GO:0022853", "GO:0042626", "GO:0015075", "GO:0005391", "GO:0022857", "GO:0015318", "GO:0008324", "GO:0140657", "GO:0046873", "GO:0015081", "GO:0003674", "GO:0019829", "GO:0022804" ]
[ "GO:0008150", "GO:0050896", "GO:0009628", "GO:0006950", "GO:0042221", "GO:0009719", "GO:0006970", "GO:1901700", "GO:1901698", "GO:0010033", "GO:0009725", "GO:0043434", "GO:1901652", "GO:0009651", "GO:0010243", "GO:0006972", "GO:0042538", "GO:0060416" ]
[ "GO:0003674", "GO:0005215", "GO:0140657", "GO:0042626", "GO:0022857", "GO:0140358", "GO:1901702", "GO:0015075", "GO:0015318", "GO:0019829", "GO:0022804", "GO:0015399", "GO:0008556", "GO:0008554", "GO:0015079", "GO:0022890", "GO:0015662", "GO:0022853", "GO:0008324", "GO:0015081", "GO:0005391", "GO:0046873" ]
null
[ "IPR006068", "IPR023299", "IPR023298", "IPR050510", "IPR036412", "IPR023214", "IPR005775", "IPR001757" ]
af_db/AF-A0A060YK73-F1-model_v4.cif.gz
8022.A0A060YK73
[ "8022.A0A060XCM7", "8022.A0A060ZIV0", "8022.A0A060YFB0", "8022.A0A060XM52", "8022.A0A060YI40", "8022.A0A060VYP9", "8022.A0A060YEQ6", "8022.A0A060WZD8", "8022.A0A060VMX9", "8022.A0A060Z7D4", "8022.A0A060YU43", "8022.A0A060ZAX9", "8022.A0A060VV08", "8022.A0A060XUR5", "8022.A0A060W616", "8022.A0A060Z8B0", "8022.A0A060YXW3", "8022.A0A060XAY3", "8022.A0A060WM21", "8022.A0A060W5G5", "8022.A0A060XKC6", "8022.A0A060X014", "8022.A0A060Z640", "8022.A0A060Y7Y8", "8022.A0A060YM41", "8022.A0A060ZL40", "8022.A0A060YJV3", "8022.A0A060Y1F8", "8022.A0A060YYE6", "8022.A0A060XVJ2", "8022.A0A060VTX4", "8022.A0A060Z2N8", "8022.A0A061AEV5", "8022.A0A060WA02" ]
[ { "protein2": "8022.A0A060XCM7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 788, "textmining": 156, "combined_score": 907 }, { "protein2": "8022.A0A060ZIV0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 681, "database": 569, "textmining": 144, "combined_score": 876 }, { "protein2": "8022.A0A060YFB0", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A060XM52", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060YI40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 750 }, { "protein2": "8022.A0A060VYP9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 614, "database": 510, "textmining": 198, "combined_score": 835 }, { "protein2": "8022.A0A060YEQ6", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A060WZD8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 660, "database": 451, "textmining": 88, "combined_score": 814 }, { "protein2": "8022.A0A060VMX9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 574, "textmining": 120, "combined_score": 807 }, { "protein2": "8022.A0A060Z7D4", "neighborhood": 0, "fusion": 0, "cooccurence": 535, "coexpression": 0, "experimental": 0, "database": 586, "textmining": 0, "combined_score": 799 }, { "protein2": "8022.A0A060YU43", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060ZAX9", "neighborhood": 0, "fusion": 0, "cooccurence": 533, "coexpression": 0, "experimental": 0, "database": 530, "textmining": 0, "combined_score": 771 }, { "protein2": "8022.A0A060VV08", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 783, "textmining": 86, "combined_score": 795 }, { "protein2": "8022.A0A060XUR5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060W616", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 574, "textmining": 108, "combined_score": 804 }, { "protein2": "8022.A0A060Z8B0", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A060YXW3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060XAY3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 719, "textmining": 99, "combined_score": 869 }, { "protein2": "8022.A0A060WM21", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 574, "textmining": 108, "combined_score": 804 }, { "protein2": "8022.A0A060W5G5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 574, "textmining": 108, "combined_score": 804 }, { "protein2": "8022.A0A060XKC6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060X014", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 719, "textmining": 99, "combined_score": 869 }, { "protein2": "8022.A0A060Z640", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060Y7Y8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 699, "database": 671, "textmining": 178, "combined_score": 913 }, { "protein2": "8022.A0A060YM41", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A060ZL40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 681, "database": 569, "textmining": 144, "combined_score": 876 }, { "protein2": "8022.A0A060YJV3", "neighborhood": 0, "fusion": 0, "cooccurence": 533, "coexpression": 0, "experimental": 0, "database": 530, "textmining": 0, "combined_score": 771 }, { "protein2": "8022.A0A060Y1F8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 750 }, { "protein2": "8022.A0A060YYE6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 699, "database": 671, "textmining": 178, "combined_score": 913 }, { "protein2": "8022.A0A060XVJ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 783, "textmining": 86, "combined_score": 795 }, { "protein2": "8022.A0A060VTX4", "neighborhood": 0, "fusion": 0, "cooccurence": 536, "coexpression": 0, "experimental": 0, "database": 530, "textmining": 0, "combined_score": 772 }, { "protein2": "8022.A0A060Z2N8", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A061AEV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 699, "database": 671, "textmining": 178, "combined_score": 913 }, { "protein2": "8022.A0A060WA02", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 764, "textmining": 86, "combined_score": 777 } ]
A0A060VZM9
RNA helicase (EC 3.6.4.13)
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
1,026
Cytoplasm {ECO:0000256|ARBA:ARBA00004496}.
MAADKDNTTNISLIEDFRPRLRKLIEIEFVLDHLNFLDNDNKDLIRTKARKESNLKAVDLLIDTIIRIRPLPKGWFREFVDALSAGGCKHAATYVEDSPPCPALEAENDNCVRLIELLSPRLLGMKTTDVCWDCFSKGILTAEDREIILAECQNRGNMGGARELLRRIVRFPPGWFSTFLKALQVTEHNDLCKELTGESPGDNLIDEPGVLMAVNEAPGNVDPMVEEGPVEAAGKSFLPEQETLDSSVTSMHLDEPSEADSEIADLYSGTEEPMENGKPENSLDLSMSGCIAPAAESPPKAVIVLRDYQMDVARPALEGKNIIICLPTGSGKTRVAVYITKEHLDSRRKEGRPGKVVVLVNKVPLVEQHYSTEFWKFLKNKYKVERVSGDSQLKISFTDIVQKNDIVICTAQLLENYLERAHSGDDDGIKLSDLSLIVIDECHHTQKGGVYNHIMIRYLKQKHKNAKLKKEQKDTVAIPQILGLTASPGVGGAKKIEKAEEHILRICANLDAYKIMTGNLGENKKEPHKKIATAEERKRDVDFHEIIYIYIILMCKCIYVLTSDPFGDVLKGVMNAIHIHAELNPTCDLGTQNYEQWVVQKEQNAAKEENQKVRVCAEHLRQYNEALYLGKTIRMWDAFSFLDKYFDEELKKKVAPEDEEAIIKTDTERFLFTLFKDSKVKLQELAKLPQYENNSLAKLRTKILHEFTSREKARGIIFTKTRRSAIALAQWVQENSKFEEVGVKACHVIGGGGQSVVKPMTAAEQRDVLNKFQNAEINLLIATTVAEEGLDIAACNFVIRYELVTNEIAMIQARGRGRAEDSSYTLVAGEGSGVAERESVNEYREKMMSKAIDKVKKLDQEEYEKRIKEFQIQAIMEERVRTTKKKQKGMKKESPSKVKFSCRSCNKPVCSGEDVEIIENMHRVNVTPQFKELFIQRENTSLVKRLLDYESNGFIACKDCGQRWGSMMLYRGIECPCLHVKNFLVTYDEKRKNVNKWSELGIQLPAFDYAEHARSVAESSEDEESM
[ "GO:0006952", "GO:0009605", "GO:0043331", "GO:0002376", "GO:0006950", "GO:0008150", "GO:0042221", "GO:0014070", "GO:0043207", "GO:0043330", "GO:0050896", "GO:1901698", "GO:0010033", "GO:0051707", "GO:0045087", "GO:0006955", "GO:0009607", "GO:0098542", "GO:1902615", "GO:0044419", "GO:0110165", "GO:0005737", "GO:0005575", "GO:0005622", "GO:0003676", "GO:0097159", "GO:1901363", "GO:0005488", "GO:0003674", "GO:0003723", "GO:0003725" ]
[ "GO:0008150", "GO:0002376", "GO:0050896", "GO:0044419", "GO:0009605", "GO:0006950", "GO:0042221", "GO:0051707", "GO:0006955", "GO:0009607", "GO:0006952", "GO:0043207", "GO:1901698", "GO:0010033", "GO:0045087", "GO:0098542", "GO:1902615", "GO:0043331", "GO:0014070", "GO:0043330" ]
[ "GO:0003674", "GO:0005488", "GO:0097159", "GO:1901363", "GO:0003676", "GO:0003723", "GO:0003725" ]
[ "GO:0005575", "GO:0110165", "GO:0005737", "GO:0005622" ]
[ "IPR031964", "IPR011545", "IPR011029", "IPR014001", "IPR001650", "IPR027417", "IPR041204", "IPR038557", "IPR021673", "IPR051363" ]
af_db/AF-A0A060VZM9-F1-model_v4.cif.gz
8022.A0A060VZM9
[ "8022.A0A060WEB4", "8022.A0A060YTZ8", "8022.A0A060X6Z6", "8022.A0A060YN46", "8022.A0A060WQG6", "8022.A0A060XL84", "8022.A0A060WW34", "8022.A0A060WH56", "8022.A0A060W4N0", "8022.A0A060YLC4", "8022.A0A060YC09", "8022.A0A060ZBM2", "8022.A0A060YK39", "8022.A0A060XY19", "8022.A0A060XJI1", "8022.A0A060XJ85", "8022.A0A060YP86", "8022.A0A060WKG7", "8022.A0A060X8M8", "8022.A0A060XMA3", "8022.A0A060Y891", "8022.A0A060YNY0", "8022.A0A060XLY4", "8022.A0A060YZ88", "8022.A0A060YGR3", "8022.A0A060YJZ6", "8022.A0A060YE44", "8022.A0A060YZ26", "8022.A0A060XZL1", "8022.A0A060W248", "8022.A0A060Y144", "8022.A0A060WAI5", "8022.A0A060XUZ1", "8022.A0A060VRW6", "8022.A0A060XTY3", "8022.A0A060Z5H7", "8022.A0A060XK45", "8022.A0A060ZHX0", "8022.A0A060X8B3", "8022.A0A060YN99", "8022.A0A060VW80", "8022.C1BFG2", "8022.A0A060Z1S1", "8022.A0A060XWW5", "8022.A0A060VWJ9", "8022.A0A060WP82", "8022.A0A060XEU9", "8022.A0A060WAB8", "8022.A0A060W266", "8022.A0A060WZ23", "8022.A0A060WI08", "8022.A0A060X6C4", "8022.A0A060WKE3", "8022.A0A060Z4D1", "8022.A0A060YYM9", "8022.A0A060YRP9", "8022.A0A060YM65", "8022.C1BG62", "8022.A0A060WKE6", "8022.A0A060W7K8", "8022.A0A060WS77", "8022.A0A060Z3T6", "8022.A0A060XDQ4", "8022.A0A060X2R7", "8022.A0A060WT92", "8022.A0A060YNG8", "8022.A0A060WD36", "8022.A0A060Z655", "8022.A0A060XRR2", "8022.A0A060Z6F4", "8022.A0A060WA73", "8022.A0A060Y1N8", "8022.A0A060W5A5", "8022.A0A060Z4W8", "8022.A0A060XI12", "8022.A0A060X6S5", "8022.A0A060YMR9", "8022.A0A061AEY4", "8022.A0A060X5I3", "8022.A0A060Z000", "8022.A0A060XDM2", "8022.A0A060ZBY8", "8022.A0A060WG92", "8022.A0A060XXI9", "8022.A0A060X3S8", "8022.A0A060W8A7", "8022.A0A060W6R9", "8022.A0A060XW94", "8022.A0A060YRF9", "8022.A0A060YGN0", "8022.A0A060Y5Y0", "8022.A0A060XTX7", "8022.A0A060WZW0", "8022.A0A060WK21", "8022.A0A060VPV4", "8022.A0A060Y4K2", "8022.A0A060YEJ5", "8022.A0A060X2B7", "8022.A0A060X4G8", "8022.A0A060Y135", "8022.A0A060XER0", "8022.A0A060WP39", "8022.A0A060WVN0", "8022.A0A060YX92", "8022.A0A060Y6S6", "8022.A0A060WGE5", "8022.A0A060XVP1", "8022.A0A060XZH1", "8022.A0A060XJT9", "8022.A0A060ZEW9", "8022.A0A060ZA43", "8022.A0A060WHG0", "8022.A0A060XYH4", "8022.A0A060YDE8", "8022.A0A060WQX1", "8022.A0A060XX03", "8022.A0A060Y7H3", "8022.C1BI16", "8022.A0A060Y1E2", "8022.A0A060ZXZ7", "8022.A0A060XU58", "8022.A0A060Z320", "8022.A0A060Y9V2", "8022.A0A060X606", "8022.A0A060YFT4", "8022.A0A060YQV1", "8022.A0A060XV19", "8022.A0A060X2J9", "8022.A0A060X656", "8022.A0A060X4P6", "8022.A0A060W7E9", "8022.A0A060WAH7", "8022.A0A060XRZ7", "8022.A0A060Z0R5", "8022.A0A060Z173", "8022.A0A060Z4S6", "8022.A0A060W1P0", "8022.A0A060ZDZ5", "8022.A0A060WW06", "8022.A0A060XVQ5", "8022.A0A060X2M8", "8022.A0A060W9W8", "8022.A0A060W9X0", "8022.A0A060WKD2", "8022.A0A060XBU0", "8022.A0A060YIJ3", "8022.A0A060X729", "8022.A0A060W716", "8022.A0A060XYU5", "8022.A0A060XB77", "8022.C1BG84", "8022.A0A060X0Z8", "8022.A0A060YE39", "8022.A0A060YTZ5", "8022.A0A060YDW3", "8022.A0A060X0A0", "8022.A0A060Z6E8", "8022.A0A060YEB0", "8022.A0A060VWD5", "8022.A0A060XXY8", "8022.A0A060XNR8", "8022.A0A060XGN6", "8022.A0A060WAD4", "8022.A0A060XXJ1", "8022.A0A060Z3S0", "8022.A0A060YJ69", "8022.A0A060VXY4", "8022.A0A060YH96", "8022.A0A060YHX9", "8022.A0A060WM17", "8022.A0A060YI26", "8022.A0A060WGY3", "8022.A0A060YHA2", "8022.C1BHI8", "8022.A0A060YT06", "8022.A0A060ZEB5", "8022.A0A060WF04", "8022.A0A060W5V1", "8022.A0A060WRH2", "8022.A0A060VU69", "8022.A0A060YW55", "8022.A0A060XUU8", "8022.A0A060YW05", "8022.A0A060XSK5", "8022.A0A060XPT1", "8022.A0A060YST3", "8022.A0A060XNV6", "8022.A0A060YQF1", "8022.A0A060XFH7", "8022.A0A060Y0H6", "8022.A0A060ZAM3", "8022.A0A060WFX5", "8022.A0A060WE07", "8022.A0A060Y4Q1", "8022.A0A060Z819", "8022.A0A060XPN1", "8022.A0A060W1U5", "8022.A0A060Z041", "8022.A0A060X8S8", "8022.A0A060WZ94", "8022.A0A060WKV9", "8022.A0A060ZQU3", "8022.A0A060Y3B2", "8022.A0A060XX02", "8022.A0A060WC46", "8022.A0A060WJD4", "8022.A0A060XCS7", "8022.A0A060YNT6", "8022.A0A060Z3Y6", "8022.A0A060YCF8", "8022.A0A060WLM0", "8022.Q9PT09", "8022.A0A060WMT5", "8022.A0A060XWU6", "8022.A0A060Z5B4", "8022.A0A060XC88", "8022.A0A060WAH4", "8022.A0A060VZX4", "8022.A0A060YR45", "8022.A0A060XTB8", "8022.A0A060YHT0", "8022.A0A060WA29", "8022.A0A060Y5B1", "8022.A0A060WIG3" ]
[ { "protein2": "8022.A0A060WEB4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 669, "database": 774, "textmining": 388, "combined_score": 950 }, { "protein2": "8022.A0A060YTZ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 600, "experimental": 0, "database": 0, "textmining": 351, "combined_score": 729 }, { "protein2": "8022.A0A060X6Z6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 792, "experimental": 158, "database": 0, "textmining": 133, "combined_score": 834 }, { "protein2": "8022.A0A060YN46", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 75, "experimental": 215, "database": 299, "textmining": 510, "combined_score": 717 }, { "protein2": "8022.A0A060WQG6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 758 }, { "protein2": "8022.A0A060XL84", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 673, "database": 754, "textmining": 52, "combined_score": 917 }, { "protein2": "8022.A0A060WW34", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 }, { "protein2": "8022.A0A060WH56", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 747, "database": 824, "textmining": 420, "combined_score": 971 }, { "protein2": "8022.A0A060W4N0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 839, "experimental": 0, "database": 0, "textmining": 376, "combined_score": 895 }, { "protein2": "8022.A0A060YLC4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 450, "combined_score": 937 }, { "protein2": "8022.A0A060YC09", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 148, "experimental": 184, "database": 583, "textmining": 110, "combined_score": 707 }, { "protein2": "8022.A0A060ZBM2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 178, "database": 785, "textmining": 387, "combined_score": 884 }, { "protein2": "8022.A0A060YK39", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 616, "database": 721, "textmining": 208, "combined_score": 907 }, { "protein2": "8022.A0A060XY19", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 669, "database": 774, "textmining": 388, "combined_score": 950 }, { "protein2": "8022.A0A060XJI1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 675, "database": 785, "textmining": 230, "combined_score": 941 }, { "protein2": "8022.A0A060XJ85", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 690, "database": 547, "textmining": 238, "combined_score": 895 }, { "protein2": "8022.A0A060YP86", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060WKG7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 673, "database": 754, "textmining": 52, "combined_score": 917 }, { "protein2": "8022.A0A060X8M8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 360, "database": 433, "textmining": 400, "combined_score": 766 }, { "protein2": "8022.A0A060XMA3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060Y891", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 180, "database": 772, "textmining": 234, "combined_score": 844 }, { "protein2": "8022.A0A060YNY0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060XLY4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 812, "database": 829, "textmining": 337, "combined_score": 976 }, { "protein2": "8022.A0A060YZ88", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060YGR3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 0, "textmining": 373, "combined_score": 706 }, { "protein2": "8022.A0A060YJZ6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 115, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 770 }, { "protein2": "8022.A0A060YE44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 812, "experimental": 158, "database": 0, "textmining": 89, "combined_score": 843 }, { "protein2": "8022.A0A060YZ26", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 109, "combined_score": 747 }, { "protein2": "8022.A0A060XZL1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 180, "database": 772, "textmining": 234, "combined_score": 844 }, { "protein2": "8022.A0A060W248", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 375, "experimental": 0, "database": 330, "textmining": 450, "combined_score": 749 }, { "protein2": "8022.A0A060Y144", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 706, "experimental": 158, "database": 0, "textmining": 128, "combined_score": 765 }, { "protein2": "8022.A0A060WAI5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 167, "database": 736, "textmining": 121, "combined_score": 789 }, { "protein2": "8022.A0A060XUZ1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 299, "database": 824, "textmining": 0, "combined_score": 871 }, { "protein2": "8022.A0A060VRW6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 172, "database": 593, "textmining": 389, "combined_score": 776 }, { "protein2": "8022.A0A060XTY3", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 199, "experimental": 694, "database": 0, "textmining": 384, "combined_score": 836 }, { "protein2": "8022.A0A060Z5H7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 683, "database": 0, "textmining": 309, "combined_score": 771 }, { "protein2": "8022.A0A060XK45", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 167, "database": 736, "textmining": 121, "combined_score": 789 }, { "protein2": "8022.A0A060ZHX0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 386, "database": 568, "textmining": 398, "combined_score": 831 }, { "protein2": "8022.A0A060X8B3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 170, "experimental": 254, "database": 334, "textmining": 505, "combined_score": 768 }, { "protein2": "8022.A0A060YN99", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 217, "experimental": 326, "database": 0, "textmining": 504, "combined_score": 715 }, { "protein2": "8022.A0A060VW80", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 812, "experimental": 158, "database": 0, "textmining": 89, "combined_score": 843 }, { "protein2": "8022.C1BFG2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 86, "combined_score": 741 }, { "protein2": "8022.A0A060Z1S1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 245, "database": 816, "textmining": 504, "combined_score": 925 }, { "protein2": "8022.A0A060XWW5", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 }, { "protein2": "8022.A0A060VWJ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 109, "combined_score": 747 }, { "protein2": "8022.A0A060WP82", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060XEU9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 170, "experimental": 254, "database": 334, "textmining": 505, "combined_score": 768 }, { "protein2": "8022.A0A060WAB8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 180, "database": 772, "textmining": 317, "combined_score": 861 }, { "protein2": "8022.A0A060W266", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 172, "database": 593, "textmining": 389, "combined_score": 776 }, { "protein2": "8022.A0A060WZ23", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 947, "database": 489, "textmining": 111, "combined_score": 974 }, { "protein2": "8022.A0A060WI08", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 812, "experimental": 158, "database": 0, "textmining": 89, "combined_score": 843 }, { "protein2": "8022.A0A060X6C4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 792, "experimental": 158, "database": 0, "textmining": 133, "combined_score": 834 }, { "protein2": "8022.A0A060WKE3", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 679, "database": 0, "textmining": 279, "combined_score": 763 }, { "protein2": "8022.A0A060Z4D1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 582, "experimental": 166, "database": 347, "textmining": 451, "combined_score": 858 }, { "protein2": "8022.A0A060YYM9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 424, "experimental": 158, "database": 0, "textmining": 454, "combined_score": 712 }, { "protein2": "8022.A0A060YRP9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 690, "database": 547, "textmining": 238, "combined_score": 895 }, { "protein2": "8022.A0A060YM65", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 812, "experimental": 158, "database": 0, "textmining": 89, "combined_score": 843 }, { "protein2": "8022.C1BG62", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 937, "database": 435, "textmining": 0, "combined_score": 962 }, { "protein2": "8022.A0A060WKE6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 837, "experimental": 0, "database": 431, "textmining": 450, "combined_score": 944 }, { "protein2": "8022.A0A060W7K8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 616, "database": 721, "textmining": 208, "combined_score": 907 }, { "protein2": "8022.A0A060WS77", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 679, "database": 0, "textmining": 279, "combined_score": 763 }, { "protein2": "8022.A0A060Z3T6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 850, "experimental": 44, "database": 0, "textmining": 417, "combined_score": 909 }, { "protein2": "8022.A0A060XDQ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 749, "database": 0, "textmining": 441, "combined_score": 853 }, { "protein2": "8022.A0A060X2R7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 170, "experimental": 254, "database": 334, "textmining": 505, "combined_score": 768 }, { "protein2": "8022.A0A060WT92", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 685, "textmining": 86, "combined_score": 730 }, { "protein2": "8022.A0A060YNG8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 450, "combined_score": 937 }, { "protein2": "8022.A0A060WD36", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 172, "database": 593, "textmining": 389, "combined_score": 776 }, { "protein2": "8022.A0A060Z655", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 749, "database": 0, "textmining": 441, "combined_score": 853 }, { "protein2": "8022.A0A060XRR2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 76, "experimental": 745, "database": 0, "textmining": 498, "combined_score": 871 }, { "protein2": "8022.A0A060Z6F4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 685, "textmining": 86, "combined_score": 730 }, { "protein2": "8022.A0A060WA73", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 666, "database": 0, "textmining": 342, "combined_score": 774 }, { "protein2": "8022.A0A060Y1N8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060W5A5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 694, "textmining": 273, "combined_score": 768 }, { "protein2": "8022.A0A060Z4W8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 690, "database": 547, "textmining": 238, "combined_score": 895 }, { "protein2": "8022.A0A060XI12", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 690, "database": 547, "textmining": 238, "combined_score": 895 }, { "protein2": "8022.A0A060X6S5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 874, "experimental": 0, "database": 0, "textmining": 505, "combined_score": 934 }, { "protein2": "8022.A0A060YMR9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 794, "experimental": 231, "database": 409, "textmining": 510, "combined_score": 947 }, { "protein2": "8022.A0A061AEY4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 766, "database": 824, "textmining": 447, "combined_score": 975 }, { "protein2": "8022.A0A060X5I3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 675, "database": 785, "textmining": 268, "combined_score": 944 }, { "protein2": "8022.A0A060Z000", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 579, "database": 721, "textmining": 216, "combined_score": 899 }, { "protein2": "8022.A0A060XDM2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 167, "database": 736, "textmining": 121, "combined_score": 789 }, { "protein2": "8022.A0A060ZBY8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 75, "experimental": 215, "database": 299, "textmining": 504, "combined_score": 713 }, { "protein2": "8022.A0A060WG92", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060XXI9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 266, "database": 827, "textmining": 506, "combined_score": 931 }, { "protein2": "8022.A0A060X3S8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 802, "database": 829, "textmining": 504, "combined_score": 981 }, { "protein2": "8022.A0A060W8A7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 167, "database": 736, "textmining": 121, "combined_score": 789 }, { "protein2": "8022.A0A060W6R9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060XW94", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 684, "database": 824, "textmining": 340, "combined_score": 961 }, { "protein2": "8022.A0A060YRF9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 582, "experimental": 166, "database": 347, "textmining": 451, "combined_score": 858 }, { "protein2": "8022.A0A060YGN0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 167, "database": 736, "textmining": 121, "combined_score": 789 }, { "protein2": "8022.A0A060Y5Y0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 167, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 784 }, { "protein2": "8022.A0A060XTX7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 87, "combined_score": 741 }, { "protein2": "8022.A0A060WZW0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 178, "database": 785, "textmining": 387, "combined_score": 884 }, { "protein2": "8022.A0A060WK21", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060VPV4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 666, "database": 0, "textmining": 342, "combined_score": 774 }, { "protein2": "8022.A0A060Y4K2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 0, "database": 0, "textmining": 402, "combined_score": 773 }, { "protein2": "8022.A0A060YEJ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 824, "textmining": 190, "combined_score": 851 }, { "protein2": "8022.A0A060X2B7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 167, "database": 736, "textmining": 121, "combined_score": 789 }, { "protein2": "8022.A0A060X4G8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 675, "experimental": 299, "database": 272, "textmining": 86, "combined_score": 828 }, { "protein2": "8022.A0A060Y135", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060XER0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 180, "database": 772, "textmining": 317, "combined_score": 861 }, { "protein2": "8022.A0A060WP39", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 673, "database": 754, "textmining": 52, "combined_score": 917 }, { "protein2": "8022.A0A060WVN0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 172, "database": 593, "textmining": 389, "combined_score": 776 }, { "protein2": "8022.A0A060YX92", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 747, "database": 824, "textmining": 420, "combined_score": 971 }, { "protein2": "8022.A0A060Y6S6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060WGE5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 837, "experimental": 0, "database": 431, "textmining": 450, "combined_score": 944 }, { "protein2": "8022.A0A060XVP1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 180, "database": 772, "textmining": 317, "combined_score": 861 }, { "protein2": "8022.A0A060XZH1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060XJT9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 675, "experimental": 299, "database": 272, "textmining": 86, "combined_score": 828 }, { "protein2": "8022.A0A060ZEW9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 288, "database": 910, "textmining": 329, "combined_score": 953 }, { "protein2": "8022.A0A060ZA43", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 812, "experimental": 158, "database": 0, "textmining": 89, "combined_score": 843 }, { "protein2": "8022.A0A060WHG0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 87, "combined_score": 741 }, { "protein2": "8022.A0A060XYH4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 675, "database": 785, "textmining": 268, "combined_score": 944 }, { "protein2": "8022.A0A060YDE8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 792, "experimental": 158, "database": 0, "textmining": 133, "combined_score": 834 }, { "protein2": "8022.A0A060WQX1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 816, "experimental": 0, "database": 0, "textmining": 87, "combined_score": 824 }, { "protein2": "8022.A0A060XX03", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 684, "database": 824, "textmining": 340, "combined_score": 961 }, { "protein2": "8022.A0A060Y7H3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 802, "database": 0, "textmining": 222, "combined_score": 839 }, { "protein2": "8022.C1BI16", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 616, "database": 721, "textmining": 208, "combined_score": 907 }, { "protein2": "8022.A0A060Y1E2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 115, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 770 }, { "protein2": "8022.A0A060ZXZ7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 122, "experimental": 222, "database": 832, "textmining": 505, "combined_score": 935 }, { "protein2": "8022.A0A060XU58", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 889, "experimental": 0, "database": 0, "textmining": 276, "combined_score": 916 }, { "protein2": "8022.A0A060Z320", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 579, "database": 721, "textmining": 216, "combined_score": 899 }, { "protein2": "8022.A0A060Y9V2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 874, "experimental": 0, "database": 0, "textmining": 505, "combined_score": 934 }, { "protein2": "8022.A0A060X606", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 706, "experimental": 158, "database": 0, "textmining": 128, "combined_score": 765 }, { "protein2": "8022.A0A060YFT4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 947, "database": 489, "textmining": 111, "combined_score": 974 }, { "protein2": "8022.A0A060YQV1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 240, "database": 910, "textmining": 507, "combined_score": 963 }, { "protein2": "8022.A0A060XV19", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 87, "combined_score": 741 }, { "protein2": "8022.A0A060X2J9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 217, "experimental": 326, "database": 0, "textmining": 504, "combined_score": 715 }, { "protein2": "8022.A0A060X656", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 768, "experimental": 0, "database": 0, "textmining": 505, "combined_score": 880 }, { "protein2": "8022.A0A060X4P6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 0, "textmining": 373, "combined_score": 706 }, { "protein2": "8022.A0A060W7E9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 299, "database": 829, "textmining": 0, "combined_score": 875 }, { "protein2": "8022.A0A060WAH7", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 199, "experimental": 694, "database": 0, "textmining": 384, "combined_score": 836 }, { "protein2": "8022.A0A060XRZ7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 424, "experimental": 158, "database": 0, "textmining": 454, "combined_score": 712 }, { "protein2": "8022.A0A060Z0R5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 706, "database": 824, "textmining": 441, "combined_score": 968 }, { "protein2": "8022.A0A060Z173", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 245, "database": 816, "textmining": 504, "combined_score": 925 }, { "protein2": "8022.A0A060Z4S6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 375, "experimental": 0, "database": 330, "textmining": 450, "combined_score": 749 }, { "protein2": "8022.A0A060W1P0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 375, "experimental": 0, "database": 330, "textmining": 450, "combined_score": 749 }, { "protein2": "8022.A0A060ZDZ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 652, "database": 435, "textmining": 0, "combined_score": 794 }, { "protein2": "8022.A0A060WW06", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 666, "database": 0, "textmining": 342, "combined_score": 774 }, { "protein2": "8022.A0A060XVQ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 758, "database": 824, "textmining": 370, "combined_score": 970 }, { "protein2": "8022.A0A060X2M8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 685, "textmining": 86, "combined_score": 730 }, { "protein2": "8022.A0A060W9W8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 360, "database": 433, "textmining": 400, "combined_score": 766 }, { "protein2": "8022.A0A060W9X0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060WKD2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060XBU0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 690, "database": 547, "textmining": 238, "combined_score": 895 }, { "protein2": "8022.A0A060YIJ3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 551, "database": 0, "textmining": 373, "combined_score": 706 }, { "protein2": "8022.A0A060X729", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 616, "database": 721, "textmining": 208, "combined_score": 907 }, { "protein2": "8022.A0A060W716", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 616, "database": 721, "textmining": 208, "combined_score": 907 }, { "protein2": "8022.A0A060XYU5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 115, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 770 }, { "protein2": "8022.A0A060XB77", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 679, "database": 0, "textmining": 279, "combined_score": 763 }, { "protein2": "8022.C1BG84", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 600, "experimental": 0, "database": 0, "textmining": 351, "combined_score": 729 }, { "protein2": "8022.A0A060X0Z8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 167, "database": 736, "textmining": 121, "combined_score": 789 }, { "protein2": "8022.A0A060YE39", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 0, "database": 0, "textmining": 402, "combined_score": 773 }, { "protein2": "8022.A0A060YTZ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 582, "experimental": 166, "database": 347, "textmining": 451, "combined_score": 858 }, { "protein2": "8022.A0A060YDW3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 199, "experimental": 361, "database": 370, "textmining": 514, "combined_score": 822 }, { "protein2": "8022.A0A060X0A0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 148, "experimental": 184, "database": 583, "textmining": 110, "combined_score": 707 }, { "protein2": "8022.A0A060Z6E8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 672, "database": 0, "textmining": 396, "combined_score": 793 }, { "protein2": "8022.A0A060YEB0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 850, "experimental": 44, "database": 0, "textmining": 417, "combined_score": 909 }, { "protein2": "8022.A0A060VWD5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 706, "experimental": 158, "database": 0, "textmining": 128, "combined_score": 765 }, { "protein2": "8022.A0A060XXY8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 600, "experimental": 0, "database": 0, "textmining": 351, "combined_score": 729 }, { "protein2": "8022.A0A060XNR8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 675, "database": 785, "textmining": 230, "combined_score": 941 }, { "protein2": "8022.A0A060XGN6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 86, "combined_score": 741 }, { "protein2": "8022.A0A060WAD4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 360, "database": 433, "textmining": 400, "combined_score": 766 }, { "protein2": "8022.A0A060XXJ1", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 }, { "protein2": "8022.A0A060Z3S0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 766, "database": 824, "textmining": 447, "combined_score": 975 }, { "protein2": "8022.A0A060YJ69", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 675, "experimental": 299, "database": 272, "textmining": 86, "combined_score": 828 }, { "protein2": "8022.A0A060VXY4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 283, "experimental": 159, "database": 333, "textmining": 507, "combined_score": 775 }, { "protein2": "8022.A0A060YH96", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 375, "experimental": 0, "database": 330, "textmining": 450, "combined_score": 749 }, { "protein2": "8022.A0A060YHX9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 245, "database": 816, "textmining": 504, "combined_score": 925 }, { "protein2": "8022.A0A060WM17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 666, "database": 0, "textmining": 342, "combined_score": 774 }, { "protein2": "8022.A0A060YI26", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060WGY3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 685, "textmining": 86, "combined_score": 730 }, { "protein2": "8022.A0A060YHA2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 672, "database": 0, "textmining": 396, "combined_score": 793 }, { "protein2": "8022.C1BHI8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 86, "combined_score": 741 }, { "protein2": "8022.A0A060YT06", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 824, "textmining": 190, "combined_score": 851 }, { "protein2": "8022.A0A060ZEB5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 240, "database": 910, "textmining": 507, "combined_score": 963 }, { "protein2": "8022.A0A060WF04", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 172, "database": 593, "textmining": 389, "combined_score": 776 }, { "protein2": "8022.A0A060W5V1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 53, "experimental": 802, "database": 829, "textmining": 450, "combined_score": 980 }, { "protein2": "8022.A0A060WRH2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 758 }, { "protein2": "8022.A0A060VU69", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 167, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 784 }, { "protein2": "8022.A0A060YW55", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 794, "experimental": 231, "database": 409, "textmining": 506, "combined_score": 947 }, { "protein2": "8022.A0A060XUU8", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 }, { "protein2": "8022.A0A060YW05", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 366, "database": 824, "textmining": 220, "combined_score": 905 }, { "protein2": "8022.A0A060XSK5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060XPT1", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 }, { "protein2": "8022.A0A060YST3", "neighborhood": 46, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 779, "textmining": 86, "combined_score": 790 }, { "protein2": "8022.A0A060XNV6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 167, "experimental": 580, "database": 378, "textmining": 126, "combined_score": 784 }, { "protein2": "8022.A0A060YQF1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 180, "database": 772, "textmining": 317, "combined_score": 861 }, { "protein2": "8022.A0A060XFH7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060Y0H6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 728, "database": 570, "textmining": 235, "combined_score": 912 }, { "protein2": "8022.A0A060ZAM3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 815, "database": 829, "textmining": 451, "combined_score": 981 }, { "protein2": "8022.A0A060WFX5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 685, "textmining": 86, "combined_score": 730 }, { "protein2": "8022.A0A060WE07", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 856, "database": 829, "textmining": 450, "combined_score": 985 }, { "protein2": "8022.A0A060Y4Q1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 266, "database": 827, "textmining": 506, "combined_score": 931 }, { "protein2": "8022.A0A060Z819", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 245, "database": 816, "textmining": 504, "combined_score": 925 }, { "protein2": "8022.A0A060XPN1", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 }, { "protein2": "8022.A0A060W1U5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 0, "database": 829, "textmining": 503, "combined_score": 913 }, { "protein2": "8022.A0A060Z041", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 675, "experimental": 299, "database": 272, "textmining": 86, "combined_score": 828 }, { "protein2": "8022.A0A060X8S8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 386, "database": 568, "textmining": 86, "combined_score": 741 }, { "protein2": "8022.A0A060WZ94", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 675, "database": 785, "textmining": 230, "combined_score": 941 }, { "protein2": "8022.A0A060WKV9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 850, "experimental": 44, "database": 0, "textmining": 417, "combined_score": 909 }, { "protein2": "8022.A0A060ZQU3", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 679, "database": 0, "textmining": 279, "combined_score": 763 }, { "protein2": "8022.A0A060Y3B2", "neighborhood": 0, "fusion": 0, "cooccurence": 69, "coexpression": 628, "experimental": 471, "database": 862, "textmining": 512, "combined_score": 985 }, { "protein2": "8022.A0A060XX02", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 405, "textmining": 226, "combined_score": 878 }, { "protein2": "8022.A0A060WC46", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 386, "database": 568, "textmining": 398, "combined_score": 831 }, { "protein2": "8022.A0A060WJD4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 706, "database": 824, "textmining": 441, "combined_score": 968 }, { "protein2": "8022.A0A060XCS7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 167, "database": 736, "textmining": 121, "combined_score": 789 }, { "protein2": "8022.A0A060YNT6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 728, "database": 569, "textmining": 226, "combined_score": 901 }, { "protein2": "8022.A0A060Z3Y6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 178, "database": 785, "textmining": 387, "combined_score": 884 }, { "protein2": "8022.A0A060YCF8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 928, "experimental": 0, "database": 570, "textmining": 390, "combined_score": 979 }, { "protein2": "8022.A0A060WLM0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 669, "database": 774, "textmining": 388, "combined_score": 950 }, { "protein2": "8022.Q9PT09", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 937, "database": 435, "textmining": 0, "combined_score": 962 }, { "protein2": "8022.A0A060WMT5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 386, "database": 568, "textmining": 398, "combined_score": 831 }, { "protein2": "8022.A0A060XWU6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 758, "database": 824, "textmining": 370, "combined_score": 970 }, { "protein2": "8022.A0A060Z5B4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 375, "experimental": 0, "database": 330, "textmining": 450, "combined_score": 749 }, { "protein2": "8022.A0A060XC88", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 148, "experimental": 184, "database": 583, "textmining": 110, "combined_score": 707 }, { "protein2": "8022.A0A060WAH4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 299, "database": 824, "textmining": 0, "combined_score": 871 }, { "protein2": "8022.A0A060VZX4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 675, "database": 785, "textmining": 268, "combined_score": 944 }, { "protein2": "8022.A0A060YR45", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 366, "database": 824, "textmining": 220, "combined_score": 905 }, { "protein2": "8022.A0A060XTB8", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 199, "experimental": 694, "database": 0, "textmining": 384, "combined_score": 836 }, { "protein2": "8022.A0A060YHT0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 375, "experimental": 0, "database": 330, "textmining": 450, "combined_score": 749 }, { "protein2": "8022.A0A060WA29", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 582, "experimental": 166, "database": 347, "textmining": 451, "combined_score": 858 }, { "protein2": "8022.A0A060Y5B1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 346, "database": 428, "textmining": 346, "combined_score": 733 }, { "protein2": "8022.A0A060WIG3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 792, "experimental": 158, "database": 0, "textmining": 133, "combined_score": 834 } ]
A0A060W032
Ventricular natriuretic peptide
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
149
Secreted {ECO:0000256|ARBA:ARBA00004613, ECO:0000256|RuleBase:RU003686}.
MAKLHIFLGYIVLITTLSVSCGTPYASRNVQELENLKDLIQRLEDKLTVNEENYAYPSESEDVDTAEMEDIEYSPTAIRGQEERMTMNAPNRIAPESPVVSRLKDLIGLTKTAKSFNSCFGNRIERIGSWSGLGCNNVKTGNKKRIFGN
[ "GO:0042310", "GO:0042311", "GO:0003018", "GO:0065008", "GO:0065007", "GO:0097746", "GO:0008150", "GO:0008015", "GO:0003013", "GO:0090066", "GO:0003008", "GO:0035296", "GO:0032501", "GO:0035150" ]
[ "GO:0008150", "GO:0065007", "GO:0032501", "GO:0065008", "GO:0003008", "GO:0003013", "GO:0090066", "GO:0003018", "GO:0008015", "GO:0035150", "GO:0097746", "GO:0035296", "GO:0042310", "GO:0042311" ]
null
null
[ "IPR000663", "IPR030480", "IPR050787", "IPR002407" ]
af_db/AF-A0A060W032-F1-model_v4.cif.gz
8022.A0A060W032
null
null
A0A060WRY3
Chemokine interleukin-8-like domain-containing protein
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
95
Secreted {ECO:0000256|ARBA:ARBA00004613}.
MSIRMSASLVVVLLALLTITEEMSLRGMGADLRCRCIETESRRIGKLIKKVEMFPPSSHCRDTEIIATLSKSGQEICLDVSAPWVKKVIEKMLAK
[ "GO:0009743", "GO:0065007", "GO:0032928", "GO:0048518", "GO:0048870", "GO:0008150", "GO:0006954", "GO:0042221", "GO:2000145", "GO:0002523", "GO:2000377", "GO:0050896", "GO:0002685", "GO:0050900", "GO:0050789", "GO:0031325", "GO:0019222", "GO:0032930", "GO:0040017", "GO:0090322", "GO:0002684", "GO:0050794", "GO:0006952", "GO:0009893", "GO:0002376", "GO:0002682", "GO:0009987", "GO:0031323", "GO:0030335", "GO:1901700", "GO:0006950", "GO:0030334", "GO:1902624", "GO:2000379", "GO:1902622", "GO:0010033", "GO:2000147", "GO:0002687", "GO:0040012", "GO:0016477", "GO:0048522" ]
[ "GO:0008150", "GO:0065007", "GO:0048518", "GO:0050896", "GO:0050789", "GO:0002376", "GO:0009987", "GO:0048870", "GO:0042221", "GO:0050900", "GO:0019222", "GO:0040017", "GO:0002684", "GO:0050794", "GO:0009893", "GO:0002682", "GO:0006950", "GO:0040012", "GO:0048522", "GO:2000145", "GO:0002523", "GO:0002685", "GO:0031325", "GO:0006952", "GO:0031323", "GO:1901700", "GO:0010033", "GO:2000147", "GO:0002687", "GO:0016477", "GO:0009743", "GO:0006954", "GO:2000377", "GO:0030335", "GO:0030334", "GO:1902624", "GO:2000379", "GO:1902622", "GO:0032930", "GO:0090322", "GO:0032928" ]
null
null
[ "IPR039809", "IPR001089", "IPR001811", "IPR033899", "IPR036048" ]
af_db/AF-A0A060WRY3-F1-model_v4.cif.gz
8022.A0A060WRY3
[ "8022.A0A060WCR4", "8022.A0A060XW82", "8022.A0A060Y453", "8022.A0A060YBG9", "8022.A0A060VQU0", "8022.A0A060XBF3", "8022.A0A060VZ13", "8022.A0A060YQ42", "8022.A0A060X2E2", "8022.A0A060XZ47", "8022.A0A061A6H0", "8022.A0A060WPR8", "8022.A0A060W3U5", "8022.A0A060XF12", "8022.A0A060VPX8", "8022.A0A060WVB6", "8022.A0A060XTS9", "8022.A0A060YAX3", "8022.A0A060YXH5", "8022.A0A060YBB6", "8022.A0A060Y1V5", "8022.A0A060XKD8", "8022.A0A060XE26", "8022.A0A060YA11", "8022.A0A060VY72", "8022.A0A060WFM4", "8022.H1ZZ93", "8022.A0A060VTH0", "8022.A0A060VSL8", "8022.A0A060Y097", "8022.A0A060XL04", "8022.A0A060YGE9", "8022.H1ZZ96", "8022.A0A060ZH67", "8022.A0A060YC27", "8022.A0A060VVA1", "8022.A4F345", "8022.A0A060WU43", "8022.A0A060WYC1", "8022.Q1G669", "8022.Q64IC2", "8022.A0A060XGQ8", "8022.A0A061A7B1", "8022.A0A060WZ17", "8022.A0A060YWY6", "8022.A0A060XGI5", "8022.A0A060Z5E6", "8022.A0A060WNJ9", "8022.A0A060XPJ4", "8022.A0A060Y0D9", "8022.A0A060X5F3", "8022.A0A060VUU9", "8022.A0A060WB80", "8022.A0A060W8I0", "8022.A0A060VW55", "8022.A0A060WQ51", "8022.A0A060WDY2", "8022.A0A060X035" ]
[ { "protein2": "8022.A0A060WCR4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 0, "database": 827, "textmining": 318, "combined_score": 878 }, { "protein2": "8022.A0A060XW82", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 43, "experimental": 0, "database": 826, "textmining": 59, "combined_score": 829 }, { "protein2": "8022.A0A060Y453", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 233, "database": 736, "textmining": 125, "combined_score": 807 }, { "protein2": "8022.A0A060YBG9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 0, "database": 827, "textmining": 126, "combined_score": 844 }, { "protein2": "8022.A0A060VQU0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 0, "database": 827, "textmining": 389, "combined_score": 893 }, { "protein2": "8022.A0A060XBF3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 827, "textmining": 111, "combined_score": 841 }, { "protein2": "8022.A0A060VZ13", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 0, "database": 827, "textmining": 126, "combined_score": 844 }, { "protein2": "8022.A0A060YQ42", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 816, "textmining": 75, "combined_score": 825 }, { "protein2": "8022.A0A060X2E2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 115, "combined_score": 840 }, { "protein2": "8022.A0A060XZ47", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 825, "textmining": 74, "combined_score": 855 }, { "protein2": "8022.A0A061A6H0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 506, "database": 736, "textmining": 136, "combined_score": 888 }, { "protein2": "8022.A0A060WPR8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 43, "experimental": 0, "database": 826, "textmining": 59, "combined_score": 829 }, { "protein2": "8022.A0A060W3U5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 827, "textmining": 111, "combined_score": 841 }, { "protein2": "8022.A0A060XF12", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 87, "combined_score": 824 }, { "protein2": "8022.A0A060VPX8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 179, "database": 827, "textmining": 429, "combined_score": 913 }, { "protein2": "8022.A0A060WVB6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 932, "database": 736, "textmining": 186, "combined_score": 985 }, { "protein2": "8022.A0A060XTS9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 785, "textmining": 74, "combined_score": 822 }, { "protein2": "8022.A0A060YAX3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 825, "textmining": 74, "combined_score": 855 }, { "protein2": "8022.A0A060YXH5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 179, "database": 827, "textmining": 422, "combined_score": 912 }, { "protein2": "8022.A0A060YBB6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 702, "database": 419, "textmining": 220, "combined_score": 857 }, { "protein2": "8022.A0A060Y1V5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 179, "database": 827, "textmining": 429, "combined_score": 913 }, { "protein2": "8022.A0A060XKD8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 233, "database": 736, "textmining": 125, "combined_score": 807 }, { "protein2": "8022.A0A060XE26", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 789, "textmining": 87, "combined_score": 799 }, { "protein2": "8022.A0A060YA11", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 439, "textmining": 220, "combined_score": 719 }, { "protein2": "8022.A0A060VY72", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 805, "textmining": 48, "combined_score": 811 }, { "protein2": "8022.A0A060WFM4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 789, "textmining": 87, "combined_score": 799 }, { "protein2": "8022.H1ZZ93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 104, "experimental": 932, "database": 609, "textmining": 375, "combined_score": 983 }, { "protein2": "8022.A0A060VTH0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 893, "database": 0, "textmining": 177, "combined_score": 908 }, { "protein2": "8022.A0A060VSL8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 0, "database": 827, "textmining": 389, "combined_score": 893 }, { "protein2": "8022.A0A060Y097", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 419, "textmining": 246, "combined_score": 718 }, { "protein2": "8022.A0A060XL04", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 439, "textmining": 220, "combined_score": 719 }, { "protein2": "8022.A0A060YGE9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 87, "combined_score": 766 }, { "protein2": "8022.H1ZZ96", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 893, "database": 0, "textmining": 177, "combined_score": 908 }, { "protein2": "8022.A0A060ZH67", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 87, "combined_score": 766 }, { "protein2": "8022.A0A060YC27", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 805, "textmining": 48, "combined_score": 811 }, { "protein2": "8022.A0A060VVA1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 785, "textmining": 74, "combined_score": 822 }, { "protein2": "8022.A4F345", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 308, "combined_score": 873 }, { "protein2": "8022.A0A060WU43", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 87, "combined_score": 766 }, { "protein2": "8022.A0A060WYC1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 826, "textmining": 48, "combined_score": 832 }, { "protein2": "8022.Q1G669", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 255, "experimental": 918, "database": 832, "textmining": 453, "combined_score": 993 }, { "protein2": "8022.Q64IC2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 419, "textmining": 220, "combined_score": 709 }, { "protein2": "8022.A0A060XGQ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 104, "experimental": 932, "database": 609, "textmining": 375, "combined_score": 983 }, { "protein2": "8022.A0A061A7B1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 506, "database": 736, "textmining": 136, "combined_score": 888 }, { "protein2": "8022.A0A060WZ17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 758, "database": 736, "textmining": 183, "combined_score": 948 }, { "protein2": "8022.A0A060YWY6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 506, "database": 736, "textmining": 136, "combined_score": 888 }, { "protein2": "8022.A0A060XGI5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 825, "textmining": 74, "combined_score": 855 }, { "protein2": "8022.A0A060Z5E6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 419, "textmining": 220, "combined_score": 709 }, { "protein2": "8022.A0A060WNJ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 115, "combined_score": 840 }, { "protein2": "8022.A0A060XPJ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 789, "textmining": 87, "combined_score": 799 }, { "protein2": "8022.A0A060Y0D9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 419, "textmining": 246, "combined_score": 718 }, { "protein2": "8022.A0A060X5F3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 0, "database": 827, "textmining": 318, "combined_score": 878 }, { "protein2": "8022.A0A060VUU9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 506, "database": 736, "textmining": 136, "combined_score": 888 }, { "protein2": "8022.A0A060WB80", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 0, "database": 614, "textmining": 338, "combined_score": 739 }, { "protein2": "8022.A0A060W8I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 44, "experimental": 0, "database": 832, "textmining": 148, "combined_score": 851 }, { "protein2": "8022.A0A060VW55", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 789, "textmining": 87, "combined_score": 799 }, { "protein2": "8022.A0A060WQ51", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 179, "database": 831, "textmining": 493, "combined_score": 925 }, { "protein2": "8022.A0A060WDY2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 816, "textmining": 73, "combined_score": 825 }, { "protein2": "8022.A0A060X035", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 826, "textmining": 48, "combined_score": 832 } ]
A0A060WUE4
Chemokine interleukin-8-like domain-containing protein
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
95
Secreted {ECO:0000256|ARBA:ARBA00004613}.
MSIRMSASLVVVLLALLTITEGMSLRGMGADLRCRCIETESRRIGKLIKKVEMFPPSSHCRDTEIIATLSKSGQEICLDVSAPWVKRVIEKMLAK
[ "GO:0009743", "GO:0065007", "GO:0032928", "GO:0048518", "GO:0048870", "GO:0008150", "GO:0006954", "GO:0042221", "GO:2000145", "GO:0002523", "GO:2000377", "GO:0050896", "GO:0002685", "GO:0050900", "GO:0050789", "GO:0031325", "GO:0019222", "GO:0032930", "GO:0040017", "GO:0090322", "GO:0002684", "GO:0050794", "GO:0006952", "GO:0009893", "GO:0002376", "GO:0002682", "GO:0009987", "GO:0031323", "GO:0030335", "GO:1901700", "GO:0006950", "GO:0030334", "GO:1902624", "GO:2000379", "GO:1902622", "GO:0010033", "GO:2000147", "GO:0002687", "GO:0040012", "GO:0016477", "GO:0048522", "GO:0110165", "GO:0005575", "GO:0005576", "GO:0005615" ]
[ "GO:0008150", "GO:0065007", "GO:0048518", "GO:0050896", "GO:0050789", "GO:0002376", "GO:0009987", "GO:0048870", "GO:0042221", "GO:0050900", "GO:0019222", "GO:0040017", "GO:0002684", "GO:0050794", "GO:0009893", "GO:0002682", "GO:0006950", "GO:0040012", "GO:0048522", "GO:2000145", "GO:0002523", "GO:0002685", "GO:0031325", "GO:0006952", "GO:0031323", "GO:1901700", "GO:0010033", "GO:2000147", "GO:0002687", "GO:0016477", "GO:0009743", "GO:0006954", "GO:2000377", "GO:0030335", "GO:0030334", "GO:1902624", "GO:2000379", "GO:1902622", "GO:0032930", "GO:0090322", "GO:0032928" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005576", "GO:0005615" ]
[ "IPR039809", "IPR001089", "IPR001811", "IPR033899", "IPR036048" ]
af_db/AF-A0A060WUE4-F1-model_v4.cif.gz
8022.A0A060WUE4
[ "8022.A0A060YAX3", "8022.A0A060XTS9", "8022.A0A060Y1V5", "8022.A0A060YXH5", "8022.A0A060YBB6", "8022.A0A060W3U5", "8022.A0A060WPR8", "8022.A0A061A6H0", "8022.A0A060VPX8", "8022.A0A060XF12", "8022.A0A060WVB6", "8022.A0A060YA11", "8022.A0A060VY72", "8022.A0A060XKD8", "8022.A0A060XE26", "8022.A0A060XW82", "8022.A0A060WCR4", "8022.A0A060Y453", "8022.A0A060YBG9", "8022.A0A060YQ42", "8022.A0A060X2E2", "8022.A0A060XZ47", "8022.A0A060VQU0", "8022.A0A060XBF3", "8022.A0A060VZ13", "8022.A0A060XGI5", "8022.A0A060Z5E6", "8022.A0A060XPJ4", "8022.A0A060WNJ9", "8022.Q64IC2", "8022.A0A060XGQ8", "8022.A0A060YWY6", "8022.A0A061A7B1", "8022.A0A060WZ17", "8022.A0A060W8I0", "8022.A0A060WDY2", "8022.A0A060X035", "8022.A0A060VW55", "8022.A0A060WQ51", "8022.A0A060VUU9", "8022.A0A060Y0D9", "8022.A0A060X5F3", "8022.A0A060WB80", "8022.A0A060XL04", "8022.A0A060VSL8", "8022.A0A060Y097", "8022.A0A060YGE9", "8022.H1ZZ96", "8022.H1ZZ93", "8022.A0A060WFM4", "8022.A0A060VTH0", "8022.A0A060WU43", "8022.A0A060WYC1", "8022.Q1G669", "8022.A0A060ZH67", "8022.A0A060YC27", "8022.A0A060VVA1", "8022.A4F345" ]
[ { "protein2": "8022.A0A060YAX3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 825, "textmining": 74, "combined_score": 855 }, { "protein2": "8022.A0A060XTS9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 785, "textmining": 74, "combined_score": 822 }, { "protein2": "8022.A0A060Y1V5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 179, "database": 827, "textmining": 429, "combined_score": 913 }, { "protein2": "8022.A0A060YXH5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 179, "database": 827, "textmining": 422, "combined_score": 912 }, { "protein2": "8022.A0A060YBB6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 702, "database": 419, "textmining": 220, "combined_score": 857 }, { "protein2": "8022.A0A060W3U5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 827, "textmining": 111, "combined_score": 841 }, { "protein2": "8022.A0A060WPR8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 43, "experimental": 0, "database": 826, "textmining": 59, "combined_score": 829 }, { "protein2": "8022.A0A061A6H0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 506, "database": 736, "textmining": 136, "combined_score": 888 }, { "protein2": "8022.A0A060VPX8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 179, "database": 827, "textmining": 429, "combined_score": 913 }, { "protein2": "8022.A0A060XF12", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 87, "combined_score": 824 }, { "protein2": "8022.A0A060WVB6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 932, "database": 736, "textmining": 186, "combined_score": 985 }, { "protein2": "8022.A0A060YA11", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 439, "textmining": 220, "combined_score": 719 }, { "protein2": "8022.A0A060VY72", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 805, "textmining": 48, "combined_score": 811 }, { "protein2": "8022.A0A060XKD8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 233, "database": 736, "textmining": 125, "combined_score": 807 }, { "protein2": "8022.A0A060XE26", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 789, "textmining": 87, "combined_score": 799 }, { "protein2": "8022.A0A060XW82", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 43, "experimental": 0, "database": 826, "textmining": 59, "combined_score": 829 }, { "protein2": "8022.A0A060WCR4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 0, "database": 827, "textmining": 318, "combined_score": 878 }, { "protein2": "8022.A0A060Y453", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 233, "database": 736, "textmining": 125, "combined_score": 807 }, { "protein2": "8022.A0A060YBG9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 0, "database": 827, "textmining": 126, "combined_score": 844 }, { "protein2": "8022.A0A060YQ42", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 816, "textmining": 75, "combined_score": 825 }, { "protein2": "8022.A0A060X2E2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 115, "combined_score": 840 }, { "protein2": "8022.A0A060XZ47", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 825, "textmining": 74, "combined_score": 855 }, { "protein2": "8022.A0A060VQU0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 0, "database": 827, "textmining": 389, "combined_score": 893 }, { "protein2": "8022.A0A060XBF3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 827, "textmining": 111, "combined_score": 841 }, { "protein2": "8022.A0A060VZ13", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 0, "database": 827, "textmining": 126, "combined_score": 844 }, { "protein2": "8022.A0A060XGI5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 825, "textmining": 74, "combined_score": 855 }, { "protein2": "8022.A0A060Z5E6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 419, "textmining": 220, "combined_score": 709 }, { "protein2": "8022.A0A060XPJ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 789, "textmining": 87, "combined_score": 799 }, { "protein2": "8022.A0A060WNJ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 115, "combined_score": 840 }, { "protein2": "8022.Q64IC2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 419, "textmining": 274, "combined_score": 729 }, { "protein2": "8022.A0A060XGQ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 104, "experimental": 932, "database": 609, "textmining": 375, "combined_score": 983 }, { "protein2": "8022.A0A060YWY6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 506, "database": 736, "textmining": 136, "combined_score": 888 }, { "protein2": "8022.A0A061A7B1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 506, "database": 736, "textmining": 136, "combined_score": 888 }, { "protein2": "8022.A0A060WZ17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 758, "database": 736, "textmining": 183, "combined_score": 948 }, { "protein2": "8022.A0A060W8I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 44, "experimental": 0, "database": 832, "textmining": 148, "combined_score": 851 }, { "protein2": "8022.A0A060WDY2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 816, "textmining": 73, "combined_score": 825 }, { "protein2": "8022.A0A060X035", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 826, "textmining": 48, "combined_score": 832 }, { "protein2": "8022.A0A060VW55", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 789, "textmining": 87, "combined_score": 799 }, { "protein2": "8022.A0A060WQ51", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 179, "database": 831, "textmining": 493, "combined_score": 925 }, { "protein2": "8022.A0A060VUU9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 506, "database": 736, "textmining": 136, "combined_score": 888 }, { "protein2": "8022.A0A060Y0D9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 419, "textmining": 246, "combined_score": 718 }, { "protein2": "8022.A0A060X5F3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 0, "database": 827, "textmining": 318, "combined_score": 878 }, { "protein2": "8022.A0A060WB80", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 0, "database": 614, "textmining": 338, "combined_score": 739 }, { "protein2": "8022.A0A060XL04", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 439, "textmining": 297, "combined_score": 746 }, { "protein2": "8022.A0A060VSL8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 0, "database": 827, "textmining": 389, "combined_score": 893 }, { "protein2": "8022.A0A060Y097", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 392, "database": 419, "textmining": 246, "combined_score": 718 }, { "protein2": "8022.A0A060YGE9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 87, "combined_score": 766 }, { "protein2": "8022.H1ZZ96", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 893, "database": 0, "textmining": 177, "combined_score": 908 }, { "protein2": "8022.H1ZZ93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 104, "experimental": 932, "database": 609, "textmining": 375, "combined_score": 983 }, { "protein2": "8022.A0A060WFM4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 789, "textmining": 87, "combined_score": 799 }, { "protein2": "8022.A0A060VTH0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 893, "database": 0, "textmining": 177, "combined_score": 908 }, { "protein2": "8022.A0A060WU43", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 87, "combined_score": 766 }, { "protein2": "8022.A0A060WYC1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 826, "textmining": 48, "combined_score": 832 }, { "protein2": "8022.Q1G669", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 255, "experimental": 918, "database": 832, "textmining": 453, "combined_score": 993 }, { "protein2": "8022.A0A060ZH67", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 87, "combined_score": 766 }, { "protein2": "8022.A0A060YC27", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 805, "textmining": 48, "combined_score": 811 }, { "protein2": "8022.A0A060VVA1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 63, "experimental": 162, "database": 785, "textmining": 74, "combined_score": 822 }, { "protein2": "8022.A4F345", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 308, "combined_score": 873 } ]
A0A060WZC7
Skeletal muscle ryanodine receptor
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
4,791
Sarcoplasmic reticulum membrane {ECO:0000256|ARBA:ARBA00004326}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004326}.
MAEGGDGEEEIQFLRTPISVFRIAHYEGGAVCSHARSLWRLEPLRIGWSGGHMKWGQSFRVRHITTGRYLCLDEEKGLLVVDPEKANAKMSAFCFRISKEKIEVAQKRDVEGMGTPEIKYGESMCFVQHVSSGLWLTYASVDAKSARLGPLKRKAILHKEGHMDDALTVARSQTEEFQAARMIYNTAGLFTQFIKALDSLSGKNKSSSGPPSLPMDSVALSLQDLIFYFRPPEEELEHEEKQTKLRSLKNRQNLFQEEGMITLVLDCIDRLNVYNTAAHFSEFAGEEAAESWKEIVNLLYELLASLIRGNRANCALFCDNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQNLITENLLPGRDLLLQSNIINYVTSVRPNIFLGTCEGSTQYKKWYFEVMVDYVEPFLTAQAFHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYAFDGLHLWSGRVLRHVASPNMHILAADDVVSCCLDLSVPSISFRINGHPVQGMFENFNLDGLFFPVVSFSAGVRVRFLLGGRHGDFKFLPPPGYAPCYEAVLPKDRLRIEPIKEYKHDFNGVRNLLGPTQSLSHTAFTPCPVDTVQIVLPPHLERIREKLAENSHELWAATRIEQGWTYGSFRDDNKKLHPCLVDFQSLPEPEKNYNLAMSGETLKTLLALGCHVGMGDEKAEENLKNIKMPKTYMMSSGYKPAPLDLNHVKLTPNQTNLVERLAENGHNVWARDRVHQGWTYSIVQDIMSKRNPRLVPYNLLDEKTKKTNRDTVCAAVRTLIGYGYNIEPPDQESSGNGEGHSRGNKIRVFRAEKSYAVTQGKWYFEFEAVTVGDMRVGWARPSVRADTELGADELAYVFNGFKAQRWHVGNEPFGRSWLPGDVVGCMIDLVEQNIFFTLNGEMLISDSGSEMAFKDIDTGDGFIPVCSLGLSQVGRLNLGQNVSSLRYFTICGLQEGFEPFAINMKRDITMWFSKSLPQFIPVPTEHPHIEVSRVDGTVDSAPCLKLTHKTFGSQNANTDLLFLRLSMPVEFHETFKVMAGTTPLTRALTIPEDEVLEVDPDSDFEVLKKSASRTEKEEEKKEPSVPKEIPVNEGGENVKDASTEKSKKKGFLFKAKKAAFTPPPVVPTMPRLMEEVVPDDRDDDDIILNTTTYYYSVRVIAGQEPSGVWVGWITPDYHQYDLHFDLSKVRNVTVTVGDDKGNIHDSMKRSNCYMVWGGEFSSSQQTRVSQEDFVIGCLIDLDTGLMTFTANGKEINTFYQVEPNTKLFPAVFVLPSSQNMLQVELGKLKNIMPISAAMFRSERKNPVPQCPPRLDVQMLTPVIWSRMPNHFLSPETGRVNERHGWMVECREPLTMMALHIPEENRCIDVLELSERMDLLKFHYHTLKLYGSVCALGNNRVAHALCSHVDESQLFYAIENTYLPGPMRSGYYDLLISMHLESAKRNRLMTNKEFIVPMTDETRSINLYSDTDNSHALPGVGLTTCLRPKLHFSPTGFVGTDLDIYTLSPFIPLQVLKAKALTMLTEAVQDGGQAMRDPVGGSVEFHFVPILKLISTLLIMGVFENEDVKHILKMIEPTVFNEELEAELEELDGEKVDGEKGAEETEKEATPGEADGEAEEQVGLEEGLLHMKLPESVKLQMCTLLQYFCDCELRHRVEAIIAFSDQFVSQVQANQRARYNELMLAFTMSAAETARKTREFRSPPQEQVNMLMNFKSIAEDEECPVPDEVRDALLSFHKNLLAHCGVHIEEEEVEEELDMSLKGRLFRILDKLRHLRKKKVEEAPEPVEETKPSTLQELISHTMIHWAQESFIQNPELVRLMFSLLHRQYDGLGELIRALPKAYTINAISIKDTMDLLECLGQIRSLLIVQMGPEEERLMIQSIGNIMSNKVFYQHPNLMRALGMHETVMEVMVNVLGGGDSKEIRFPRMVTNCCRFLCYFCRISRQNQRSMFDHLSYLLQNSGIGLGMRGSTPLDVAAASCIDNNELALALQEQDLEKVVKYLAGCGLQSCPQLLAKGYPDIGWNPCGGEKYLDFLRFAVFVNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAIEEAIKISEDPARDGPTVKKDRRFPGMFPGGEEQHEENKVHLGNAIMSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPMEDLVGVISLSVQIPDFGKDNSVIEPKMSSSFVPDHKAPMVLFLDRVYGIDNQDFLLHVLEVGFLPDMRAAASLDTAAFCTTEMALALNRYLSLAVLPLITKCAFLFAGTDHRAIMIDSMLHTIYRLSRGRAFTKAQRDVIEECLMALCKNLRPSMLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWKYYCLPNGWGNFGVSSEEELHLTRKLFWGIFESLAHKKFDAELFKIAMPCICAIAGAIPPDYVDASYSSKTEKKALVDAEGNFDPKPVETTNTIIPERLDGFINRYAEYTHDKWAFEKIQNNWTYGEMLDENSKTHPMLRPYKTFSEKDKEIYRWPIKESMKAMIAWEWTLDQTREGDEAKTEQKKAARKISQTAQATYDPSHGYSPQPIEISHTALSRELQSMAEQLAENYHNTWGRKKKMELQSKGGGAHPLLVPYDTLTAKEKARDREKAHELLKFLQLNGFAVTRGMKDMESDISSIEKRFAYGFLQKLLKWMEIAQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFKNHCLYFLSTPAKVLGSGGHSSNKEKEMIASIFCKMAALVRHRVSLFGNDAAAIVNCLHILARSLDARTVMKSGPEIVKAGLRSFFEGAADDIEKMVENLKLGKVSKGNQQVKGVSQNINYTTIALLPVLTSLFDHISQHQFGDDVMLDDLQMSCYRIMCAIYSLGSVKNPHVERQRPALGECLAHLAAAMPVAYLEPHLNEYNAFSVYTTKSPRERAILGLPNEVQELCQDIPELDVLLKEIGDLAESGARYTEMPHVIEITLPMLCNYLPRWWERGLENFPELEGQICTDVTSDQLNQLLGSIMKIVVNNLGIDEASWMKRLAVFSQPIVSRARPEMLKSHFIPTMEKLKKRTGKVVAEEDHLRMEGKAEGDEEEGTIRDEFAVLCRDLYALYPLLIRYVDNNRARWLTCPDPDAEELFRMVGEVFIFWSKSHNFKREEQNFVVMNEINNMSFLTADSKSKMSKAGGSDVERTKKKRRGDRYSVQTSLIVAALKKMLPIGLNMCSPADHELINLAKIRYSLRDTDEEVREFLQNNLHLQGKVENPSMRWQMSLYKEMAGKAEDADAPEKVVKRVQEVSAVLYHIEVTEHPFKSKKMVWHKLLSKQRRKAVVACFRMTPLYNLPRHRASNMFLEGYKRNWIHTEGYSFEDRMIDDLSKAMEQEGEEEEETETKPDPLHQLILHFSRTALTEKSKLDTDYLYMAYADIMAKSCHIGEEDEGGEEVEEGAEDEMSFEVRQTELEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGCMVSSTLKLGISILNGGNVEVQQKMLEYLKDKKDVGFFLSVQALMQTCSVLDLNAFERQNKAEGLGMVSEEGTSKSFFPLECLTADLLKLRSSPLLRLIRIPEHGISAISQSIDLSNSPLVKLLNCVVCLYTVMSIVPIHESISDFYWYYSGKDIIDEPGKKNFSKAMTVAKQIFNSLTEYIQGPCTGNQQSLTHSRLWDAVVGFLHVFAHMMMKLAQHRQNPRGKPGSDSSQIGLLKELLDLQKDMVVMLLSLLEGNVVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFQKAMDSQKQYSPSEIQFLLSCSEADENDMINFEEFADRFQEPAKDIGFNIAVLLTNLSEHVPHDLRLKNFLEQAESVLNYFRPFLGRIEIMGASRKIERIYFEISEVNRTQWEMPQVRESKRQFIFDVVNEGGESEKMEMFVNFCEDTIFEMNIASQISEQEEEKEEEDDDEPAEGGAEAGGGGGGDEEGNGEEGEPESSSAFADFINSLLNFLSIFTFRNLRRQYRRVRKMTIKQIVVGLATFFWTILIGILHFIYSVCKGFFLLIWQTLFGGGLVEGAKNITVTEILASMPDPTQDEVHGDLPGEPRTGEEQEAGGVTDQMDTGGGEEEEEDKQDKEGGGPPRIDAPGGLGDMGIEATVEPPTPEGTPLTRRKQQPEEGAAAAADGQAAEPAPAPAPAIEEPPPEPEKADTENGEKAEKEAETKEEEKQEEPKEKKAKDKKTKKQHREQGFQLWTELDIQRNKFLNYLSRNFYNLRFLALFIAFALNFILLFYKVSDSPPGEGDEVEGSGMFEGSGEEEEEGPVYFFLEESTGYMQPTLTFLAALHTVIAFLCIIGYNCLKIPLVIFKREKELARKLEFDGLYITEQPEDDDIKGQWDRLVLNTPSFPNNYWDKFVKRKVLDKYGDIYGRERIAELLGMDLASLDVSQQTDKKPEEPDNSTLAWCTSIDFKYQIWKCGVVFTDGTFLYLCWYTIMSLLGHYNNFFYACHLLDIAIGVKDLRTILSSVTHNGKQLMMTLGLLAVVVYLYTVVAFIFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDVYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERAWDFFPAGDCFRKQYEDQLA
[ "GO:0014808", "GO:0051234", "GO:0070588", "GO:0098655", "GO:0051283", "GO:0051209", "GO:0065007", "GO:0009987", "GO:0071702", "GO:0051179", "GO:0097553", "GO:0006816", "GO:0098662", "GO:0034220", "GO:0008150", "GO:0030001", "GO:0055085", "GO:0006812", "GO:0050789", "GO:0048523", "GO:0048519", "GO:1903514", "GO:0051282", "GO:0006811", "GO:0098660", "GO:0032879", "GO:0006810", "GO:0050794", "GO:0070296", "GO:0005622", "GO:0043226", "GO:0016529", "GO:0005783", "GO:0005575", "GO:0016020", "GO:0043231", "GO:0043229", "GO:0014802", "GO:0110165", "GO:0005737", "GO:0016528", "GO:0043227", "GO:0012505", "GO:0031984", "GO:0098827", "GO:0015643", "GO:0003674", "GO:0005488" ]
[ "GO:0008150", "GO:0065007", "GO:0009987", "GO:0051179", "GO:0050789", "GO:0048519", "GO:0051234", "GO:0055085", "GO:0048523", "GO:0032879", "GO:0050794", "GO:0051283", "GO:0034220", "GO:0051282", "GO:0098660", "GO:0006810", "GO:0098655", "GO:0051209", "GO:0071702", "GO:0098662", "GO:0006811", "GO:0070588", "GO:0006816", "GO:0006812", "GO:1903514", "GO:0014808", "GO:0097553", "GO:0030001", "GO:0070296" ]
[ "GO:0003674", "GO:0005488", "GO:0015643" ]
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0016020", "GO:0005737", "GO:0012505", "GO:0031984", "GO:0005783", "GO:0043229", "GO:0016528", "GO:0043227", "GO:0098827", "GO:0016529", "GO:0043231", "GO:0014802" ]
[ "IPR001870", "IPR043136", "IPR013320", "IPR011992", "IPR005821", "IPR036300", "IPR016093", "IPR013662", "IPR000699", "IPR013333", "IPR015925", "IPR003032", "IPR009460", "IPR048581", "IPR035910", "IPR035761", "IPR035764", "IPR035762", "IPR003877" ]
null
8022.A0A060WZC7
[ "8022.A0A060XT19", "8022.A0A060VV08", "8022.A0A060YI40", "8022.A0A060W552", "8022.A0A060WND2", "8022.A0A060W7T8", "8022.A0A060WVU0", "8022.A0A060WZJ2", "8022.A0A060ZCJ0", "8022.A0A060Y1F8", "8022.A0A060YSV0", "8022.C1BHS5", "8022.A0A060X1N4", "8022.A0A060X010", "8022.A0A060Y7R5", "8022.A0A060Y7X2", "8022.A0A060YSJ4", "8022.A0A060XPD1", "8022.A0A060WZU7", "8022.A0A060Y6N6", "8022.A0A060WA02", "8022.A0A060XLH8", "8022.A0A060Y2D4", "8022.A0A060VW65", "8022.A0A060X0K0", "8022.A0A060XVJ2", "8022.C1BFZ3", "8022.A0A060YC57", "8022.A0A060VRI3", "8022.A0A060Y0G1", "8022.A0A060WIX3" ]
[ { "protein2": "8022.A0A060XT19", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 528, "database": 431, "textmining": 86, "combined_score": 733 }, { "protein2": "8022.A0A060VV08", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 534, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060YI40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 504, "textmining": 86, "combined_score": 704 }, { "protein2": "8022.A0A060W552", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 374, "database": 504, "textmining": 125, "combined_score": 711 }, { "protein2": "8022.A0A060WND2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 0, "database": 825, "textmining": 85, "combined_score": 837 }, { "protein2": "8022.A0A060W7T8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 528, "database": 431, "textmining": 86, "combined_score": 733 }, { "protein2": "8022.A0A060WVU0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 528, "database": 431, "textmining": 86, "combined_score": 733 }, { "protein2": "8022.A0A060WZJ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 528, "database": 431, "textmining": 86, "combined_score": 733 }, { "protein2": "8022.A0A060ZCJ0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 528, "database": 431, "textmining": 86, "combined_score": 733 }, { "protein2": "8022.A0A060Y1F8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 504, "textmining": 86, "combined_score": 704 }, { "protein2": "8022.A0A060YSV0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 578, "database": 337, "textmining": 111, "combined_score": 729 }, { "protein2": "8022.C1BHS5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 598, "database": 342, "textmining": 115, "combined_score": 745 }, { "protein2": "8022.A0A060X1N4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 386, "database": 581, "textmining": 182, "combined_score": 771 }, { "protein2": "8022.A0A060X010", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 640, "database": 356, "textmining": 137, "combined_score": 782 }, { "protein2": "8022.A0A060Y7R5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 374, "database": 504, "textmining": 125, "combined_score": 711 }, { "protein2": "8022.A0A060Y7X2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 528, "database": 431, "textmining": 86, "combined_score": 733 }, { "protein2": "8022.A0A060YSJ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 528, "database": 431, "textmining": 86, "combined_score": 733 }, { "protein2": "8022.A0A060XPD1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 528, "database": 431, "textmining": 86, "combined_score": 733 }, { "protein2": "8022.A0A060WZU7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 640, "database": 356, "textmining": 137, "combined_score": 782 }, { "protein2": "8022.A0A060Y6N6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 640, "database": 356, "textmining": 137, "combined_score": 782 }, { "protein2": "8022.A0A060WA02", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 504, "textmining": 86, "combined_score": 704 }, { "protein2": "8022.A0A060XLH8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 528, "database": 431, "textmining": 86, "combined_score": 733 }, { "protein2": "8022.A0A060Y2D4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 386, "database": 577, "textmining": 89, "combined_score": 742 }, { "protein2": "8022.A0A060VW65", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 43, "combined_score": 832 }, { "protein2": "8022.A0A060X0K0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 598, "database": 342, "textmining": 115, "combined_score": 745 }, { "protein2": "8022.A0A060XVJ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 534, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.C1BFZ3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 640, "database": 356, "textmining": 137, "combined_score": 782 }, { "protein2": "8022.A0A060YC57", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 386, "database": 581, "textmining": 185, "combined_score": 772 }, { "protein2": "8022.A0A060VRI3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 374, "database": 504, "textmining": 125, "combined_score": 711 }, { "protein2": "8022.A0A060Y0G1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 528, "database": 431, "textmining": 86, "combined_score": 733 }, { "protein2": "8022.A0A060WIX3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 528, "database": 431, "textmining": 86, "combined_score": 733 } ]
A0A060XA63
Sodium/potassium-transporting ATPase subunit alpha
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
517
Cell membrane {ECO:0000256|RuleBase:RU362084}; Multi-pass membrane protein {ECO:0000256|RuleBase:RU362084}. Membrane {ECO:0000256|ARBA:ARBA00004370}.
MKGAPERILDRCSTILIQGKEQPLDDELKEAFQNAYEELGGLGERVLGFCHFQLPDDQFAEGFQFDCEEVNFPTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLKIPVSEVNPRDAKACVVHGGELKDLSAEQLDDILAHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEEAENDIMKRQPRNPKTDKLVNERLISIAYGQIGMMQATAGFFTYFVILAENGFLPMDLLGMRVDWDNKIMNDMEDSYGQQWTYERRKIVEFTCHTAFFASIVVVQWADLIICKTRRNSILQQGMKNRILIFGLFEETALAVFLSYCPGMDVALRMYPLKPCWWFCALPYSLLIFLYDEGRRYILRRNPGGWVEQETYY
[ "GO:0006970", "GO:0043434", "GO:1901652", "GO:0009628", "GO:1901700", "GO:0009651", "GO:0006950", "GO:0008150", "GO:0042538", "GO:0042221", "GO:0010243", "GO:0050896", "GO:1901698", "GO:0010033", "GO:0009725", "GO:0060416", "GO:0009719", "GO:0006972", "GO:0015399", "GO:0008556", "GO:0008554", "GO:0015079", "GO:0140358", "GO:0022890", "GO:0005215", "GO:0015662", "GO:1901702", "GO:0022853", "GO:0042626", "GO:0015075", "GO:0005391", "GO:0022857", "GO:0015318", "GO:0008324", "GO:0140657", "GO:0046873", "GO:0015081", "GO:0003674", "GO:0019829", "GO:0022804" ]
[ "GO:0008150", "GO:0050896", "GO:0009628", "GO:0006950", "GO:0042221", "GO:0009719", "GO:0006970", "GO:1901700", "GO:1901698", "GO:0010033", "GO:0009725", "GO:0043434", "GO:1901652", "GO:0009651", "GO:0010243", "GO:0006972", "GO:0042538", "GO:0060416" ]
[ "GO:0003674", "GO:0005215", "GO:0140657", "GO:0042626", "GO:0022857", "GO:0140358", "GO:1901702", "GO:0015075", "GO:0015318", "GO:0019829", "GO:0022804", "GO:0015399", "GO:0008556", "GO:0008554", "GO:0015079", "GO:0022890", "GO:0015662", "GO:0022853", "GO:0008324", "GO:0015081", "GO:0005391", "GO:0046873" ]
null
[ "IPR006068", "IPR023299", "IPR023298", "IPR050510", "IPR036412", "IPR023214", "IPR005775", "IPR001757" ]
af_db/AF-A0A060XA63-F1-model_v4.cif.gz
8022.A0A060XA63
[ "8022.A0A060XAY3", "8022.A0A060YXW3", "8022.A0A060Z8B0", "8022.A0A060WM21", "8022.A0A060W5G5", "8022.A0A060ZAX9", "8022.A0A060YU43", "8022.A0A060W616", "8022.A0A060VV08", "8022.A0A060XUR5", "8022.A0A060VMX9", "8022.A0A060Z7D4", "8022.A0A060ZIV0", "8022.A0A060XCM7", "8022.A0A060WZD8", "8022.A0A060VYP9", "8022.A0A060YEQ6", "8022.A0A060YI40", "8022.A0A060XM52", "8022.A0A060YFB0", "8022.A0A060Z2N8", "8022.A0A060VTX4", "8022.A0A060XVJ2", "8022.A0A060YYE6", "8022.A0A060WA02", "8022.A0A061AEV5", "8022.A0A060Y1F8", "8022.A0A060YJV3", "8022.A0A060YM41", "8022.A0A060ZL40", "8022.A0A060Z640", "8022.A0A060XKC6", "8022.A0A060X014", "8022.A0A060Y7Y8" ]
[ { "protein2": "8022.A0A060XAY3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 719, "textmining": 99, "combined_score": 869 }, { "protein2": "8022.A0A060YXW3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060Z8B0", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A060WM21", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 574, "textmining": 108, "combined_score": 804 }, { "protein2": "8022.A0A060W5G5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 574, "textmining": 108, "combined_score": 804 }, { "protein2": "8022.A0A060ZAX9", "neighborhood": 0, "fusion": 0, "cooccurence": 533, "coexpression": 0, "experimental": 0, "database": 530, "textmining": 0, "combined_score": 771 }, { "protein2": "8022.A0A060YU43", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060W616", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 574, "textmining": 108, "combined_score": 804 }, { "protein2": "8022.A0A060VV08", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 783, "textmining": 86, "combined_score": 795 }, { "protein2": "8022.A0A060XUR5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060VMX9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 574, "textmining": 120, "combined_score": 807 }, { "protein2": "8022.A0A060Z7D4", "neighborhood": 0, "fusion": 0, "cooccurence": 535, "coexpression": 0, "experimental": 0, "database": 586, "textmining": 0, "combined_score": 799 }, { "protein2": "8022.A0A060ZIV0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 681, "database": 569, "textmining": 144, "combined_score": 876 }, { "protein2": "8022.A0A060XCM7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 788, "textmining": 156, "combined_score": 907 }, { "protein2": "8022.A0A060WZD8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 660, "database": 451, "textmining": 88, "combined_score": 814 }, { "protein2": "8022.A0A060VYP9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 614, "database": 510, "textmining": 198, "combined_score": 835 }, { "protein2": "8022.A0A060YEQ6", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A060YI40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 750 }, { "protein2": "8022.A0A060XM52", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060YFB0", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A060Z2N8", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A060VTX4", "neighborhood": 0, "fusion": 0, "cooccurence": 536, "coexpression": 0, "experimental": 0, "database": 530, "textmining": 0, "combined_score": 772 }, { "protein2": "8022.A0A060XVJ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 783, "textmining": 86, "combined_score": 795 }, { "protein2": "8022.A0A060YYE6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 699, "database": 671, "textmining": 178, "combined_score": 913 }, { "protein2": "8022.A0A060WA02", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 764, "textmining": 86, "combined_score": 777 }, { "protein2": "8022.A0A061AEV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 699, "database": 671, "textmining": 178, "combined_score": 913 }, { "protein2": "8022.A0A060Y1F8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 750 }, { "protein2": "8022.A0A060YJV3", "neighborhood": 0, "fusion": 0, "cooccurence": 533, "coexpression": 0, "experimental": 0, "database": 530, "textmining": 0, "combined_score": 771 }, { "protein2": "8022.A0A060YM41", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 829, "textmining": 73, "combined_score": 840 }, { "protein2": "8022.A0A060ZL40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 681, "database": 569, "textmining": 144, "combined_score": 876 }, { "protein2": "8022.A0A060Z640", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060XKC6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 429, "textmining": 87, "combined_score": 731 }, { "protein2": "8022.A0A060X014", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 516, "database": 719, "textmining": 99, "combined_score": 869 }, { "protein2": "8022.A0A060Y7Y8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 62, "experimental": 699, "database": 671, "textmining": 178, "combined_score": 913 } ]
A0A060XXJ7
Glycogen [starch] synthase (EC 2.4.1.11)
Glycogen synthase participates in the glycogen biosynthetic process along with glycogenin and glycogen branching enzyme. Extends the primer composed of a few glucose units formed by glycogenin by adding new glucose units to it. In this context, glycogen synthase transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan. {ECO:0000256|ARBA:ARBA00043883}.; FUNCTION: Transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan. {ECO:0000256|RuleBase:RU363104}.
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
696
null
FFFATQPRRPASQSCLFTVDVETGVFLVLFNEAAMGGIYTVIQTKAKITVDEWGENLFMMGPYYEHNFNTQVEQCEPPNPAIKKAMGALIDNGCLVYFGRWLIEGSPYVILFDTGSAAWNLDRWKGDLWDTCGIGMPAHDREANDSLLFGSMVAWFFKELTDELGDSPNVLAHFHEWQVGAGLILCRSRKIPLATIFTTHATLLGRYICAGNVDFYNNLDKFNIDQEAGERQIYHRYCLERAAVHCAHVFTTVSQITAVEANHMLHRKPDVVTPNGLNIKKFSAMHEFQNLHSTNKGQIQEFIRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGVDIFLESLSRLNYLLRVHKNDVTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHTVKDKFGKRLYEALLKGDIPDMNTILDRDDFTIMKRAIYATQRHTLPPVTTHNMLDDTSDPILANVRRIGLFNARTDRVKIVFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFMEEHVSDPTAYGIYIVDRRFRSADDSCNQLTQFMFGFCQQSRRQRIIQRNRTERLSDLLDWRYLGRFYMHARSLALSRAFPDKFKMEPLAPPQTEGFRYPRPGSVPPSPSVSVHSTPHHSDEEDDEEPYDEDMEAERDRQNIKAPFTLGATPEGKKTHPGESAN
[ "GO:0043434", "GO:1901652", "GO:0032868", "GO:0009743", "GO:1901700", "GO:0006950", "GO:0008150", "GO:0042221", "GO:0010243", "GO:0050896", "GO:1901698", "GO:0010033", "GO:0009725", "GO:0090664", "GO:0009719", "GO:0034284", "GO:0032501", "GO:0009749", "GO:0009746", "GO:0009011", "GO:0046527", "GO:0016740", "GO:0003674", "GO:0003824", "GO:0016757", "GO:0016758" ]
[ "GO:0008150", "GO:0050896", "GO:0032501", "GO:0006950", "GO:0042221", "GO:0090664", "GO:0009719", "GO:1901700", "GO:1901698", "GO:0010033", "GO:0009725", "GO:0043434", "GO:1901652", "GO:0009743", "GO:0010243", "GO:0032868", "GO:0034284", "GO:0009746", "GO:0009749" ]
[ "GO:0003674", "GO:0003824", "GO:0016740", "GO:0016757", "GO:0016758", "GO:0046527", "GO:0009011" ]
null
[ "IPR008631" ]
af_db/AF-A0A060XXJ7-F1-model_v4.cif.gz
8022.A0A060XXJ7
[ "8022.A0A060WYJ9", "8022.A0A060YIP8", "8022.A0A060WRI4", "8022.A0A060X2M1", "8022.A0A060Y8P1", "8022.A0A060YMT8", "8022.A0A060XV67", "8022.A0A060XDC6", "8022.A0A060XS00", "8022.A0A060W1Z0", "8022.A0A060Y5X7", "8022.A0A060YIM7", "8022.A0A060ZAN1", "8022.A0A060YX04", "8022.A0A060X7K4", "8022.A0A060WM17", "8022.A0A060XZP7", "8022.A0A060XJT2", "8022.A0A060YVM7", "8022.A0A060XZ37", "8022.A0A060ZEK4", "8022.A0A060YH61", "8022.A0A060W2G6", "8022.A0A060YVA7", "8022.A0A060WUC8", "8022.A0A060X323", "8022.A0A060XT37", "8022.A0A060Y1F8", "8022.A0A060X0Y1", "8022.A0A060WIJ8", "8022.A0A060XRD2", "8022.A0A060X616", "8022.A0A060Y6W1", "8022.A0A060VTF9", "8022.A0A060WIJ2", "8022.A0A060X8N3", "8022.A0A060XKP6", "8022.A0A060Z4R9", "8022.A0A060Z5F5", "8022.A0A060YL26", "8022.A0A060X713", "8022.A0A060WQ25", "8022.A0A060WLB7", "8022.A0A060VUU1", "8022.A0A060XSN8", "8022.A0A060ZNH6", "8022.A0A060XH06", "8022.A0A060Y5I2", "8022.A0A060XXN7", "8022.A0A060Z5F3", "8022.A0A060WEI1", "8022.A0A060WQP2", "8022.A0A060XVJ2", "8022.A0A060WHB4", "8022.A0A060Z1C5", "8022.A0A060VZV0", "8022.A0A060YTQ2", "8022.A0A060VWG1", "8022.A0A060YL98", "8022.A0A060XU63", "8022.A0A060Y534", "8022.A0A060XNY0", "8022.A0A060WH90", "8022.A0A060XSM8", "8022.A0A060YTG3", "8022.A0A060YNX7", "8022.A0A060VUY5", "8022.A0A060X1P8", "8022.A0A060YMQ1", "8022.A0A060W283", "8022.A0A061ADV4", "8022.A0A060YFV0", "8022.A0A060YQV7", "8022.A0A060YDL6", "8022.A0A060YV74", "8022.A0A060YAF5", "8022.A0A060XUT6", "8022.A0A060Y0T0", "8022.A0A060WA02", "8022.A0A060X8L2", "8022.A0A060WZJ0", "8022.A0A060YFS3", "8022.A0A060YZG3", "8022.A0A060YFA7", "8022.A0A060XT54", "8022.A0A060YBJ4", "8022.A0A060Y786", "8022.A0A060W0B2", "8022.A0A060WLM0", "8022.A0A060XV30", "8022.A0A060XD51", "8022.A0A060Y609", "8022.A0A060Y709", "8022.A0A060VZH4", "8022.A0A060XRX7", "8022.A0A060Y2C4", "8022.A0A061A4H1", "8022.A0A060XG53", "8022.A0A060WVD8", "8022.A0A060Y501", "8022.A0A060VWH8", "8022.A0A060VVL9", "8022.A0A060WT58", "8022.A0A060XTP5", "8022.A0A060XS33", "8022.A0A060XEX3", "8022.A0A060XSY3", "8022.A0A060WIW7", "8022.A0A060Y7A8", "8022.A0A060W866", "8022.A0A060XSB7", "8022.A0A060YFV9", "8022.A0A060WPP2", "8022.A0A060Z9N9", "8022.A0A060WN87", "8022.A0A060WW06", "8022.A0A060YSL4", "8022.A0A060Z3H1", "8022.A0A060Y3N1", "8022.A0A060W8A2", "8022.A0A060Y7X3", "8022.A0A060Z1E1", "8022.A0A060XPD8", "8022.Q91381", "8022.A0A060XLL5", "8022.A0A060XTV9", "8022.A0A060XC32", "8022.A0A060WW97", "8022.A0A060XUP8", "8022.A0A060Y4C1", "8022.A0A060WGP6", "8022.A0A060VTH4", "8022.A0A060W7I7", "8022.A0A060YBV8", "8022.A0A060YBX5", "8022.C1BGD2", "8022.A0A060VMQ1", "8022.A0A060XW24", "8022.A0A060WSG3", "8022.A0A060W0M8", "8022.A0A060YL36", "8022.A0A060VSR1", "8022.A0A060VX16", "8022.A0A060YH63", "8022.A0A060ZF19", "8022.A0A060X514", "8022.A0A060YJA5", "8022.A0A060YLW3", "8022.A0A060W2L4", "8022.A0A060XIF0", "8022.C1BI55", "8022.A0A060XER1", "8022.A0A060Y7D9", "8022.A0A060W299", "8022.A0A060YEQ2", "8022.A0A061A6F9", "8022.A0A060Y189", "8022.A0A060X8J0", "8022.A0A060Z6M0", "8022.A0A060VRS4", "8022.A0A060YE51", "8022.A0A060XLG3", "8022.A0A060VZ75", "8022.A0A060YXZ4", "8022.A0A060VZK5", "8022.A0A060X3J8", "8022.A0A060YAU7", "8022.A0A060YBC9", "8022.A0A060W6I3", "8022.A0A060W3W4", "8022.A0A060XG99", "8022.A0A060W7G4", "8022.A0A060YB62", "8022.A0A060VVS9", "8022.A0A060WKQ0", "8022.A0A060XFQ4", "8022.A0A060XN85", "8022.A0A060Z7M7", "8022.A0A060VTG5", "8022.A0A060ZCK7", "8022.A0A060Z909", "8022.A0A060WAZ8", "8022.A0A060VPT7", "8022.A0A060WNW6", "8022.A0A060X8J2", "8022.A0A060WVF2", "8022.A0A060VY18", "8022.A0A060Y703", "8022.A0A060VUC1", "8022.A0A060VZV9", "8022.A0A060XF64", "8022.A0A060XXT9", "8022.A0A060YWZ4", "8022.A0A060X4I5", "8022.A0A060X549", "8022.A0A060YT42", "8022.A0A060WA73", "8022.A0A060XSA5", "8022.A0A060XYQ2", "8022.A0A060WIM8", "8022.A0A060W5K0", "8022.A0A060ZGG9", "8022.A0A060WBX7", "8022.A0A060W580", "8022.A0A060YK16", "8022.A0A060ZY85", "8022.A0A060Y572", "8022.A0A060VV08", "8022.A0A060Y7J3", "8022.A0A060XEQ2", "8022.A0A060YNN1", "8022.A0A060YY15", "8022.A0A060YRA4", "8022.A0A060YBG4", "8022.A0A060W0X7", "8022.A0A060Y8H0", "8022.A0A060ZI18", "8022.A0A060YP62", "8022.A0A060XIQ6", "8022.A0A060YZR7", "8022.A0A060YRP0", "8022.A0A060XXY2", "8022.A0A060WIP0", "8022.A0A060Y9P2", "8022.A0A060W322", "8022.A0A060WA27", "8022.A0A060WHM3", "8022.A0A060YI57", "8022.A0A060W4Y9", "8022.A0A060XHI7", "8022.A0A060ZLI0", "8022.A0A060X5X8", "8022.A0A060VYX3", "8022.A0A060VU13", "8022.A0A060W897", "8022.A0A060Y9R0", "8022.A0A060XX90", "8022.A0A060WVL3", "8022.A0A060WPA9", "8022.A0A060ZHP3", "8022.A0A060XAY0", "8022.A0A060WWG8", "8022.A0A060WS82", "8022.A0A060VX13", "8022.A0A060W352", "8022.A0A060WVE9", "8022.A0A060WWN6", "8022.A0A060X6L1", "8022.A0A060Y2F6", "8022.A0A061AE56", "8022.A0A061A5I3", "8022.A0A060W782", "8022.A0A060XBG1", "8022.A0A060VPV4", "8022.A0A060WWC7", "8022.A0A060XY19", "8022.A0A060X451", "8022.A0A060WXT5", "8022.A0A060W1M5", "8022.A0A060WL30", "8022.A0A060X5Z6", "8022.A0A060Y002", "8022.A0A060XQN1", "8022.A0A060XLE7", "8022.A0A060WEB4", "8022.A0A060W1W2", "8022.A0A060Y374", "8022.A0A060YT31", "8022.A0A060XQ68", "8022.A0A060XQV6", "8022.A0A060XR98", "8022.A0A060WRU8", "8022.C1BFE0", "8022.A0A060WR68", "8022.A0A060W6P2", "8022.A0A060YZH2", "8022.A0A060Y7N3", "8022.A0A061AFP5", "8022.A0A060Y457", "8022.A0A060X6C1", "8022.A0A060Z1V4", "8022.A0A060YEI0", "8022.A0A060ZFF2", "8022.A0A060YN45", "8022.A0A060X7E8", "8022.A0A060WBI8", "8022.A0A060YI40", "8022.A0A060WUV7", "8022.A0A060YC16", "8022.A0A060ZEV1", "8022.A0A060XLD9", "8022.A0A060Z5S7", "8022.A0A060XFS5", "8022.A0A060Z2G8", "8022.A0A060WG87", "8022.A0A060XAF0", "8022.A0A060Y0X3", "8022.A0A060XUG1", "8022.A0A060VQU3", "8022.A0A060X106", "8022.A0A060XRG4", "8022.A0A060WEA8", "8022.A0A060W448", "8022.A0A060VPR7", "8022.A0A060YPM2", "8022.A0A060XAK7", "8022.A0A060Y4H0", "8022.A0A060Z3J9", "8022.A0A060X554", "8022.A0A060WSC1", "8022.A0A060WB43", "8022.A0A060WMB2", "8022.A0A061AEK9", "8022.A0A060Y6Z6", "8022.A0A060WZ37", "8022.A0A060WPP4", "8022.A0A060WXS1", "8022.A0A060XV20", "8022.A0A060Y539", "8022.C1BEI8", "8022.A0A060WTE4", "8022.A0A060WKM3", "8022.A0A060WLZ5", "8022.C1BHD2", "8022.O57399", "8022.A0A060XRV8", "8022.A0A060YTP7", "8022.A0A060XZF7", "8022.A0A060YGT3", "8022.A0A060WSY5", "8022.A0A060Z6P1", "8022.A0A060XNW5", "8022.A0A060X4P1", "8022.A0A060Z2E0", "8022.A0A060YU85" ]
[ { "protein2": "8022.A0A060WYJ9", "neighborhood": 157, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 0, "combined_score": 846 }, { "protein2": "8022.A0A060YIP8", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060WRI4", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 358, "database": 444, "textmining": 221, "combined_score": 701 }, { "protein2": "8022.A0A060X2M1", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 757, "database": 829, "textmining": 309, "combined_score": 969 }, { "protein2": "8022.A0A060Y8P1", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 790, "textmining": 136, "combined_score": 812 }, { "protein2": "8022.A0A060YMT8", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 825, "experimental": 342, "database": 523, "textmining": 432, "combined_score": 968 }, { "protein2": "8022.A0A060XV67", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060XDC6", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 825, "experimental": 342, "database": 523, "textmining": 432, "combined_score": 968 }, { "protein2": "8022.A0A060XS00", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 771, "database": 835, "textmining": 278, "combined_score": 973 }, { "protein2": "8022.A0A060W1Z0", "neighborhood": 164, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 0, "database": 518, "textmining": 450, "combined_score": 764 }, { "protein2": "8022.A0A060Y5X7", "neighborhood": 115, "fusion": 0, "cooccurence": 0, "coexpression": 122, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 745 }, { "protein2": "8022.A0A060YIM7", "neighborhood": 141, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 826, "textmining": 210, "combined_score": 871 }, { "protein2": "8022.A0A060ZAN1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 731, "database": 0, "textmining": 86, "combined_score": 743 }, { "protein2": "8022.A0A060YX04", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 156, "experimental": 942, "database": 830, "textmining": 504, "combined_score": 995 }, { "protein2": "8022.A0A060X7K4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 0, "database": 790, "textmining": 130, "combined_score": 818 }, { "protein2": "8022.A0A060WM17", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 274, "database": 823, "textmining": 193, "combined_score": 888 }, { "protein2": "8022.A0A060XZP7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 120, "experimental": 317, "database": 827, "textmining": 115, "combined_score": 895 }, { "protein2": "8022.A0A060XJT2", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060YVM7", "neighborhood": 110, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 651, "textmining": 231, "combined_score": 766 }, { "protein2": "8022.A0A060XZ37", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060ZEK4", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060YH61", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 120, "experimental": 317, "database": 827, "textmining": 115, "combined_score": 895 }, { "protein2": "8022.A0A060W2G6", "neighborhood": 162, "fusion": 0, "cooccurence": 0, "coexpression": 140, "experimental": 0, "database": 772, "textmining": 356, "combined_score": 880 }, { "protein2": "8022.A0A060YVA7", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 790, "textmining": 136, "combined_score": 812 }, { "protein2": "8022.A0A060WUC8", "neighborhood": 154, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 173, "database": 649, "textmining": 454, "combined_score": 941 }, { "protein2": "8022.A0A060X323", "neighborhood": 143, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 660, "textmining": 308, "combined_score": 803 }, { "protein2": "8022.A0A060XT37", "neighborhood": 115, "fusion": 0, "cooccurence": 0, "coexpression": 122, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 745 }, { "protein2": "8022.A0A060Y1F8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 281, "experimental": 0, "database": 829, "textmining": 155, "combined_score": 887 }, { "protein2": "8022.A0A060X0Y1", "neighborhood": 154, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 173, "database": 649, "textmining": 454, "combined_score": 941 }, { "protein2": "8022.A0A060WIJ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 731, "database": 0, "textmining": 86, "combined_score": 743 }, { "protein2": "8022.A0A060XRD2", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 693, "textmining": 139, "combined_score": 756 }, { "protein2": "8022.A0A060X616", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060Y6W1", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 170, "experimental": 0, "database": 569, "textmining": 308, "combined_score": 734 }, { "protein2": "8022.A0A060VTF9", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 0, "database": 790, "textmining": 130, "combined_score": 818 }, { "protein2": "8022.A0A060WIJ2", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 757, "database": 829, "textmining": 309, "combined_score": 969 }, { "protein2": "8022.A0A060X8N3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060XKP6", "neighborhood": 100, "fusion": 0, "cooccurence": 0, "coexpression": 44, "experimental": 0, "database": 700, "textmining": 340, "combined_score": 806 }, { "protein2": "8022.A0A060Z4R9", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 632, "textmining": 220, "combined_score": 735 }, { "protein2": "8022.A0A060Z5F5", "neighborhood": 43, "fusion": 0, "cooccurence": 0, "coexpression": 167, "experimental": 0, "database": 437, "textmining": 504, "combined_score": 747 }, { "protein2": "8022.A0A060YL26", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 532, "database": 826, "textmining": 308, "combined_score": 942 }, { "protein2": "8022.A0A060X713", "neighborhood": 110, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 651, "textmining": 231, "combined_score": 766 }, { "protein2": "8022.A0A060WQ25", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 766, "database": 839, "textmining": 265, "combined_score": 972 }, { "protein2": "8022.A0A060WLB7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 316, "database": 568, "textmining": 87, "combined_score": 722 }, { "protein2": "8022.A0A060VUU1", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 790, "textmining": 136, "combined_score": 812 }, { "protein2": "8022.A0A060XSN8", "neighborhood": 93, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 178, "database": 640, "textmining": 208, "combined_score": 758 }, { "protein2": "8022.A0A060ZNH6", "neighborhood": 141, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 826, "textmining": 210, "combined_score": 871 }, { "protein2": "8022.A0A060XH06", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 841, "textmining": 136, "combined_score": 858 }, { "protein2": "8022.A0A060Y5I2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 0, "database": 772, "textmining": 0, "combined_score": 778 }, { "protein2": "8022.A0A060XXN7", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 790, "textmining": 136, "combined_score": 812 }, { "protein2": "8022.A0A060Z5F3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 504, "database": 825, "textmining": 275, "combined_score": 935 }, { "protein2": "8022.A0A060WEI1", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 862, "textmining": 136, "combined_score": 876 }, { "protein2": "8022.A0A060WQP2", "neighborhood": 154, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 173, "database": 649, "textmining": 454, "combined_score": 941 }, { "protein2": "8022.A0A060XVJ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 281, "experimental": 0, "database": 829, "textmining": 155, "combined_score": 887 }, { "protein2": "8022.A0A060WHB4", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 632, "textmining": 220, "combined_score": 735 }, { "protein2": "8022.A0A060Z1C5", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 825, "experimental": 342, "database": 523, "textmining": 432, "combined_score": 968 }, { "protein2": "8022.A0A060VZV0", "neighborhood": 144, "fusion": 0, "cooccurence": 0, "coexpression": 222, "experimental": 182, "database": 630, "textmining": 191, "combined_score": 807 }, { "protein2": "8022.A0A060YTQ2", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 757, "database": 832, "textmining": 309, "combined_score": 969 }, { "protein2": "8022.A0A060VWG1", "neighborhood": 144, "fusion": 0, "cooccurence": 0, "coexpression": 222, "experimental": 182, "database": 630, "textmining": 191, "combined_score": 807 }, { "protein2": "8022.A0A060YL98", "neighborhood": 162, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 772, "textmining": 365, "combined_score": 878 }, { "protein2": "8022.A0A060XU63", "neighborhood": 53, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 158, "database": 602, "textmining": 270, "combined_score": 741 }, { "protein2": "8022.A0A060Y534", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 272, "experimental": 0, "database": 825, "textmining": 134, "combined_score": 880 }, { "protein2": "8022.A0A060XNY0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 120, "experimental": 317, "database": 816, "textmining": 115, "combined_score": 889 }, { "protein2": "8022.A0A060WH90", "neighborhood": 93, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 178, "database": 640, "textmining": 208, "combined_score": 758 }, { "protein2": "8022.A0A060XSM8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 244, "database": 693, "textmining": 308, "combined_score": 825 }, { "protein2": "8022.A0A060YTG3", "neighborhood": 93, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 178, "database": 640, "textmining": 208, "combined_score": 758 }, { "protein2": "8022.A0A060YNX7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060VUY5", "neighborhood": 142, "fusion": 0, "cooccurence": 0, "coexpression": 374, "experimental": 321, "database": 835, "textmining": 505, "combined_score": 964 }, { "protein2": "8022.A0A060X1P8", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 757, "database": 829, "textmining": 309, "combined_score": 969 }, { "protein2": "8022.A0A060YMQ1", "neighborhood": 155, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 612, "textmining": 260, "combined_score": 780 }, { "protein2": "8022.A0A060W283", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 0, "database": 790, "textmining": 130, "combined_score": 818 }, { "protein2": "8022.A0A061ADV4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 771, "database": 839, "textmining": 278, "combined_score": 973 }, { "protein2": "8022.A0A060YFV0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 696, "database": 829, "textmining": 87, "combined_score": 950 }, { "protein2": "8022.A0A060YQV7", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060YDL6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 450, "combined_score": 899 }, { "protein2": "8022.A0A060YV74", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 361, "database": 825, "textmining": 450, "combined_score": 933 }, { "protein2": "8022.A0A060YAF5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 120, "experimental": 317, "database": 827, "textmining": 115, "combined_score": 895 }, { "protein2": "8022.A0A060XUT6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060Y0T0", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060WA02", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 281, "experimental": 0, "database": 829, "textmining": 155, "combined_score": 887 }, { "protein2": "8022.A0A060X8L2", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 358, "database": 444, "textmining": 221, "combined_score": 701 }, { "protein2": "8022.A0A060WZJ0", "neighborhood": 110, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 651, "textmining": 231, "combined_score": 766 }, { "protein2": "8022.A0A060YFS3", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060YZG3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 156, "experimental": 942, "database": 830, "textmining": 504, "combined_score": 995 }, { "protein2": "8022.A0A060YFA7", "neighborhood": 141, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 826, "textmining": 210, "combined_score": 871 }, { "protein2": "8022.A0A060XT54", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 281, "experimental": 0, "database": 826, "textmining": 155, "combined_score": 885 }, { "protein2": "8022.A0A060YBJ4", "neighborhood": 141, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 826, "textmining": 210, "combined_score": 871 }, { "protein2": "8022.A0A060Y786", "neighborhood": 93, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 178, "database": 640, "textmining": 208, "combined_score": 758 }, { "protein2": "8022.A0A060W0B2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 731, "database": 0, "textmining": 86, "combined_score": 743 }, { "protein2": "8022.A0A060WLM0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 51, "experimental": 834, "database": 421, "textmining": 262, "combined_score": 923 }, { "protein2": "8022.A0A060XV30", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 771, "database": 835, "textmining": 278, "combined_score": 973 }, { "protein2": "8022.A0A060XD51", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 825, "experimental": 342, "database": 523, "textmining": 432, "combined_score": 968 }, { "protein2": "8022.A0A060Y609", "neighborhood": 110, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 651, "textmining": 231, "combined_score": 766 }, { "protein2": "8022.A0A060Y709", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 731, "database": 0, "textmining": 86, "combined_score": 743 }, { "protein2": "8022.A0A060VZH4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060XRX7", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 757, "database": 832, "textmining": 309, "combined_score": 969 }, { "protein2": "8022.A0A060Y2C4", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 757, "database": 829, "textmining": 309, "combined_score": 969 }, { "protein2": "8022.A0A061A4H1", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 790, "textmining": 136, "combined_score": 812 }, { "protein2": "8022.A0A060XG53", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060WVD8", "neighborhood": 154, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 173, "database": 649, "textmining": 454, "combined_score": 941 }, { "protein2": "8022.A0A060Y501", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 841, "textmining": 136, "combined_score": 858 }, { "protein2": "8022.A0A060VWH8", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 0, "database": 790, "textmining": 130, "combined_score": 818 }, { "protein2": "8022.A0A060VVL9", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 657, "textmining": 155, "combined_score": 702 }, { "protein2": "8022.A0A060WT58", "neighborhood": 154, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 173, "database": 649, "textmining": 454, "combined_score": 941 }, { "protein2": "8022.A0A060XTP5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 696, "database": 829, "textmining": 87, "combined_score": 950 }, { "protein2": "8022.A0A060XS33", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 244, "database": 693, "textmining": 308, "combined_score": 825 }, { "protein2": "8022.A0A060XEX3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 156, "experimental": 908, "database": 824, "textmining": 448, "combined_score": 991 }, { "protein2": "8022.A0A060XSY3", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 358, "database": 444, "textmining": 232, "combined_score": 705 }, { "protein2": "8022.A0A060WIW7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 120, "experimental": 317, "database": 816, "textmining": 115, "combined_score": 889 }, { "protein2": "8022.A0A060Y7A8", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 316, "database": 568, "textmining": 87, "combined_score": 722 }, { "protein2": "8022.A0A060W866", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 0, "database": 790, "textmining": 130, "combined_score": 818 }, { "protein2": "8022.A0A060XSB7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 0, "database": 772, "textmining": 0, "combined_score": 778 }, { "protein2": "8022.A0A060YFV9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 771, "database": 835, "textmining": 278, "combined_score": 973 }, { "protein2": "8022.A0A060WPP2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 771, "database": 835, "textmining": 278, "combined_score": 973 }, { "protein2": "8022.A0A060Z9N9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 696, "database": 829, "textmining": 87, "combined_score": 950 }, { "protein2": "8022.A0A060WN87", "neighborhood": 93, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 326, "database": 640, "textmining": 208, "combined_score": 802 }, { "protein2": "8022.A0A060WW06", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 274, "database": 828, "textmining": 193, "combined_score": 892 }, { "protein2": "8022.A0A060YSL4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 272, "experimental": 0, "database": 825, "textmining": 134, "combined_score": 880 }, { "protein2": "8022.A0A060Z3H1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 357, "database": 693, "textmining": 293, "combined_score": 848 }, { "protein2": "8022.A0A060Y3N1", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 825, "experimental": 342, "database": 523, "textmining": 432, "combined_score": 968 }, { "protein2": "8022.A0A060W8A2", "neighborhood": 162, "fusion": 0, "cooccurence": 0, "coexpression": 140, "experimental": 0, "database": 772, "textmining": 356, "combined_score": 880 }, { "protein2": "8022.A0A060Y7X3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060Z1E1", "neighborhood": 93, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 178, "database": 640, "textmining": 208, "combined_score": 758 }, { "protein2": "8022.A0A060XPD8", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 532, "database": 826, "textmining": 308, "combined_score": 942 }, { "protein2": "8022.Q91381", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060XLL5", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 170, "experimental": 0, "database": 569, "textmining": 308, "combined_score": 734 }, { "protein2": "8022.A0A060XTV9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 321, "database": 346, "textmining": 507, "combined_score": 761 }, { "protein2": "8022.A0A060XC32", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060WW97", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060XUP8", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060Y4C1", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 826, "textmining": 136, "combined_score": 844 }, { "protein2": "8022.A0A060WGP6", "neighborhood": 162, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 835, "textmining": 365, "combined_score": 904 }, { "protein2": "8022.A0A060VTH4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 0, "database": 790, "textmining": 130, "combined_score": 818 }, { "protein2": "8022.A0A060W7I7", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 632, "textmining": 220, "combined_score": 735 }, { "protein2": "8022.A0A060YBV8", "neighborhood": 100, "fusion": 0, "cooccurence": 0, "coexpression": 44, "experimental": 0, "database": 700, "textmining": 340, "combined_score": 806 }, { "protein2": "8022.A0A060YBX5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 156, "experimental": 908, "database": 824, "textmining": 448, "combined_score": 991 }, { "protein2": "8022.C1BGD2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 438, "database": 825, "textmining": 444, "combined_score": 940 }, { "protein2": "8022.A0A060VMQ1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 120, "experimental": 317, "database": 816, "textmining": 115, "combined_score": 889 }, { "protein2": "8022.A0A060XW24", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 731, "database": 0, "textmining": 86, "combined_score": 743 }, { "protein2": "8022.A0A060WSG3", "neighborhood": 108, "fusion": 0, "cooccurence": 0, "coexpression": 51, "experimental": 0, "database": 825, "textmining": 435, "combined_score": 905 }, { "protein2": "8022.A0A060W0M8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 771, "database": 832, "textmining": 278, "combined_score": 972 }, { "protein2": "8022.A0A060YL36", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 316, "database": 568, "textmining": 87, "combined_score": 722 }, { "protein2": "8022.A0A060VSR1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060VX16", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 787, "textmining": 0, "combined_score": 790 }, { "protein2": "8022.A0A060YH63", "neighborhood": 144, "fusion": 0, "cooccurence": 0, "coexpression": 222, "experimental": 182, "database": 630, "textmining": 191, "combined_score": 807 }, { "protein2": "8022.A0A060ZF19", "neighborhood": 156, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 115, "database": 835, "textmining": 433, "combined_score": 928 }, { "protein2": "8022.A0A060X514", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 786 }, { "protein2": "8022.A0A060YJA5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060YLW3", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 349, "combined_score": 751 }, { "protein2": "8022.A0A060W2L4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 504, "database": 825, "textmining": 275, "combined_score": 935 }, { "protein2": "8022.A0A060XIF0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 771, "database": 832, "textmining": 278, "combined_score": 972 }, { "protein2": "8022.C1BI55", "neighborhood": 162, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 835, "textmining": 365, "combined_score": 904 }, { "protein2": "8022.A0A060XER1", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 841, "textmining": 136, "combined_score": 858 }, { "protein2": "8022.A0A060Y7D9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 787, "textmining": 0, "combined_score": 790 }, { "protein2": "8022.A0A060W299", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 825, "experimental": 342, "database": 523, "textmining": 432, "combined_score": 968 }, { "protein2": "8022.A0A060YEQ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 159, "database": 693, "textmining": 150, "combined_score": 761 }, { "protein2": "8022.A0A061A6F9", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 693, "textmining": 139, "combined_score": 756 }, { "protein2": "8022.A0A060Y189", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 757, "database": 829, "textmining": 309, "combined_score": 969 }, { "protein2": "8022.A0A060X8J0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060Z6M0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 731, "database": 0, "textmining": 86, "combined_score": 743 }, { "protein2": "8022.A0A060VRS4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060YE51", "neighborhood": 43, "fusion": 0, "cooccurence": 0, "coexpression": 346, "experimental": 0, "database": 832, "textmining": 505, "combined_score": 940 }, { "protein2": "8022.A0A060XLG3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 696, "database": 829, "textmining": 87, "combined_score": 950 }, { "protein2": "8022.A0A060VZ75", "neighborhood": 142, "fusion": 0, "cooccurence": 0, "coexpression": 374, "experimental": 321, "database": 835, "textmining": 505, "combined_score": 964 }, { "protein2": "8022.A0A060YXZ4", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 632, "textmining": 220, "combined_score": 735 }, { "protein2": "8022.A0A060VZK5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 657, "textmining": 155, "combined_score": 702 }, { "protein2": "8022.A0A060X3J8", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 757, "database": 832, "textmining": 309, "combined_score": 969 }, { "protein2": "8022.A0A060YAU7", "neighborhood": 155, "fusion": 0, "cooccurence": 0, "coexpression": 218, "experimental": 0, "database": 660, "textmining": 273, "combined_score": 814 }, { "protein2": "8022.A0A060YBC9", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 632, "textmining": 220, "combined_score": 735 }, { "protein2": "8022.A0A060W6I3", "neighborhood": 141, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 210, "combined_score": 870 }, { "protein2": "8022.A0A060W3W4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 771, "database": 832, "textmining": 278, "combined_score": 972 }, { "protein2": "8022.A0A060XG99", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 46, "experimental": 454, "database": 825, "textmining": 450, "combined_score": 943 }, { "protein2": "8022.A0A060W7G4", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 787, "textmining": 136, "combined_score": 810 }, { "protein2": "8022.A0A060YB62", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 787, "textmining": 0, "combined_score": 790 }, { "protein2": "8022.A0A060VVS9", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 657, "textmining": 155, "combined_score": 702 }, { "protein2": "8022.A0A060WKQ0", "neighborhood": 128, "fusion": 0, "cooccurence": 0, "coexpression": 47, "experimental": 0, "database": 825, "textmining": 0, "combined_score": 841 }, { "protein2": "8022.A0A060XFQ4", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 825, "experimental": 342, "database": 523, "textmining": 432, "combined_score": 968 }, { "protein2": "8022.A0A060XN85", "neighborhood": 128, "fusion": 0, "cooccurence": 0, "coexpression": 47, "experimental": 0, "database": 825, "textmining": 0, "combined_score": 841 }, { "protein2": "8022.A0A060Z7M7", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 825, "experimental": 342, "database": 523, "textmining": 432, "combined_score": 968 }, { "protein2": "8022.A0A060VTG5", "neighborhood": 50, "fusion": 0, "cooccurence": 0, "coexpression": 780, "experimental": 174, "database": 645, "textmining": 391, "combined_score": 955 }, { "protein2": "8022.A0A060ZCK7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 120, "experimental": 317, "database": 816, "textmining": 115, "combined_score": 889 }, { "protein2": "8022.A0A060Z909", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 825, "experimental": 342, "database": 523, "textmining": 432, "combined_score": 968 }, { "protein2": "8022.A0A060WAZ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 771, "database": 835, "textmining": 278, "combined_score": 973 }, { "protein2": "8022.A0A060VPT7", "neighborhood": 143, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 660, "textmining": 276, "combined_score": 794 }, { "protein2": "8022.A0A060WNW6", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 532, "database": 862, "textmining": 308, "combined_score": 954 }, { "protein2": "8022.A0A060X8J2", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 632, "textmining": 220, "combined_score": 735 }, { "protein2": "8022.A0A060WVF2", "neighborhood": 93, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 326, "database": 640, "textmining": 208, "combined_score": 802 }, { "protein2": "8022.A0A060VY18", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 757, "database": 830, "textmining": 309, "combined_score": 969 }, { "protein2": "8022.A0A060Y703", "neighborhood": 144, "fusion": 0, "cooccurence": 0, "coexpression": 222, "experimental": 182, "database": 630, "textmining": 209, "combined_score": 811 }, { "protein2": "8022.A0A060VUC1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 88, "combined_score": 783 }, { "protein2": "8022.A0A060VZV9", "neighborhood": 144, "fusion": 0, "cooccurence": 0, "coexpression": 222, "experimental": 182, "database": 630, "textmining": 191, "combined_score": 807 }, { "protein2": "8022.A0A060XF64", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060XXT9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 731, "database": 0, "textmining": 86, "combined_score": 743 }, { "protein2": "8022.A0A060YWZ4", "neighborhood": 50, "fusion": 0, "cooccurence": 0, "coexpression": 780, "experimental": 174, "database": 645, "textmining": 391, "combined_score": 955 }, { "protein2": "8022.A0A060X4I5", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 790, "textmining": 136, "combined_score": 812 }, { "protein2": "8022.A0A060X549", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 0, "database": 790, "textmining": 130, "combined_score": 818 }, { "protein2": "8022.A0A060YT42", "neighborhood": 93, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 326, "database": 640, "textmining": 208, "combined_score": 802 }, { "protein2": "8022.A0A060WA73", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 274, "database": 823, "textmining": 193, "combined_score": 888 }, { "protein2": "8022.A0A060XSA5", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 0, "database": 790, "textmining": 130, "combined_score": 818 }, { "protein2": "8022.A0A060XYQ2", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 693, "textmining": 139, "combined_score": 756 }, { "protein2": "8022.A0A060WIM8", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 532, "database": 826, "textmining": 308, "combined_score": 942 }, { "protein2": "8022.A0A060W5K0", "neighborhood": 43, "fusion": 0, "cooccurence": 0, "coexpression": 346, "experimental": 0, "database": 841, "textmining": 505, "combined_score": 944 }, { "protein2": "8022.A0A060ZGG9", "neighborhood": 43, "fusion": 0, "cooccurence": 0, "coexpression": 167, "experimental": 0, "database": 437, "textmining": 504, "combined_score": 747 }, { "protein2": "8022.A0A060WBX7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060W580", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060YK16", "neighborhood": 156, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 115, "database": 835, "textmining": 433, "combined_score": 928 }, { "protein2": "8022.A0A060ZY85", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 0, "database": 790, "textmining": 130, "combined_score": 818 }, { "protein2": "8022.A0A060Y572", "neighborhood": 155, "fusion": 0, "cooccurence": 0, "coexpression": 218, "experimental": 0, "database": 660, "textmining": 273, "combined_score": 814 }, { "protein2": "8022.A0A060VV08", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 281, "experimental": 0, "database": 829, "textmining": 155, "combined_score": 887 }, { "protein2": "8022.A0A060Y7J3", "neighborhood": 155, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 612, "textmining": 260, "combined_score": 780 }, { "protein2": "8022.A0A060XEQ2", "neighborhood": 155, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 612, "textmining": 260, "combined_score": 780 }, { "protein2": "8022.A0A060YNN1", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 358, "database": 444, "textmining": 232, "combined_score": 705 }, { "protein2": "8022.A0A060YY15", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 825, "experimental": 342, "database": 523, "textmining": 432, "combined_score": 968 }, { "protein2": "8022.A0A060YRA4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 244, "database": 693, "textmining": 308, "combined_score": 825 }, { "protein2": "8022.A0A060YBG4", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060W0X7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 120, "experimental": 317, "database": 816, "textmining": 115, "combined_score": 889 }, { "protein2": "8022.A0A060Y8H0", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 505, "combined_score": 810 }, { "protein2": "8022.A0A060ZI18", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 156, "experimental": 908, "database": 824, "textmining": 448, "combined_score": 991 }, { "protein2": "8022.A0A060YP62", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 787, "textmining": 0, "combined_score": 790 }, { "protein2": "8022.A0A060XIQ6", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 532, "database": 832, "textmining": 308, "combined_score": 944 }, { "protein2": "8022.A0A060YZR7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 731, "database": 0, "textmining": 86, "combined_score": 743 }, { "protein2": "8022.A0A060YRP0", "neighborhood": 163, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 0, "database": 825, "textmining": 454, "combined_score": 915 }, { "protein2": "8022.A0A060XXY2", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 532, "database": 826, "textmining": 308, "combined_score": 942 }, { "protein2": "8022.A0A060WIP0", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060Y9P2", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060W322", "neighborhood": 155, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 612, "textmining": 260, "combined_score": 780 }, { "protein2": "8022.A0A060WA27", "neighborhood": 50, "fusion": 0, "cooccurence": 0, "coexpression": 780, "experimental": 174, "database": 645, "textmining": 391, "combined_score": 955 }, { "protein2": "8022.A0A060WHM3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 0, "database": 790, "textmining": 130, "combined_score": 818 }, { "protein2": "8022.A0A060YI57", "neighborhood": 141, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 826, "textmining": 210, "combined_score": 871 }, { "protein2": "8022.A0A060W4Y9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 771, "database": 835, "textmining": 278, "combined_score": 973 }, { "protein2": "8022.A0A060XHI7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060ZLI0", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 601, "experimental": 0, "database": 140, "textmining": 308, "combined_score": 773 }, { "protein2": "8022.A0A060X5X8", "neighborhood": 92, "fusion": 0, "cooccurence": 0, "coexpression": 151, "experimental": 115, "database": 602, "textmining": 258, "combined_score": 761 }, { "protein2": "8022.A0A060VYX3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060VU13", "neighborhood": 144, "fusion": 0, "cooccurence": 0, "coexpression": 222, "experimental": 182, "database": 630, "textmining": 209, "combined_score": 811 }, { "protein2": "8022.A0A060W897", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060Y9R0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 120, "experimental": 317, "database": 827, "textmining": 115, "combined_score": 895 }, { "protein2": "8022.A0A060XX90", "neighborhood": 50, "fusion": 0, "cooccurence": 0, "coexpression": 780, "experimental": 174, "database": 645, "textmining": 391, "combined_score": 955 }, { "protein2": "8022.A0A060WVL3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 787, "textmining": 0, "combined_score": 790 }, { "protein2": "8022.A0A060WPA9", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 170, "experimental": 0, "database": 569, "textmining": 308, "combined_score": 734 }, { "protein2": "8022.A0A060ZHP3", "neighborhood": 144, "fusion": 0, "cooccurence": 0, "coexpression": 222, "experimental": 182, "database": 630, "textmining": 191, "combined_score": 807 }, { "protein2": "8022.A0A060XAY0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060WWG8", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 0, "database": 790, "textmining": 130, "combined_score": 818 }, { "protein2": "8022.A0A060WS82", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 731, "database": 0, "textmining": 86, "combined_score": 743 }, { "protein2": "8022.A0A060VX13", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 120, "experimental": 317, "database": 827, "textmining": 115, "combined_score": 895 }, { "protein2": "8022.A0A060W352", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060WVE9", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 601, "experimental": 0, "database": 140, "textmining": 308, "combined_score": 773 }, { "protein2": "8022.A0A060WWN6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 766, "database": 839, "textmining": 265, "combined_score": 972 }, { "protein2": "8022.A0A060X6L1", "neighborhood": 139, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 53, "database": 693, "textmining": 308, "combined_score": 803 }, { "protein2": "8022.A0A060Y2F6", "neighborhood": 143, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 660, "textmining": 276, "combined_score": 794 }, { "protein2": "8022.A0A061AE56", "neighborhood": 144, "fusion": 0, "cooccurence": 0, "coexpression": 222, "experimental": 182, "database": 630, "textmining": 191, "combined_score": 807 }, { "protein2": "8022.A0A061A5I3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 156, "experimental": 942, "database": 862, "textmining": 504, "combined_score": 996 }, { "protein2": "8022.A0A060W782", "neighborhood": 92, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 115, "database": 602, "textmining": 498, "combined_score": 836 }, { "protein2": "8022.A0A060XBG1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 120, "experimental": 317, "database": 816, "textmining": 115, "combined_score": 889 }, { "protein2": "8022.A0A060VPV4", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 274, "database": 828, "textmining": 193, "combined_score": 892 }, { "protein2": "8022.A0A060WWC7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 532, "database": 832, "textmining": 308, "combined_score": 944 }, { "protein2": "8022.A0A060XY19", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 51, "experimental": 470, "database": 421, "textmining": 119, "combined_score": 709 }, { "protein2": "8022.A0A060X451", "neighborhood": 139, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 53, "database": 693, "textmining": 308, "combined_score": 803 }, { "protein2": "8022.A0A060WXT5", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 0, "database": 790, "textmining": 130, "combined_score": 818 }, { "protein2": "8022.A0A060W1M5", "neighborhood": 50, "fusion": 0, "cooccurence": 0, "coexpression": 780, "experimental": 174, "database": 645, "textmining": 391, "combined_score": 955 }, { "protein2": "8022.A0A060WL30", "neighborhood": 43, "fusion": 0, "cooccurence": 0, "coexpression": 346, "experimental": 0, "database": 841, "textmining": 505, "combined_score": 944 }, { "protein2": "8022.A0A060X5Z6", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060Y002", "neighborhood": 144, "fusion": 0, "cooccurence": 0, "coexpression": 222, "experimental": 182, "database": 630, "textmining": 191, "combined_score": 807 }, { "protein2": "8022.A0A060XQN1", "neighborhood": 53, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 158, "database": 602, "textmining": 270, "combined_score": 741 }, { "protein2": "8022.A0A060XLE7", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 841, "textmining": 136, "combined_score": 858 }, { "protein2": "8022.A0A060WEB4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 51, "experimental": 834, "database": 421, "textmining": 262, "combined_score": 923 }, { "protein2": "8022.A0A060W1W2", "neighborhood": 53, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 158, "database": 602, "textmining": 270, "combined_score": 741 }, { "protein2": "8022.A0A060Y374", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 770, "database": 0, "textmining": 176, "combined_score": 802 }, { "protein2": "8022.A0A060YT31", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 771, "database": 835, "textmining": 278, "combined_score": 973 }, { "protein2": "8022.A0A060XQ68", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 601, "experimental": 0, "database": 140, "textmining": 308, "combined_score": 773 }, { "protein2": "8022.A0A060XQV6", "neighborhood": 128, "fusion": 0, "cooccurence": 0, "coexpression": 47, "experimental": 0, "database": 825, "textmining": 0, "combined_score": 841 }, { "protein2": "8022.A0A060XR98", "neighborhood": 161, "fusion": 0, "cooccurence": 0, "coexpression": 54, "experimental": 0, "database": 772, "textmining": 358, "combined_score": 868 }, { "protein2": "8022.A0A060WRU8", "neighborhood": 54, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 358, "database": 444, "textmining": 221, "combined_score": 701 }, { "protein2": "8022.C1BFE0", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060WR68", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 156, "experimental": 942, "database": 839, "textmining": 504, "combined_score": 995 }, { "protein2": "8022.A0A060W6P2", "neighborhood": 141, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 210, "combined_score": 870 }, { "protein2": "8022.A0A060YZH2", "neighborhood": 161, "fusion": 0, "cooccurence": 0, "coexpression": 54, "experimental": 0, "database": 772, "textmining": 358, "combined_score": 868 }, { "protein2": "8022.A0A060Y7N3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 325, "database": 825, "textmining": 368, "combined_score": 918 }, { "protein2": "8022.A0A061AFP5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 159, "database": 693, "textmining": 150, "combined_score": 761 }, { "protein2": "8022.A0A060Y457", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 770, "database": 0, "textmining": 176, "combined_score": 802 }, { "protein2": "8022.A0A060X6C1", "neighborhood": 155, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 612, "textmining": 260, "combined_score": 780 }, { "protein2": "8022.A0A060Z1V4", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 657, "textmining": 155, "combined_score": 702 }, { "protein2": "8022.A0A060YEI0", "neighborhood": 141, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 826, "textmining": 210, "combined_score": 871 }, { "protein2": "8022.A0A060ZFF2", "neighborhood": 141, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 826, "textmining": 210, "combined_score": 871 }, { "protein2": "8022.A0A060YN45", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 170, "experimental": 0, "database": 569, "textmining": 308, "combined_score": 734 }, { "protein2": "8022.A0A060X7E8", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 632, "textmining": 220, "combined_score": 735 }, { "protein2": "8022.A0A060WBI8", "neighborhood": 93, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 178, "database": 640, "textmining": 208, "combined_score": 758 }, { "protein2": "8022.A0A060YI40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 281, "experimental": 0, "database": 829, "textmining": 155, "combined_score": 887 }, { "protein2": "8022.A0A060WUV7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 156, "experimental": 908, "database": 824, "textmining": 448, "combined_score": 991 }, { "protein2": "8022.A0A060YC16", "neighborhood": 53, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 158, "database": 602, "textmining": 270, "combined_score": 741 }, { "protein2": "8022.A0A060ZEV1", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 0, "database": 790, "textmining": 130, "combined_score": 818 }, { "protein2": "8022.A0A060XLD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 766, "database": 839, "textmining": 265, "combined_score": 972 }, { "protein2": "8022.A0A060Z5S7", "neighborhood": 143, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 283, "combined_score": 883 }, { "protein2": "8022.A0A060XFS5", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 786 }, { "protein2": "8022.A0A060Z2G8", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 958, "experimental": 773, "database": 973, "textmining": 513, "combined_score": 999 }, { "protein2": "8022.A0A060WG87", "neighborhood": 93, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 178, "database": 640, "textmining": 208, "combined_score": 758 }, { "protein2": "8022.A0A060XAF0", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 349, "combined_score": 751 }, { "protein2": "8022.A0A060Y0X3", "neighborhood": 50, "fusion": 0, "cooccurence": 0, "coexpression": 780, "experimental": 174, "database": 645, "textmining": 391, "combined_score": 955 }, { "protein2": "8022.A0A060XUG1", "neighborhood": 162, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 772, "textmining": 365, "combined_score": 878 }, { "protein2": "8022.A0A060VQU3", "neighborhood": 144, "fusion": 0, "cooccurence": 0, "coexpression": 222, "experimental": 182, "database": 630, "textmining": 191, "combined_score": 807 }, { "protein2": "8022.A0A060X106", "neighborhood": 144, "fusion": 0, "cooccurence": 0, "coexpression": 222, "experimental": 182, "database": 630, "textmining": 209, "combined_score": 811 }, { "protein2": "8022.A0A060XRG4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 739, "textmining": 333, "combined_score": 818 }, { "protein2": "8022.A0A060WEA8", "neighborhood": 155, "fusion": 0, "cooccurence": 0, "coexpression": 218, "experimental": 0, "database": 660, "textmining": 273, "combined_score": 814 }, { "protein2": "8022.A0A060W448", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 771, "database": 835, "textmining": 278, "combined_score": 973 }, { "protein2": "8022.A0A060VPR7", "neighborhood": 110, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 651, "textmining": 231, "combined_score": 766 }, { "protein2": "8022.A0A060YPM2", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 826, "textmining": 136, "combined_score": 844 }, { "protein2": "8022.A0A060XAK7", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 592, "experimental": 0, "database": 689, "textmining": 308, "combined_score": 916 }, { "protein2": "8022.A0A060Y4H0", "neighborhood": 50, "fusion": 0, "cooccurence": 0, "coexpression": 780, "experimental": 174, "database": 645, "textmining": 391, "combined_score": 955 }, { "protein2": "8022.A0A060Z3J9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 357, "database": 693, "textmining": 293, "combined_score": 848 }, { "protein2": "8022.A0A060X554", "neighborhood": 139, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 53, "database": 693, "textmining": 308, "combined_score": 803 }, { "protein2": "8022.A0A060WSC1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 156, "experimental": 908, "database": 824, "textmining": 448, "combined_score": 991 }, { "protein2": "8022.A0A060WB43", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 632, "textmining": 220, "combined_score": 735 }, { "protein2": "8022.A0A060WMB2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 50, "experimental": 260, "database": 619, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A061AEK9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 357, "database": 693, "textmining": 293, "combined_score": 848 }, { "protein2": "8022.A0A060Y6Z6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 120, "experimental": 317, "database": 827, "textmining": 115, "combined_score": 895 }, { "protein2": "8022.A0A060WZ37", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 316, "database": 568, "textmining": 87, "combined_score": 722 }, { "protein2": "8022.A0A060WPP4", "neighborhood": 154, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 173, "database": 649, "textmining": 454, "combined_score": 941 }, { "protein2": "8022.A0A060WXS1", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 316, "database": 568, "textmining": 87, "combined_score": 722 }, { "protein2": "8022.A0A060XV20", "neighborhood": 143, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 660, "textmining": 276, "combined_score": 794 }, { "protein2": "8022.A0A060Y539", "neighborhood": 50, "fusion": 0, "cooccurence": 0, "coexpression": 780, "experimental": 174, "database": 645, "textmining": 391, "combined_score": 955 }, { "protein2": "8022.C1BEI8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 159, "database": 693, "textmining": 150, "combined_score": 761 }, { "protein2": "8022.A0A060WTE4", "neighborhood": 110, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 651, "textmining": 231, "combined_score": 766 }, { "protein2": "8022.A0A060WKM3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 281, "experimental": 0, "database": 826, "textmining": 155, "combined_score": 885 }, { "protein2": "8022.A0A060WLZ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 696, "database": 829, "textmining": 87, "combined_score": 950 }, { "protein2": "8022.C1BHD2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 422, "combined_score": 894 }, { "protein2": "8022.O57399", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 731, "database": 0, "textmining": 86, "combined_score": 743 }, { "protein2": "8022.A0A060XRV8", "neighborhood": 155, "fusion": 0, "cooccurence": 0, "coexpression": 218, "experimental": 0, "database": 660, "textmining": 273, "combined_score": 814 }, { "protein2": "8022.A0A060YTP7", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 592, "experimental": 0, "database": 689, "textmining": 308, "combined_score": 916 }, { "protein2": "8022.A0A060XZF7", "neighborhood": 144, "fusion": 0, "cooccurence": 0, "coexpression": 222, "experimental": 182, "database": 630, "textmining": 191, "combined_score": 807 }, { "protein2": "8022.A0A060YGT3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 156, "experimental": 942, "database": 830, "textmining": 504, "combined_score": 995 }, { "protein2": "8022.A0A060WSY5", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 202, "experimental": 0, "database": 611, "textmining": 165, "combined_score": 746 }, { "protein2": "8022.A0A060Z6P1", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 592, "experimental": 0, "database": 689, "textmining": 308, "combined_score": 916 }, { "protein2": "8022.A0A060XNW5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 88, "combined_score": 783 }, { "protein2": "8022.A0A060X4P1", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 170, "experimental": 0, "database": 569, "textmining": 308, "combined_score": 734 }, { "protein2": "8022.A0A060Z2E0", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 349, "combined_score": 751 }, { "protein2": "8022.A0A060YU85", "neighborhood": 138, "fusion": 0, "cooccurence": 0, "coexpression": 825, "experimental": 342, "database": 523, "textmining": 432, "combined_score": 968 } ]
A0A060Y644
Beta-2 adrenergic receptor (Beta-2 adrenoreceptor)
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
408
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
MENVSTSALFNLSDLPVEMNLSSHHWSYSEYSEAEAVLLGIIMALLVLGIVFGNVLVITAIVRFQRLQTVTNMFITSLACADLVMGLLVVPFGACYILLNTWHFGSFLCEFWTAADVLCVTASIETLCVIALDRYLAITSPLRYPSLLTKHKACVVVVTVWGVAALISFLPIHMKWWVSDEPEALSCLENAHCCDFNTNAAYAVASSVVSFYIPLAVMAFVYGRVFQEARKQLQKIRGSEGRFHAQIINNNKGQDGGGGGGGNGKRPKFCLKEHKALKTLGIIMGTFTLCWLPFFVLNVAVTIWKVDNIKMPFRILNWIGYANSAFNPLIYCRSPEFRYAFQEILCLRGTAFPTNEYIYRGHSLQVSPKDKPGCSIHDTGTMELSTGSRSSVPNTNRNCNKPSLASIV
[ "GO:0043434", "GO:1901652", "GO:0051952", "GO:0065007", "GO:1903530", "GO:0032811", "GO:0033604", "GO:0051049", "GO:0051051", "GO:0008150", "GO:0042221", "GO:0010243", "GO:0050896", "GO:1901698", "GO:0050789", "GO:0050433", "GO:0009719", "GO:0032879", "GO:0007186", "GO:0050794", "GO:0051716", "GO:0009987", "GO:0023052", "GO:1901700", "GO:0051046", "GO:0071875", "GO:0014060", "GO:0051953", "GO:0048523", "GO:0048519", "GO:0010033", "GO:0009725", "GO:0051048", "GO:0007154", "GO:1903531", "GO:0007165" ]
[ "GO:0008150", "GO:0065007", "GO:0050896", "GO:0050789", "GO:0009987", "GO:0023052", "GO:0048519", "GO:0051051", "GO:0042221", "GO:0009719", "GO:0032879", "GO:0050794", "GO:0051716", "GO:0048523", "GO:0007154", "GO:0007165", "GO:1903530", "GO:0051049", "GO:1901698", "GO:0007186", "GO:1901700", "GO:0051953", "GO:0010033", "GO:0009725", "GO:0051048", "GO:1903531", "GO:0043434", "GO:1901652", "GO:0051952", "GO:0033604", "GO:0010243", "GO:0050433", "GO:0051046", "GO:0071875", "GO:0032811", "GO:0014060" ]
null
null
[ "IPR002233", "IPR000276", "IPR017452" ]
af_db/AF-A0A060Y644-F1-model_v4.cif.gz
8022.A0A060Y644
[ "8022.A0A060Y7L4", "8022.A0A060W081", "8022.A0A060Z4B9", "8022.A0A060Z2S8", "8022.A0A060VY52", "8022.Q7SZV5", "8022.A0A060XG51", "8022.A0A060W066", "8022.A0A060VW67", "8022.A0A060Y3I4", "8022.A0A060Y8R0", "8022.A0A060WP41", "8022.A0A060XJN8", "8022.A0A060Y8H5", "8022.Q7T2I7", "8022.A0A060WDT4", "8022.A0A060YU11", "8022.A0A060WHA4", "8022.A0A060Z2C2", "8022.A0A060XGM0", "8022.A0A060VZ80", "8022.A0A060YWJ1", "8022.A0A060XTK7", "8022.A0A060WSX0", "8022.A0A060WE78", "8022.A0A060VXM2", "8022.A0A060XB37", "8022.A0A060Z1D1", "8022.A0A060W0D6", "8022.A0A060Z6T3", "8022.A0A060VPW7", "8022.A0A060YEE1", "8022.A0A060Z6I0", "8022.C1BH40", "8022.A0A060Z1I0", "8022.A0A060WIZ5", "8022.A0A060ZEF4", "8022.A0A060VWA0", "8022.A0A060YL43", "8022.A0A060XUD4", "8022.A0A060ZG63", "8022.A0A060WVD9", "8022.A0A060XA34", "8022.A0A060XCL5", "8022.A0A060WJ93", "8022.A0A060Z480", "8022.A0A060YP44", "8022.A0A060Z8T5", "8022.A0A060Y3C6", "8022.A0A060YAW4", "8022.A0A060W808", "8022.A0A060XLR8", "8022.B2KL82", "8022.A0A060WCN9", "8022.A0A060YR93", "8022.A0A060XIC8", "8022.A0A060XLH0", "8022.A0A060XH49", "8022.A0A060WHT5", "8022.A0A060X2B4", "8022.A0A060WXK5", "8022.A0A060VWI9", "8022.A0A060Y433", "8022.A0A060WVH7", "8022.A0A060YK59", "8022.A0A060WF25", "8022.A0A060XVD9", "8022.A0A060XC17", "8022.A0A060W0Q4", "8022.A0A060XLX4", "8022.A0A060VXS0", "8022.A0A060YV89", "8022.A0A060WRL9", "8022.A0A061A7Q4", "8022.A0A060W6W6", "8022.A0A060W8T4", "8022.A0A060X5U6", "8022.A0A060YJ99", "8022.A0A060WHG5", "8022.A0A060YC25", "8022.A0A060XRA0", "8022.A0A060XBV2", "8022.A0A060W476", "8022.A0A060ZAK0", "8022.A0A060YPP2", "8022.A0A060ZE50", "8022.A0A060XB81", "8022.A0A060WLD6", "8022.A0A060XAN6", "8022.A0A060XBN9", "8022.A0A060WSN3", "8022.A0A060Y3R9", "8022.A0A060WVI0", "8022.A0A060VX07", "8022.A0A060XFJ9", "8022.A0A060XJ06", "8022.A0A060Z6G3", "8022.A0A060YHK9" ]
[ { "protein2": "8022.A0A060Y7L4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060W081", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060Z4B9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060Z2S8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060VY52", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.Q7SZV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 387, "database": 831, "textmining": 124, "combined_score": 901 }, { "protein2": "8022.A0A060XG51", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 748, "database": 419, "textmining": 86, "combined_score": 854 }, { "protein2": "8022.A0A060W066", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 779, "textmining": 86, "combined_score": 789 }, { "protein2": "8022.A0A060VW67", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 81, "combined_score": 832 }, { "protein2": "8022.A0A060Y3I4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060Y8R0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060WP41", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060XJN8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060Y8H5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 571, "textmining": 0, "combined_score": 708 }, { "protein2": "8022.Q7T2I7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 167, "combined_score": 849 }, { "protein2": "8022.A0A060WDT4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060YU11", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060WHA4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 267, "database": 832, "textmining": 87, "combined_score": 881 }, { "protein2": "8022.A0A060Z2C2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 844, "textmining": 162, "combined_score": 961 }, { "protein2": "8022.A0A060XGM0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 110, "combined_score": 839 }, { "protein2": "8022.A0A060VZ80", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 825, "textmining": 62, "combined_score": 889 }, { "protein2": "8022.A0A060YWJ1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 593, "textmining": 162, "combined_score": 898 }, { "protein2": "8022.A0A060XTK7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060WSX0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 829, "textmining": 62, "combined_score": 891 }, { "protein2": "8022.A0A060WE78", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060VXM2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 59, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 838 }, { "protein2": "8022.A0A060XB37", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 167, "combined_score": 849 }, { "protein2": "8022.A0A060Z1D1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 751, "database": 523, "textmining": 0, "combined_score": 876 }, { "protein2": "8022.A0A060W0D6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 46, "experimental": 0, "database": 825, "textmining": 62, "combined_score": 829 }, { "protein2": "8022.A0A060Z6T3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060VPW7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 250, "database": 827, "textmining": 109, "combined_score": 874 }, { "protein2": "8022.A0A060YEE1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060Z6I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 827, "textmining": 89, "combined_score": 897 }, { "protein2": "8022.C1BH40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 751, "database": 523, "textmining": 0, "combined_score": 876 }, { "protein2": "8022.A0A060Z1I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060WIZ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060ZEF4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060VWA0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060YL43", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 825, "textmining": 62, "combined_score": 889 }, { "protein2": "8022.A0A060XUD4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060ZG63", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060WVD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 829, "textmining": 62, "combined_score": 891 }, { "protein2": "8022.A0A060XA34", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060XCL5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 250, "database": 827, "textmining": 109, "combined_score": 874 }, { "protein2": "8022.A0A060WJ93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060Z480", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060YP44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 827, "textmining": 89, "combined_score": 897 }, { "protein2": "8022.A0A060Z8T5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060Y3C6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060YAW4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060W808", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060XLR8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.B2KL82", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 844, "textmining": 162, "combined_score": 961 }, { "protein2": "8022.A0A060WCN9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 110, "combined_score": 839 }, { "protein2": "8022.A0A060YR93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060XIC8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060XLH0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060XH49", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 89, "combined_score": 835 }, { "protein2": "8022.A0A060WHT5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060X2B4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060WXK5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060VWI9", "neighborhood": 0, "fusion": 0, "cooccurence": 86, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 89, "combined_score": 843 }, { "protein2": "8022.A0A060Y433", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060WVH7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 825, "textmining": 62, "combined_score": 889 }, { "protein2": "8022.A0A060YK59", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060WF25", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 816, "textmining": 62, "combined_score": 883 }, { "protein2": "8022.A0A060XVD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 291, "database": 783, "textmining": 0, "combined_score": 839 }, { "protein2": "8022.A0A060XC17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 571, "textmining": 0, "combined_score": 708 }, { "protein2": "8022.A0A060W0Q4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060XLX4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060VXS0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 772, "textmining": 87, "combined_score": 782 }, { "protein2": "8022.A0A060YV89", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 241, "database": 827, "textmining": 86, "combined_score": 869 }, { "protein2": "8022.A0A060WRL9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 844, "textmining": 162, "combined_score": 961 }, { "protein2": "8022.A0A061A7Q4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060W6W6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 829, "textmining": 62, "combined_score": 891 }, { "protein2": "8022.A0A060W8T4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060X5U6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 46, "experimental": 0, "database": 825, "textmining": 62, "combined_score": 829 }, { "protein2": "8022.A0A060YJ99", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 829, "textmining": 62, "combined_score": 891 }, { "protein2": "8022.A0A060WHG5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060YC25", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 152, "combined_score": 768 }, { "protein2": "8022.A0A060XRA0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060XBV2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060W476", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060ZAK0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 832, "textmining": 89, "combined_score": 902 }, { "protein2": "8022.A0A060YPP2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060ZE50", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 380, "database": 555, "textmining": 62, "combined_score": 718 }, { "protein2": "8022.A0A060XB81", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 }, { "protein2": "8022.A0A060WLD6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 46, "experimental": 0, "database": 825, "textmining": 62, "combined_score": 829 }, { "protein2": "8022.A0A060XAN6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 225, "database": 832, "textmining": 130, "combined_score": 876 }, { "protein2": "8022.A0A060XBN9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 59, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 838 }, { "protein2": "8022.A0A060WSN3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 241, "database": 827, "textmining": 86, "combined_score": 869 }, { "protein2": "8022.A0A060Y3R9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 779, "textmining": 86, "combined_score": 789 }, { "protein2": "8022.A0A060WVI0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060VX07", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060XFJ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 63, "combined_score": 829 }, { "protein2": "8022.A0A060XJ06", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 353, "database": 597, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060Z6G3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 727, "database": 602, "textmining": 162, "combined_score": 900 }, { "protein2": "8022.A0A060YHK9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 419, "textmining": 86, "combined_score": 857 } ]
A0A024A2C9
Lipoprotein binding FH
null
Haemophilus influenzae
280
null
MNINLKKFSLTILAALTLTACGSGSGASASNAPTAQPSTPATQPSEQAVLEMPKRSPTNTGLVFSIKTESEEDSVGQINTINNEQELSNRTLTSIDVDGKQIPIAFTENWNEAKYIEQPLNGVPHICCNKYTAMRFGAIASNEAGQNDILFYNGIPTEKLPDSGEVTYEGESIMTSKESVIPDDYMKGSSKFIVNFGDKKLSGSLIIDTTKSTSSSQKVKIDIEKAKITGNTFSGTAQSDSFKSQGIAEGKFYGDGAKELGGMVKAKDNSWAGAYGAKAQ
[ "GO:0009605", "GO:0001971", "GO:0051701", "GO:0050777", "GO:0031341", "GO:0065007", "GO:0052200", "GO:0030449", "GO:0050776", "GO:0008150", "GO:1903659", "GO:0043207", "GO:0052173", "GO:0050896", "GO:0050789", "GO:0002683", "GO:0002697", "GO:0009607", "GO:0032879", "GO:0060341", "GO:0002921", "GO:0050794", "GO:0044419", "GO:0048583", "GO:0052553", "GO:0075136", "GO:0052562", "GO:0052572", "GO:0002682", "GO:0002698", "GO:0032880", "GO:0045916", "GO:0002920", "GO:0044403", "GO:0048519", "GO:0051707", "GO:0048585", "GO:0001969", "GO:0110165", "GO:0005575", "GO:0009986", "GO:0003674", "GO:0005488", "GO:0050840", "GO:0005515" ]
[ "GO:0008150", "GO:0065007", "GO:0050896", "GO:0050789", "GO:0044419", "GO:0048519", "GO:0009605", "GO:0002683", "GO:0009607", "GO:0032879", "GO:0050794", "GO:0048583", "GO:0002682", "GO:0044403", "GO:0051707", "GO:0048585", "GO:0051701", "GO:0050777", "GO:0031341", "GO:0050776", "GO:0043207", "GO:0052173", "GO:0002697", "GO:0060341", "GO:0075136", "GO:0002698", "GO:0052200", "GO:0030449", "GO:1903659", "GO:0002921", "GO:0032880", "GO:0045916", "GO:0002920", "GO:0001971", "GO:0052572", "GO:0001969", "GO:0052553", "GO:0052562" ]
[ "GO:0003674", "GO:0005488", "GO:0050840", "GO:0005515" ]
[ "GO:0005575", "GO:0110165", "GO:0009986" ]
[ "IPR011250", "IPR054843", "IPR001677" ]
af_db/AF-A0A024A2C9-F1-model_v4.cif.gz
null
null
null
A0A060XK41
Phospholipid/glycerol acyltransferase domain-containing protein
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
180
Membrane {ECO:0000256|ARBA:ARBA00004370}.
MTVTVFPVRLFFAVFLMLLAWPFAFAASLGRSELAVETETWWRRICDIALRVIMRAMWFCGGFHWVTVKGEPAPPSQAPILTLAPHSSYFDAIPITMTMASIVMKTESKNIPVWGTLIKFIRPVFVSRSDQDSRRKTVEEIKRRAHAGGEWPQIMIFPEGTCTNRSCLITFKPGMCSSLC
[ "GO:0008152", "GO:1901566", "GO:0006650", "GO:0006662", "GO:1901503", "GO:0009058", "GO:0008654", "GO:0044237", "GO:0008150", "GO:1901576", "GO:1901564", "GO:0046486", "GO:0006629", "GO:0006663", "GO:0044281", "GO:0046504", "GO:0006644", "GO:0097384", "GO:0008611", "GO:0046485", "GO:0019637", "GO:0006807", "GO:0090407", "GO:0044255", "GO:0044249", "GO:0009987", "GO:0006796", "GO:0046474", "GO:0018904", "GO:0071704", "GO:0046469", "GO:0008610", "GO:0045017", "GO:0044238", "GO:0006793", "GO:0042175", "GO:0005622", "GO:0031090", "GO:0043226", "GO:0005783", "GO:0005575", "GO:0016020", "GO:0043231", "GO:0005789", "GO:0031984", "GO:0043229", "GO:0110165", "GO:0071944", "GO:0005737", "GO:0043227", "GO:0012505", "GO:0005886", "GO:0098827", "GO:0016747", "GO:0016740", "GO:0003674", "GO:0016407", "GO:0016746", "GO:0003824", "GO:0047179" ]
[ "GO:0008150", "GO:0008152", "GO:0009987", "GO:0009058", "GO:0044237", "GO:0044281", "GO:0006807", "GO:0071704", "GO:0044238", "GO:1901576", "GO:1901564", "GO:0006629", "GO:0019637", "GO:0044255", "GO:0044249", "GO:0018904", "GO:0006793", "GO:1901566", "GO:0006662", "GO:1901503", "GO:0046486", "GO:0046504", "GO:0006644", "GO:0097384", "GO:0046485", "GO:0090407", "GO:0006796", "GO:0046469", "GO:0008610", "GO:0045017", "GO:0006650", "GO:0008654", "GO:0006663", "GO:0008611", "GO:0046474" ]
[ "GO:0003674", "GO:0003824", "GO:0016740", "GO:0016746", "GO:0016747", "GO:0016407", "GO:0047179" ]
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0016020", "GO:0031984", "GO:0071944", "GO:0005737", "GO:0012505", "GO:0042175", "GO:0031090", "GO:0005783", "GO:0043229", "GO:0043227", "GO:0005886", "GO:0098827", "GO:0043231", "GO:0005789" ]
[ "IPR045252", "IPR002123" ]
af_db/AF-A0A060XK41-F1-model_v4.cif.gz
8022.A0A060XK41
[ "8022.A0A060XLF8", "8022.A0A060WDA7", "8022.A0A060YAJ2", "8022.A0A060Z370", "8022.A0A060VZH3", "8022.A0A060YQM4", "8022.A0A060W8Z2", "8022.A0A060XKJ6", "8022.A0A060X4H7", "8022.A0A060Y6G2", "8022.A0A060W3V3", "8022.A0A060XFT6", "8022.A0A060Y2H4", "8022.A0A060Y2K1", "8022.A0A060Z5I3", "8022.A0A060Y4G9", "8022.A0A060WXB6", "8022.A0A060YKM8", "8022.A0A060XM30", "8022.A0A060XEI7", "8022.A0A060YZH2", "8022.A0A060XR98", "8022.A0A060WTF2", "8022.A0A060ZCK2", "8022.A0A060XEP9", "8022.A0A060X5K2", "8022.A0A060XI36", "8022.A0A060XT39", "8022.A0A060WDQ0", "8022.A0A060VU79", "8022.A0A060W6W8", "8022.A0A060WCJ4", "8022.A0A060Z9W8", "8022.A0A060X101", "8022.A0A060WK44", "8022.A0A060WAZ2", "8022.A0A060ZFN7", "8022.A0A060XNK8", "8022.A0A060Z1S9", "8022.A0A060WE92", "8022.A0A060Z3A6", "8022.A0A060Z2V6", "8022.A0A060WG53", "8022.A0A060VXV4", "8022.A0A060XE36", "8022.A0A060X9R9", "8022.A0A060Y5Z4", "8022.A0A060XTV7", "8022.A0A060YCG4", "8022.A0A060XN93", "8022.A0A060X754", "8022.A0A060W3X0", "8022.A0A060X5H9", "8022.A0A060YK16", "8022.A0A060X1Q1", "8022.A0A060VWE7", "8022.A0A060X8I3", "8022.A0A060VWG7", "8022.A0A060ZF19", "8022.A0A060WWB8", "8022.A0A060W780", "8022.A0A060VY33", "8022.A0A060WAH0", "8022.A0A060VYJ7", "8022.A0A060YPN4", "8022.A0A060Y3S3", "8022.A0A060ZEA0", "8022.A0A060WKI9", "8022.A0A060WAM9", "8022.A0A060Z178", "8022.A0A060Y525", "8022.A0A060XJE3", "8022.A0A060WXJ9", "8022.A0A060XBF4", "8022.A0A060YNP0", "8022.A0A060Y209", "8022.A0A060XZG5", "8022.A0A060WMA0", "8022.A0A060YP76", "8022.A0A060XZ81", "8022.A0A060YCR0", "8022.A0A060VWY0", "8022.A0A060XQT7", "8022.A0A060W3M6", "8022.A0A060YLF9", "8022.A0A060X659", "8022.A0A060XN56", "8022.A0A060X1J7", "8022.A0A060Y7U0", "8022.A0A060X836", "8022.A0A060WCZ0", "8022.A0A060XI24", "8022.A0A060VYB1", "8022.A0A060XCL6", "8022.A0A060Z8E6", "8022.A0A060YWG6", "8022.A0A060Z769", "8022.A0A060YPX7", "8022.A0A060XJF5", "8022.A0A060VML4", "8022.A0A060Y022", "8022.A0A060YG60", "8022.A0A060YR49", "8022.A0A060WGS1", "8022.A0A060X8F2", "8022.A0A060W5A1", "8022.A0A060W2M5" ]
[ { "protein2": "8022.A0A060XLF8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 323, "combined_score": 889 }, { "protein2": "8022.A0A060WDA7", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 157, "combined_score": 848 }, { "protein2": "8022.A0A060YAJ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 151, "combined_score": 861 }, { "protein2": "8022.A0A060Z370", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 782, "textmining": 112, "combined_score": 798 }, { "protein2": "8022.A0A060VZH3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 839, "textmining": 151, "combined_score": 857 }, { "protein2": "8022.A0A060YQM4", "neighborhood": 154, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 649, "textmining": 205, "combined_score": 743 }, { "protein2": "8022.A0A060W8Z2", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 157, "combined_score": 854 }, { "protein2": "8022.A0A060XKJ6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 834, "textmining": 89, "combined_score": 842 }, { "protein2": "8022.A0A060X4H7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 782, "textmining": 112, "combined_score": 798 }, { "protein2": "8022.A0A060Y6G2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 128, "combined_score": 840 }, { "protein2": "8022.A0A060W3V3", "neighborhood": 42, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 212, "combined_score": 856 }, { "protein2": "8022.A0A060XFT6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 835 }, { "protein2": "8022.A0A060Y2H4", "neighborhood": 0, "fusion": 0, "cooccurence": 72, "coexpression": 0, "experimental": 158, "database": 827, "textmining": 137, "combined_score": 867 }, { "protein2": "8022.A0A060Y2K1", "neighborhood": 0, "fusion": 0, "cooccurence": 84, "coexpression": 0, "experimental": 0, "database": 831, "textmining": 0, "combined_score": 838 }, { "protein2": "8022.A0A060Z5I3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 115, "combined_score": 838 }, { "protein2": "8022.A0A060Y4G9", "neighborhood": 139, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 232, "database": 534, "textmining": 180, "combined_score": 717 }, { "protein2": "8022.A0A060WXB6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 81, "combined_score": 839 }, { "protein2": "8022.A0A060YKM8", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 831, "textmining": 0, "combined_score": 833 }, { "protein2": "8022.A0A060XM30", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060XEI7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 135, "combined_score": 843 }, { "protein2": "8022.A0A060YZH2", "neighborhood": 147, "fusion": 0, "cooccurence": 0, "coexpression": 127, "experimental": 100, "database": 832, "textmining": 211, "combined_score": 894 }, { "protein2": "8022.A0A060XR98", "neighborhood": 147, "fusion": 0, "cooccurence": 0, "coexpression": 127, "experimental": 100, "database": 534, "textmining": 211, "combined_score": 708 }, { "protein2": "8022.A0A060WTF2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 44, "combined_score": 825 }, { "protein2": "8022.A0A060ZCK2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 829, "textmining": 47, "combined_score": 830 }, { "protein2": "8022.A0A060XEP9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 167, "combined_score": 847 }, { "protein2": "8022.A0A060X5K2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 772, "textmining": 112, "combined_score": 789 }, { "protein2": "8022.A0A060XI36", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 357, "database": 602, "textmining": 235, "combined_score": 792 }, { "protein2": "8022.A0A060XT39", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060WDQ0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 44, "combined_score": 825 }, { "protein2": "8022.A0A060VU79", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 323, "combined_score": 889 }, { "protein2": "8022.A0A060W6W8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 834, "textmining": 89, "combined_score": 842 }, { "protein2": "8022.A0A060WCJ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 167, "combined_score": 864 }, { "protein2": "8022.A0A060Z9W8", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 84, "database": 827, "textmining": 132, "combined_score": 852 }, { "protein2": "8022.A0A060X101", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060WK44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 835 }, { "protein2": "8022.A0A060WAZ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 276, "combined_score": 869 }, { "protein2": "8022.A0A060ZFN7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 782, "textmining": 112, "combined_score": 798 }, { "protein2": "8022.A0A060XNK8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 135, "combined_score": 843 }, { "protein2": "8022.A0A060Z1S9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 115, "combined_score": 838 }, { "protein2": "8022.A0A060WE92", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 835 }, { "protein2": "8022.A0A060Z3A6", "neighborhood": 0, "fusion": 0, "cooccurence": 204, "coexpression": 0, "experimental": 0, "database": 831, "textmining": 0, "combined_score": 859 }, { "protein2": "8022.A0A060Z2V6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 44, "combined_score": 832 }, { "protein2": "8022.A0A060WG53", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 84, "database": 827, "textmining": 132, "combined_score": 852 }, { "protein2": "8022.A0A060VXV4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060XE36", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 748 }, { "protein2": "8022.A0A060X9R9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 118, "database": 654, "textmining": 143, "combined_score": 715 }, { "protein2": "8022.A0A060Y5Z4", "neighborhood": 114, "fusion": 0, "cooccurence": 0, "coexpression": 98, "experimental": 0, "database": 592, "textmining": 230, "combined_score": 715 }, { "protein2": "8022.A0A060XTV7", "neighborhood": 42, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 212, "combined_score": 856 }, { "protein2": "8022.A0A060YCG4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 748 }, { "protein2": "8022.A0A060XN93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 86, "combined_score": 833 }, { "protein2": "8022.A0A060X754", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 357, "database": 602, "textmining": 235, "combined_score": 792 }, { "protein2": "8022.A0A060W3X0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 118, "database": 654, "textmining": 143, "combined_score": 715 }, { "protein2": "8022.A0A060X5H9", "neighborhood": 101, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 148, "combined_score": 846 }, { "protein2": "8022.A0A060YK16", "neighborhood": 63, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 165, "database": 824, "textmining": 115, "combined_score": 864 }, { "protein2": "8022.A0A060X1Q1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 224, "combined_score": 864 }, { "protein2": "8022.A0A060VWE7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 835 }, { "protein2": "8022.A0A060X8I3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 357, "database": 602, "textmining": 235, "combined_score": 792 }, { "protein2": "8022.A0A060VWG7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 357, "database": 602, "textmining": 235, "combined_score": 792 }, { "protein2": "8022.A0A060ZF19", "neighborhood": 63, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 165, "database": 824, "textmining": 115, "combined_score": 864 }, { "protein2": "8022.A0A060WWB8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 47, "combined_score": 828 }, { "protein2": "8022.A0A060W780", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 151, "combined_score": 861 }, { "protein2": "8022.A0A060VY33", "neighborhood": 42, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 212, "combined_score": 856 }, { "protein2": "8022.A0A060WAH0", "neighborhood": 0, "fusion": 0, "cooccurence": 74, "coexpression": 0, "experimental": 158, "database": 844, "textmining": 137, "combined_score": 881 }, { "protein2": "8022.A0A060VYJ7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 782, "textmining": 112, "combined_score": 798 }, { "protein2": "8022.A0A060YPN4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 43, "combined_score": 832 }, { "protein2": "8022.A0A060Y3S3", "neighborhood": 101, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 125, "combined_score": 856 }, { "protein2": "8022.A0A060ZEA0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 782, "textmining": 112, "combined_score": 798 }, { "protein2": "8022.A0A060WKI9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 834, "textmining": 89, "combined_score": 842 }, { "protein2": "8022.A0A060WAM9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 835 }, { "protein2": "8022.A0A060Z178", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 44, "combined_score": 825 }, { "protein2": "8022.A0A060Y525", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 748 }, { "protein2": "8022.A0A060XJE3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 834, "textmining": 89, "combined_score": 842 }, { "protein2": "8022.A0A060WXJ9", "neighborhood": 101, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 148, "combined_score": 846 }, { "protein2": "8022.A0A060XBF4", "neighborhood": 101, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 148, "combined_score": 846 }, { "protein2": "8022.A0A060YNP0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 357, "database": 602, "textmining": 235, "combined_score": 792 }, { "protein2": "8022.A0A060Y209", "neighborhood": 0, "fusion": 0, "cooccurence": 79, "coexpression": 0, "experimental": 0, "database": 831, "textmining": 0, "combined_score": 837 }, { "protein2": "8022.A0A060XZG5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 135, "combined_score": 843 }, { "protein2": "8022.A0A060WMA0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 44, "combined_score": 825 }, { "protein2": "8022.A0A060YP76", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 752 }, { "protein2": "8022.A0A060XZ81", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 151, "combined_score": 861 }, { "protein2": "8022.A0A060YCR0", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060VWY0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 118, "database": 827, "textmining": 143, "combined_score": 857 }, { "protein2": "8022.A0A060XQT7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 834, "textmining": 86, "combined_score": 841 }, { "protein2": "8022.A0A060W3M6", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060YLF9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 44, "combined_score": 825 }, { "protein2": "8022.A0A060X659", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 357, "database": 602, "textmining": 235, "combined_score": 792 }, { "protein2": "8022.A0A060XN56", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 779, "textmining": 86, "combined_score": 789 }, { "protein2": "8022.A0A060X1J7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 86, "combined_score": 835 }, { "protein2": "8022.A0A060Y7U0", "neighborhood": 139, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 232, "database": 534, "textmining": 180, "combined_score": 717 }, { "protein2": "8022.A0A060X836", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 167, "combined_score": 847 }, { "protein2": "8022.A0A060WCZ0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 276, "combined_score": 869 }, { "protein2": "8022.A0A060XI24", "neighborhood": 101, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 148, "combined_score": 846 }, { "protein2": "8022.A0A060VYB1", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060XCL6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 834, "textmining": 86, "combined_score": 841 }, { "protein2": "8022.A0A060Z8E6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 86, "combined_score": 833 }, { "protein2": "8022.A0A060YWG6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 135, "combined_score": 843 }, { "protein2": "8022.A0A060Z769", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060YPX7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060XJF5", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 157, "combined_score": 848 }, { "protein2": "8022.A0A060VML4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 844, "textmining": 164, "combined_score": 864 }, { "protein2": "8022.A0A060Y022", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 86, "combined_score": 833 }, { "protein2": "8022.A0A060YG60", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 74, "combined_score": 795 }, { "protein2": "8022.A0A060YR49", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 115, "combined_score": 838 }, { "protein2": "8022.A0A060WGS1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 748 }, { "protein2": "8022.A0A060X8F2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 118, "database": 827, "textmining": 143, "combined_score": 857 }, { "protein2": "8022.A0A060W5A1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 839, "textmining": 151, "combined_score": 857 }, { "protein2": "8022.A0A060W2M5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 118, "database": 654, "textmining": 143, "combined_score": 715 } ]
A0A060Y7B7
Alpha-2B adrenergic receptor (Alpha-2B adrenoreceptor)
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
475
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
MAAAPKVTCLSAPGVNVITNLNLSVTTGSAPYYNQTALRIPPYSREATALFAMAITLMMILTIVGNILVIIAVLTSRSLHGPQNLFLVSLAAADILVATLIIPFSLANELQGYWAFRSLWCEIYLALDVFFCTSSIAHLCAISLDRYLSISRPVSYGIQRTPARIKAAIVVVWLLSAVISFPPLLSLDKSKGGVEVCELNNERWYILYSTIGSFFAPCLIMIGVYIRIYQIAKQHTRCLPGEKPNPNKSPGNMSSNPPTNPTPPSPGPAKSQPQTSLPNPVPTSPQPTSPTVALSLTLLSPDSQHEETHRQGEIQEEKHRDTPNDDSFSSGSEAETRGRGKGGRGGGKGTVKNNGGSKSGGAPLSSLTSHEAKNTPQATPMSRRRAMVNREKRFTFVLAVVIGVFVICWFPFFFSYSLKAIFPETCLVPAPLFTFFFWIGYCNSCLNPVIYTIFNQDFRKAFKKILCRDTKGTFF
[ "GO:0051716", "GO:0051602", "GO:0009628", "GO:0009987", "GO:0051952", "GO:0065007", "GO:0023052", "GO:1903530", "GO:0032811", "GO:0033604", "GO:0051046", "GO:0051049", "GO:0051051", "GO:0008150", "GO:0071875", "GO:0050896", "GO:0050789", "GO:0014060", "GO:0051953", "GO:0050433", "GO:0048523", "GO:0048519", "GO:0007186", "GO:0051048", "GO:0032879", "GO:1903531", "GO:0007154", "GO:0007165", "GO:0050794" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0023052", "GO:0050896", "GO:0050789", "GO:0048519", "GO:0051716", "GO:0009628", "GO:0051051", "GO:0048523", "GO:0032879", "GO:0007154", "GO:0007165", "GO:0050794", "GO:0051602", "GO:1903530", "GO:0051049", "GO:0051953", "GO:0007186", "GO:0051048", "GO:1903531", "GO:0051952", "GO:0033604", "GO:0051046", "GO:0071875", "GO:0050433", "GO:0032811", "GO:0014060" ]
null
null
[ "IPR002233", "IPR000276", "IPR017452" ]
af_db/AF-A0A060Y7B7-F1-model_v4.cif.gz
8022.A0A060Y7B7
[ "8022.A0A060WHA4", "8022.A0A060WGC3", "8022.A0A060Y8H5", "8022.A0A060Y2Z0", "8022.Q7SZV5", "8022.A0A060YR57", "8022.A0A060XSB8", "8022.A0A060XN60", "8022.A0A060Z6I0", "8022.C1BH40", "8022.A0A060Y1H7", "8022.A0A060Z1D1", "8022.A0A060Z6E2", "8022.A0A060WMN1", "8022.A0A060WEW9", "8022.A0A060XPS3", "8022.A0A060WL89", "8022.A0A060VPZ9", "8022.A0A060WVZ9", "8022.A0A060YP44", "8022.A0A060XRQ9", "8022.A0A060W8V2", "8022.A0A060X2G9", "8022.A0A060ZAK0", "8022.A0A060WXC1", "8022.A0A060XVD9", "8022.A0A060XC17" ]
[ { "protein2": "8022.A0A060WHA4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 155, "experimental": 267, "database": 571, "textmining": 86, "combined_score": 724 }, { "protein2": "8022.A0A060WGC3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060Y8H5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 608, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060Y2Z0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.Q7SZV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 387, "database": 568, "textmining": 86, "combined_score": 736 }, { "protein2": "8022.A0A060YR57", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060XSB8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060XN60", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 572, "textmining": 0, "combined_score": 709 }, { "protein2": "8022.A0A060Z6I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 523, "textmining": 88, "combined_score": 716 }, { "protein2": "8022.C1BH40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 626, "database": 567, "textmining": 0, "combined_score": 833 }, { "protein2": "8022.A0A060Y1H7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060Z1D1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 626, "database": 567, "textmining": 0, "combined_score": 833 }, { "protein2": "8022.A0A060Z6E2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060WMN1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060WEW9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060XPS3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060WL89", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 604, "textmining": 0, "combined_score": 733 }, { "protein2": "8022.A0A060VPZ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 572, "textmining": 0, "combined_score": 709 }, { "protein2": "8022.A0A060WVZ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060YP44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 523, "textmining": 88, "combined_score": 716 }, { "protein2": "8022.A0A060XRQ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060W8V2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 608, "textmining": 0, "combined_score": 736 }, { "protein2": "8022.A0A060X2G9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060ZAK0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 89, "combined_score": 751 }, { "protein2": "8022.A0A060WXC1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 63, "combined_score": 708 }, { "protein2": "8022.A0A060XVD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 291, "database": 783, "textmining": 0, "combined_score": 839 }, { "protein2": "8022.A0A060XC17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 571, "textmining": 0, "combined_score": 708 } ]
A0A060YD78
CARD domain-containing protein
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
199
null
MDSWCITDEDMAEVKKEALERLRPYLCEKLVADRHLDYLRSRRVLTRDDAEDICCSKKTGRMLDYLAENPRGLDYLVESICRVRTKDFVIGKITNEVEVVKMERREAAILSAAGSSSPVCICKERTPFVSLQSGSSDAQSIQTSLSNSEDKWGQNEASFSWSALPEGVSVSSLHSLPKPGEQGAPSVPLEDNEPGTLRV
[ "GO:0048583", "GO:1901222", "GO:0009967", "GO:1901224", "GO:0023051", "GO:0010647", "GO:0023056", "GO:0065007", "GO:1902533", "GO:0048518", "GO:0009966", "GO:0008150", "GO:0050789", "GO:0048584", "GO:0010646", "GO:1902531", "GO:0050794", "GO:0048522", "GO:0099081", "GO:0005856", "GO:0140535", "GO:0005622", "GO:0043229", "GO:0099513", "GO:0043226", "GO:0110165", "GO:0043232", "GO:0005575", "GO:0005884", "GO:0032449", "GO:0015629", "GO:0032991", "GO:0043228", "GO:0099512", "GO:0099080", "GO:0042803", "GO:0042802", "GO:0005488", "GO:0003674", "GO:0005515", "GO:0046983" ]
[ "GO:0008150", "GO:0065007", "GO:0048518", "GO:0050789", "GO:0048583", "GO:0023051", "GO:0023056", "GO:0048584", "GO:0050794", "GO:0048522", "GO:0009967", "GO:0010647", "GO:0009966", "GO:0010646", "GO:1902533", "GO:1902531", "GO:1901222", "GO:1901224" ]
[ "GO:0003674", "GO:0005488", "GO:0005515", "GO:0042802", "GO:0046983", "GO:0042803" ]
[ "GO:0005575", "GO:0110165", "GO:0032991", "GO:0140535", "GO:0005622", "GO:0043226", "GO:0099080", "GO:0099081", "GO:0043229", "GO:0032449", "GO:0043228", "GO:0043232", "GO:0099512", "GO:0005856", "GO:0099513", "GO:0005884", "GO:0015629" ]
[ "IPR033238", "IPR001315", "IPR011029" ]
af_db/AF-A0A060YD78-F1-model_v4.cif.gz
8022.A0A060YD78
[ "8022.A0A060VPQ9", "8022.A0A060YC11", "8022.A0A060VMZ0", "8022.A0A060ZAC5", "8022.A0A060WHP4", "8022.A0A060X3A7", "8022.A0A060VPK7", "8022.A0A060Z7Q1", "8022.A0A060VSM2", "8022.A0A060WPG0", "8022.A0A060XEI8", "8022.A0A060Y3W2", "8022.A0A060XE22", "8022.A0A060W2Y1", "8022.A0A060YSP1", "8022.A0A060X0B9", "8022.A0A060YA72", "8022.A0A060WWW9", "8022.A0A060WFN4", "8022.A0A060Z7S6", "8022.A0A060Z9A4", "8022.A0A060XMN7", "8022.A0A060XWP0", "8022.A0A060WGT0", "8022.A0A060YN46", "8022.A0A060WMM4", "8022.A0A060X3D3", "8022.A0A060YT60", "8022.A0A060ZXZ7", "8022.A0A060WVX3", "8022.A0A060Y4P1", "8022.A0A060YFT4", "8022.A0A060Z681", "8022.A0A060VN59", "8022.A0A060X678", "8022.A0A060Y0Y0", "8022.A0A060X4V6", "8022.A0A060YX93", "8022.A0A060WDK2", "8022.A0A060VW27", "8022.A0A060YWL7", "8022.A0A060W7T1", "8022.A0A060WDS6", "8022.A0A060WZ23", "8022.A0A060XUA7", "8022.A0A060WIC9", "8022.A0A060XCU8", "8022.A0A060XLZ6", "8022.A0A060YFY3", "8022.A0A060X3K2", "8022.A0A060WR55", "8022.A0A060YQJ2", "8022.A0A060WGD6", "8022.A0A060W010", "8022.A0A060WH79", "8022.A0A060Y8M4", "8022.A0A060YMA8", "8022.A0A060X7V7", "8022.A0A060X4A4", "8022.A0A060WE22", "8022.A0A060YTI2", "8022.A0A060WMC0", "8022.A0A060Y599", "8022.A0A060X4L3", "8022.A0A060Y8P3", "8022.A0A060WRE1", "8022.A0A060XKG4", "8022.A0A060WH36", "8022.A0A060WTZ2", "8022.A0A060XRP8", "8022.A0A060XTA1", "8022.A0A060W1A6", "8022.A0A060XQK8", "8022.A0A060X9J9", "8022.A0A060YCY4", "8022.A0A060YHN1", "8022.A0A060YTB0", "8022.A0A060X2Z7", "8022.A0A060Y4X6", "8022.A0A060YPE8", "8022.A0A060YPV1", "8022.A0A060WBE7", "8022.A0A060XR59", "8022.A0A060XMS2", "8022.A0A060W620", "8022.A0A060Y3L3", "8022.A0A060XEQ9", "8022.A0A060XTF4", "8022.A0A060WSK7", "8022.A0A060W9W2", "8022.A0A060Y5J3", "8022.A0A060Y4W6", "8022.A0A060Y8T1", "8022.A0A060XE11", "8022.A0A060WUS8", "8022.A0A060YBF2", "8022.A0A061A6D5", "8022.A0A060W9J5", "8022.A0A060WNK3", "8022.A0A060YTY7", "8022.A0A060ZCG7", "8022.A0A060VMS8", "8022.A0A060WWY0", "8022.A0A060VXV5", "8022.A0A060Z2R2", "8022.A0A060XV27", "8022.A0A060YYR0", "8022.A0A060ZCR8", "8022.A0A060ZBY8", "8022.A0A060YHR8" ]
[ { "protein2": "8022.A0A060VPQ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060YC11", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 450, "combined_score": 842 }, { "protein2": "8022.A0A060VMZ0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060ZAC5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060WHP4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 217, "database": 824, "textmining": 86, "combined_score": 863 }, { "protein2": "8022.A0A060X3A7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 217, "database": 654, "textmining": 86, "combined_score": 730 }, { "protein2": "8022.A0A060VPK7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060Z7Q1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 397, "database": 619, "textmining": 135, "combined_score": 789 }, { "protein2": "8022.A0A060VSM2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 341, "database": 654, "textmining": 107, "combined_score": 778 }, { "protein2": "8022.A0A060WPG0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 234, "database": 572, "textmining": 317, "combined_score": 756 }, { "protein2": "8022.A0A060XEI8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 712, "database": 825, "textmining": 411, "combined_score": 967 }, { "protein2": "8022.A0A060Y3W2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 112, "combined_score": 746 }, { "protein2": "8022.A0A060XE22", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 217, "database": 654, "textmining": 86, "combined_score": 730 }, { "protein2": "8022.A0A060W2Y1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 717, "database": 825, "textmining": 450, "combined_score": 971 }, { "protein2": "8022.A0A060YSP1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 397, "database": 619, "textmining": 135, "combined_score": 789 }, { "protein2": "8022.A0A060X0B9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 499, "database": 785, "textmining": 228, "combined_score": 911 }, { "protein2": "8022.A0A060YA72", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 185, "database": 755, "textmining": 320, "combined_score": 856 }, { "protein2": "8022.A0A060WWW9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 341, "database": 654, "textmining": 107, "combined_score": 778 }, { "protein2": "8022.A0A060WFN4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 751, "database": 862, "textmining": 489, "combined_score": 981 }, { "protein2": "8022.A0A060Z7S6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 397, "database": 619, "textmining": 135, "combined_score": 789 }, { "protein2": "8022.A0A060Z9A4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060XMN7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 185, "database": 755, "textmining": 320, "combined_score": 856 }, { "protein2": "8022.A0A060XWP0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 261, "database": 506, "textmining": 329, "combined_score": 741 }, { "protein2": "8022.A0A060WGT0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 751, "database": 862, "textmining": 489, "combined_score": 981 }, { "protein2": "8022.A0A060YN46", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 397, "database": 619, "textmining": 135, "combined_score": 789 }, { "protein2": "8022.A0A060WMM4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 261, "database": 506, "textmining": 308, "combined_score": 733 }, { "protein2": "8022.A0A060X3D3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 185, "database": 824, "textmining": 320, "combined_score": 896 }, { "protein2": "8022.A0A060YT60", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 712, "database": 825, "textmining": 411, "combined_score": 967 }, { "protein2": "8022.A0A060ZXZ7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 125, "experimental": 363, "database": 825, "textmining": 505, "combined_score": 945 }, { "protein2": "8022.A0A060WVX3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 667, "textmining": 167, "combined_score": 713 }, { "protein2": "8022.A0A060Y4P1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 217, "database": 764, "textmining": 86, "combined_score": 816 }, { "protein2": "8022.A0A060YFT4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 335, "database": 570, "textmining": 0, "combined_score": 701 }, { "protein2": "8022.A0A060Z681", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 889, "database": 832, "textmining": 505, "combined_score": 989 }, { "protein2": "8022.A0A060VN59", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060X678", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060Y0Y0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 764, "textmining": 144, "combined_score": 791 }, { "protein2": "8022.A0A060X4V6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060YX93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 764, "textmining": 0, "combined_score": 765 }, { "protein2": "8022.A0A060WDK2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 880, "database": 841, "textmining": 423, "combined_score": 988 }, { "protein2": "8022.A0A060VW27", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 341, "database": 654, "textmining": 107, "combined_score": 778 }, { "protein2": "8022.A0A060YWL7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 908, "database": 827, "textmining": 489, "combined_score": 991 }, { "protein2": "8022.A0A060W7T1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060WDS6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 175, "database": 737, "textmining": 246, "combined_score": 822 }, { "protein2": "8022.A0A060WZ23", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 335, "database": 570, "textmining": 0, "combined_score": 701 }, { "protein2": "8022.A0A060XUA7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 185, "database": 755, "textmining": 320, "combined_score": 856 }, { "protein2": "8022.A0A060WIC9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 764, "textmining": 144, "combined_score": 791 }, { "protein2": "8022.A0A060XCU8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 217, "database": 654, "textmining": 86, "combined_score": 730 }, { "protein2": "8022.A0A060XLZ6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 185, "database": 755, "textmining": 320, "combined_score": 856 }, { "protein2": "8022.A0A060YFY3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 341, "database": 654, "textmining": 107, "combined_score": 778 }, { "protein2": "8022.A0A060X3K2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 824, "textmining": 237, "combined_score": 861 }, { "protein2": "8022.A0A060WR55", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 397, "database": 619, "textmining": 135, "combined_score": 789 }, { "protein2": "8022.A0A060YQJ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060WGD6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 824, "textmining": 230, "combined_score": 859 }, { "protein2": "8022.A0A060W010", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 880, "database": 841, "textmining": 423, "combined_score": 988 }, { "protein2": "8022.A0A060WH79", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 880, "database": 862, "textmining": 443, "combined_score": 990 }, { "protein2": "8022.A0A060Y8M4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060YMA8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060X7V7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 667, "textmining": 167, "combined_score": 713 }, { "protein2": "8022.A0A060X4A4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060WE22", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 341, "database": 654, "textmining": 107, "combined_score": 778 }, { "protein2": "8022.A0A060YTI2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 449, "combined_score": 842 }, { "protein2": "8022.A0A060WMC0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 175, "database": 737, "textmining": 246, "combined_score": 822 }, { "protein2": "8022.A0A060Y599", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060X4L3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 217, "database": 654, "textmining": 86, "combined_score": 730 }, { "protein2": "8022.A0A060Y8P3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 217, "database": 667, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060WRE1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 880, "database": 836, "textmining": 389, "combined_score": 987 }, { "protein2": "8022.A0A060XKG4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 185, "database": 824, "textmining": 320, "combined_score": 896 }, { "protein2": "8022.A0A060WH36", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 217, "database": 764, "textmining": 86, "combined_score": 816 }, { "protein2": "8022.A0A060WTZ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 880, "database": 836, "textmining": 389, "combined_score": 987 }, { "protein2": "8022.A0A060XRP8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 764, "textmining": 150, "combined_score": 792 }, { "protein2": "8022.A0A060XTA1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 449, "combined_score": 842 }, { "protein2": "8022.A0A060W1A6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 499, "database": 785, "textmining": 228, "combined_score": 911 }, { "protein2": "8022.A0A060XQK8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060X9J9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060YCY4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 908, "database": 827, "textmining": 489, "combined_score": 991 }, { "protein2": "8022.A0A060YHN1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 185, "database": 755, "textmining": 320, "combined_score": 856 }, { "protein2": "8022.A0A060YTB0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 499, "database": 785, "textmining": 228, "combined_score": 911 }, { "protein2": "8022.A0A060X2Z7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 824, "textmining": 237, "combined_score": 861 }, { "protein2": "8022.A0A060Y4X6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 217, "database": 667, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060YPE8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 499, "database": 824, "textmining": 228, "combined_score": 927 }, { "protein2": "8022.A0A060YPV1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 499, "database": 785, "textmining": 228, "combined_score": 911 }, { "protein2": "8022.A0A060WBE7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 53, "experimental": 254, "database": 744, "textmining": 108, "combined_score": 817 }, { "protein2": "8022.A0A060XR59", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060XMS2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060W620", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 175, "database": 737, "textmining": 246, "combined_score": 822 }, { "protein2": "8022.A0A060Y3L3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060XEQ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 234, "database": 572, "textmining": 317, "combined_score": 756 }, { "protein2": "8022.A0A060XTF4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060WSK7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 341, "database": 654, "textmining": 107, "combined_score": 778 }, { "protein2": "8022.A0A060W9W2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 449, "combined_score": 842 }, { "protein2": "8022.A0A060Y5J3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 217, "database": 667, "textmining": 86, "combined_score": 740 }, { "protein2": "8022.A0A060Y4W6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 261, "database": 506, "textmining": 308, "combined_score": 733 }, { "protein2": "8022.A0A060Y8T1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060XE11", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 450, "combined_score": 842 }, { "protein2": "8022.A0A060WUS8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 764, "textmining": 0, "combined_score": 765 }, { "protein2": "8022.A0A060YBF2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 450, "combined_score": 842 }, { "protein2": "8022.A0A061A6D5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060W9J5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 112, "combined_score": 746 }, { "protein2": "8022.A0A060WNK3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 341, "database": 654, "textmining": 107, "combined_score": 778 }, { "protein2": "8022.A0A060YTY7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 341, "database": 654, "textmining": 107, "combined_score": 778 }, { "protein2": "8022.A0A060ZCG7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060VMS8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060WWY0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060VXV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 341, "database": 654, "textmining": 107, "combined_score": 778 }, { "protein2": "8022.A0A060Z2R2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 98, "combined_score": 742 }, { "protein2": "8022.A0A060XV27", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 458, "database": 515, "textmining": 112, "combined_score": 746 }, { "protein2": "8022.A0A060YYR0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 341, "database": 654, "textmining": 107, "combined_score": 778 }, { "protein2": "8022.A0A060ZCR8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 764, "textmining": 150, "combined_score": 792 }, { "protein2": "8022.A0A060ZBY8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 397, "database": 619, "textmining": 135, "combined_score": 789 }, { "protein2": "8022.A0A060YHR8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 0, "database": 667, "textmining": 167, "combined_score": 713 } ]
A0A060YGE9
G-protein coupled receptors family 1 profile domain-containing protein
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
375
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}. Early endosome {ECO:0000256|ARBA:ARBA00004412}.
MPVYQGARCRTCFSQNEKMTTEFITDFTDYPTDNTDLDYDHWTQQCQKESNRHFRSWFMPTFYSLICFLGLVGNILVIGTYVYFNRLKTGTDVFLLSLSVADLLFVVSLPLWATNSMTEWVLGLFICKAMHTIYKVSFYSGMFLLASISVDRYFAISKAVSAHRHRSMAVFISKVTSVVIWVMALVFSVPEMSYTNISNKTCTPYTAGSDQVRVAIQVSQMVLGFVLPLLIMAFCYGAIVKTLCQARSFEKNKAIKVIFTLVAVFLLCQVPYNLVLLLTTLDAAKGGSKDCLYDNSLLYAADITQCLAFLRCCLNPFVYAFIGVKFRRDLLKLLKDLGCMSKERFFHTSQKFGHTYSFQGLLYWYYFLHLKTSKP
[ "GO:0006952", "GO:0140546", "GO:0009605", "GO:0050896", "GO:0009615", "GO:0051607", "GO:0051707", "GO:0009607", "GO:0006950", "GO:0098542", "GO:0008150", "GO:0044419", "GO:0043207", "GO:0110165", "GO:0005575", "GO:0016020" ]
[ "GO:0008150", "GO:0050896", "GO:0044419", "GO:0009605", "GO:0051707", "GO:0009607", "GO:0006950", "GO:0006952", "GO:0009615", "GO:0098542", "GO:0043207", "GO:0140546", "GO:0051607" ]
null
[ "GO:0005575", "GO:0110165", "GO:0016020" ]
[ "IPR050119", "IPR000355", "IPR001277", "IPR000276", "IPR017452" ]
af_db/AF-A0A060YGE9-F1-model_v4.cif.gz
8022.A0A060YGE9
[ "8022.A0A060WB80", "8022.A0A060Y0D9", "8022.A0A060Y300", "8022.A0A060Y3X6", "8022.A0A060WRY3", "8022.A0A060YK59", "8022.A0A060W8I0", "8022.A0A060XA34", "8022.A0A060WZ17", "8022.A0A060WZ98", "8022.A0A060XGQ8", "8022.Q64IC2", "8022.A0A060Z480", "8022.A0A060YR93", "8022.A0A060WQA6", "8022.A0A060WVZ9", "8022.A0A060X2G9", "8022.A0A060WUE4", "8022.Q1G669", "8022.A0A060XRQ9", "8022.A0A060XVD9", "8022.A0A060VTH0", "8022.H1ZZ93", "8022.A0A060WIW2", "8022.A0A060W0Q4", "8022.A0A060VTG0", "8022.H1ZZ96", "8022.A0A060WXC1", "8022.A0A060W8T4", "8022.A0A060XL04", "8022.A0A060Y097", "8022.A0A060WHG5", "8022.A0A060YC25", "8022.A0A060XF71", "8022.A0A060WT98", "8022.A0A060WGC3", "8022.A0A060YA11", "8022.A0A060WVB6", "8022.A0A060YNV4", "8022.A0A060WD73", "8022.A0A060XSB8", "8022.A0A060YBB6", "8022.A0A060VST7", "8022.A0A060YL85", "8022.A0A060YH38", "8022.A0A060Y1H7", "8022.A0A060Y1Y5", "8022.A0A060XPS3", "8022.A0A060WMN1" ]
[ { "protein2": "8022.A0A060WB80", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 645, "textmining": 506, "combined_score": 817 }, { "protein2": "8022.A0A060Y0D9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 188, "database": 787, "textmining": 92, "combined_score": 829 }, { "protein2": "8022.A0A060Y300", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 93, "database": 747, "textmining": 218, "combined_score": 804 }, { "protein2": "8022.A0A060Y3X6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 153, "combined_score": 783 }, { "protein2": "8022.A0A060WRY3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 87, "combined_score": 766 }, { "protein2": "8022.A0A060YK59", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 341, "database": 569, "textmining": 49, "combined_score": 706 }, { "protein2": "8022.A0A060W8I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 839, "textmining": 86, "combined_score": 846 }, { "protein2": "8022.A0A060XA34", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 341, "database": 569, "textmining": 49, "combined_score": 706 }, { "protein2": "8022.A0A060WZ17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 202, "database": 787, "textmining": 276, "combined_score": 870 }, { "protein2": "8022.A0A060WZ98", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 319, "database": 755, "textmining": 51, "combined_score": 827 }, { "protein2": "8022.A0A060XGQ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 275, "database": 787, "textmining": 308, "combined_score": 883 }, { "protein2": "8022.Q64IC2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 188, "database": 826, "textmining": 62, "combined_score": 855 }, { "protein2": "8022.A0A060Z480", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 341, "database": 569, "textmining": 49, "combined_score": 706 }, { "protein2": "8022.A0A060YR93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 341, "database": 569, "textmining": 49, "combined_score": 706 }, { "protein2": "8022.A0A060WQA6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 787, "textmining": 48, "combined_score": 789 }, { "protein2": "8022.A0A060WVZ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 0, "combined_score": 701 }, { "protein2": "8022.A0A060X2G9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 0, "combined_score": 701 }, { "protein2": "8022.A0A060WUE4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 87, "combined_score": 766 }, { "protein2": "8022.Q1G669", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 826, "textmining": 175, "combined_score": 850 }, { "protein2": "8022.A0A060XRQ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 0, "combined_score": 701 }, { "protein2": "8022.A0A060XVD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 291, "database": 783, "textmining": 0, "combined_score": 839 }, { "protein2": "8022.A0A060VTH0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 787, "textmining": 168, "combined_score": 815 }, { "protein2": "8022.H1ZZ93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 275, "database": 787, "textmining": 308, "combined_score": 883 }, { "protein2": "8022.A0A060WIW2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 426, "database": 425, "textmining": 222, "combined_score": 720 }, { "protein2": "8022.A0A060W0Q4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 341, "database": 569, "textmining": 49, "combined_score": 706 }, { "protein2": "8022.A0A060VTG0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 319, "database": 755, "textmining": 51, "combined_score": 827 }, { "protein2": "8022.H1ZZ96", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 787, "textmining": 168, "combined_score": 815 }, { "protein2": "8022.A0A060WXC1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 0, "combined_score": 701 }, { "protein2": "8022.A0A060W8T4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 341, "database": 569, "textmining": 49, "combined_score": 706 }, { "protein2": "8022.A0A060XL04", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 188, "database": 839, "textmining": 403, "combined_score": 916 }, { "protein2": "8022.A0A060Y097", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 188, "database": 787, "textmining": 182, "combined_score": 846 }, { "protein2": "8022.A0A060WHG5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 341, "database": 569, "textmining": 49, "combined_score": 706 }, { "protein2": "8022.A0A060YC25", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 341, "database": 569, "textmining": 49, "combined_score": 706 }, { "protein2": "8022.A0A060XF71", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 93, "database": 785, "textmining": 234, "combined_score": 837 }, { "protein2": "8022.A0A060WT98", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 87, "combined_score": 766 }, { "protein2": "8022.A0A060WGC3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 0, "combined_score": 701 }, { "protein2": "8022.A0A060YA11", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 188, "database": 839, "textmining": 274, "combined_score": 898 }, { "protein2": "8022.A0A060WVB6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 72, "experimental": 202, "database": 826, "textmining": 365, "combined_score": 907 }, { "protein2": "8022.A0A060YNV4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 93, "database": 785, "textmining": 234, "combined_score": 837 }, { "protein2": "8022.A0A060WD73", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 153, "combined_score": 783 }, { "protein2": "8022.A0A060XSB8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 0, "combined_score": 701 }, { "protein2": "8022.A0A060YBB6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 188, "database": 826, "textmining": 182, "combined_score": 874 }, { "protein2": "8022.A0A060VST7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 755, "textmining": 153, "combined_score": 783 }, { "protein2": "8022.A0A060YL85", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 319, "database": 755, "textmining": 51, "combined_score": 827 }, { "protein2": "8022.A0A060YH38", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 787, "textmining": 48, "combined_score": 789 }, { "protein2": "8022.A0A060Y1H7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 0, "combined_score": 701 }, { "protein2": "8022.A0A060Y1Y5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 93, "database": 761, "textmining": 0, "combined_score": 773 }, { "protein2": "8022.A0A060XPS3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 0, "combined_score": 701 }, { "protein2": "8022.A0A060WMN1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 564, "textmining": 0, "combined_score": 701 } ]
A0A060ZZG4
Ig-like domain-containing protein
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
234
null
MCSFTFRLVDGGLMFLLLSLTRISAQREMSLNTTTISHYTESPCQLFDKYETTVTEGEALSLPAYRDLSELVWASVTEFTWYRNRTQELPSSEEERVHHHGPVLFFLPLLINDSDQYYTYWRKGADTCLIFVTEVIVVKAQPFDHSVLFNDISESAENIAIPCPDPVEKLCQDGKENLVWYKNFSLIPNESERNLWVYGASKADEGIYTCVCTWEHNGTVLNTSASRRLKIQGM
[ "GO:1901223", "GO:0002764", "GO:0031347", "GO:0051641", "GO:0009968", "GO:0065007", "GO:0034504", "GO:0010648", "GO:0023057", "GO:0002831", "GO:0032103", "GO:0051179", "GO:0045089", "GO:0033365", "GO:0048518", "GO:0050776", "GO:0008150", "GO:0002758", "GO:0045088", "GO:0002757", "GO:0050896", "GO:0050789", "GO:0048584", "GO:0010646", "GO:0002833", "GO:0080134", "GO:0002684", "GO:0050794", "GO:0009966", "GO:0048583", "GO:1901222", "GO:0002221", "GO:0051716", "GO:0070727", "GO:0002376", "GO:0050778", "GO:0032101", "GO:0023051", "GO:0009987", "GO:0002682", "GO:0023052", "GO:0031349", "GO:1902532", "GO:0002253", "GO:0002224", "GO:0008104", "GO:0033036", "GO:0048523", "GO:0048519", "GO:0048585", "GO:1902531", "GO:0007154", "GO:0007165", "GO:0002218", "GO:0005622", "GO:0031090", "GO:0043226", "GO:0031967", "GO:0016234", "GO:0031965", "GO:0005783", "GO:0031975", "GO:0005575", "GO:0005635", "GO:0016020", "GO:0043231", "GO:0043229", "GO:0110165", "GO:0005737", "GO:0043227", "GO:0012505", "GO:0005634" ]
[ "GO:0008150", "GO:0065007", "GO:0051179", "GO:0048518", "GO:0050896", "GO:0050789", "GO:0002376", "GO:0009987", "GO:0023052", "GO:0048519", "GO:0051641", "GO:0023057", "GO:0048584", "GO:0002684", "GO:0050794", "GO:0048583", "GO:0051716", "GO:0023051", "GO:0002682", "GO:0002253", "GO:0033036", "GO:0048523", "GO:0048585", "GO:0007154", "GO:0007165", "GO:0002764", "GO:0009968", "GO:0010648", "GO:0002831", "GO:0032103", "GO:0050776", "GO:0002757", "GO:0010646", "GO:0002833", "GO:0080134", "GO:0009966", "GO:0070727", "GO:0050778", "GO:0032101", "GO:0031349", "GO:0002218", "GO:0031347", "GO:0045089", "GO:0002758", "GO:0045088", "GO:1902532", "GO:0008104", "GO:1902531", "GO:1901223", "GO:0033365", "GO:1901222", "GO:0002221", "GO:0034504", "GO:0002224" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0031975", "GO:0016020", "GO:0005737", "GO:0012505", "GO:0031090", "GO:0031967", "GO:0016234", "GO:0005783", "GO:0005635", "GO:0043229", "GO:0043227", "GO:0031965", "GO:0043231", "GO:0005634" ]
[ "IPR036179", "IPR013783", "IPR015621" ]
af_db/AF-A0A060ZZG4-F1-model_v4.cif.gz
8022.A0A060ZZG4
[ "8022.A0A060ZXZ7", "8022.C1BEZ2", "8022.A0A060WTK5", "8022.A0A060WD93", "8022.A0A060VYK6", "8022.A0A061AEF4", "8022.A0A060WVY3", "8022.A0A060YRQ4", "8022.A0A060YIW1", "8022.A0A060YIQ8", "8022.A0A060Z3R0", "8022.A0A060YP34", "8022.A0A060WQS0", "8022.A0A060XXD6", "8022.A0A060W2E3", "8022.A0A060WBT7", "8022.A0A060YNP8", "8022.A0A060Z0U0", "8022.A0A060X3S2", "8022.A0A060WYH3" ]
[ { "protein2": "8022.A0A060ZXZ7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 322, "database": 597, "textmining": 359, "combined_score": 815 }, { "protein2": "8022.C1BEZ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 571, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060WTK5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 686, "database": 787, "textmining": 389, "combined_score": 955 }, { "protein2": "8022.A0A060WD93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 86, "experimental": 929, "database": 830, "textmining": 505, "combined_score": 993 }, { "protein2": "8022.A0A060VYK6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 571, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A061AEF4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 0, "database": 762, "textmining": 133, "combined_score": 789 }, { "protein2": "8022.A0A060WVY3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 0, "database": 778, "textmining": 276, "combined_score": 835 }, { "protein2": "8022.A0A060YRQ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 571, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060YIW1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 322, "database": 597, "textmining": 264, "combined_score": 781 }, { "protein2": "8022.A0A060YIQ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 541, "database": 787, "textmining": 134, "combined_score": 908 }, { "protein2": "8022.A0A060Z3R0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 0, "database": 762, "textmining": 133, "combined_score": 789 }, { "protein2": "8022.A0A060YP34", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 0, "database": 778, "textmining": 276, "combined_score": 835 }, { "protein2": "8022.A0A060WQS0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 571, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060XXD6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 541, "database": 787, "textmining": 134, "combined_score": 908 }, { "protein2": "8022.A0A060W2E3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 571, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060WBT7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 0, "database": 778, "textmining": 276, "combined_score": 835 }, { "protein2": "8022.A0A060YNP8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 828, "textmining": 494, "combined_score": 939 }, { "protein2": "8022.A0A060Z0U0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 686, "database": 787, "textmining": 389, "combined_score": 955 }, { "protein2": "8022.A0A060X3S2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 823, "textmining": 391, "combined_score": 887 }, { "protein2": "8022.A0A060WYH3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 571, "textmining": 86, "combined_score": 727 } ]
A0A0A7MA29
Prostaglandin E2 receptor EP4 subtype (Prostanoid EP4 receptor)
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function. {ECO:0000256|ARBA:ARBA00025493}.
Salmo salar (Atlantic salmon)
472
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
MSGMNNGTMTSGPREPTIPVIMFIFGVVGNVIAIVVLRKSRKEQKETTFYTLVCGLAVTDLLGTLLASPVTIATYVQGKWPGGESLCQYSGFILLFFFLVGLSIICAMSIERYLAINHAYFYNHYVDQRLAALTLAGIYISNVLFCALPAMGLGKVNKQFPGTWCFIDWRTNDSAHAAFSYMYAGVSSFLILATVICNVLVCGALIMMHKRFIRRTSLGTDQGGRIADLRRRRSFQRLAGAEIQMVILLIATSAVVLVCSIPLVLRVFVNQLSMVAFDAHSTPLEKNPDLHAIRIASINPILDPWIYILLRKTVLLKLVEKIKCLFCRMGCRGRGSGVRGQFHCGGEGHPNSSIVSRDSPSLVSRELREVISTSQTFLYLPEGTGGGSRGTGGEGRPSPPAVECSLLQDQQTPGGKGMQNDSKKGTLGPSISMRTDGTVDPSPLNRVPSVRKDKTLHVTFTDETLNLQEKCI
[ "GO:1901655", "GO:0071379", "GO:0065007", "GO:0097305", "GO:0032870", "GO:0008150", "GO:0042221", "GO:1901654", "GO:0050896", "GO:0050789", "GO:0019222", "GO:0071310", "GO:0033993", "GO:0070887", "GO:0010605", "GO:0009719", "GO:0034695", "GO:0034694", "GO:0051716", "GO:0071495", "GO:0060255", "GO:0009987", "GO:0071380", "GO:1901700", "GO:0097306", "GO:0010033", "GO:0048519", "GO:1901701", "GO:0009725", "GO:0010629", "GO:0010468", "GO:0009892", "GO:0071396", "GO:0110165", "GO:0005575", "GO:0016020" ]
[ "GO:0008150", "GO:0065007", "GO:0050896", "GO:0050789", "GO:0009987", "GO:0048519", "GO:0042221", "GO:0019222", "GO:0009719", "GO:0051716", "GO:0009892", "GO:0070887", "GO:0010605", "GO:0071495", "GO:0060255", "GO:1901700", "GO:0010033", "GO:0009725", "GO:0097305", "GO:0032870", "GO:1901654", "GO:0071310", "GO:0033993", "GO:0034694", "GO:1901701", "GO:0010629", "GO:0010468", "GO:1901655", "GO:0071379", "GO:0034695", "GO:0097306", "GO:0071396", "GO:0071380" ]
null
[ "GO:0005575", "GO:0110165", "GO:0016020" ]
[ "IPR000276", "IPR017452", "IPR001758", "IPR008365", "IPR001244" ]
af_db/AF-A0A0A7MA29-F1-model_v4.cif.gz
null
null
null
A0A060D574
Sodium/potassium-transporting ATPase subunit alpha
null
Salmo salar (Atlantic salmon)
875
Cell membrane, sarcolemma {ECO:0000256|ARBA:ARBA00004415}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004415}. Cell membrane {ECO:0000256|RuleBase:RU362084}; Multi-pass membrane protein {ECO:0000256|RuleBase:RU362084}.
KQMFGGFSMLLWTGALLCFLAYGIQAAMEDEPANDNLYLGVVLSAVVIVTGCFSYYQEAKSSKIMDSFKNLVPQQALVVRDGEKMNINAQQVVVGDLVEVKGGDRIPADLRIISASGCKVDNSSLTGESEPQTRTPDYSNDNPLETRNIAFFSTNCVEGTARGIVINTGDRTVMGRIATLASGLEVGRTPISIEIEHFIHIITGVAVFLGMSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGTSFDRSSATWAALARVAGLCNRAVFLAEQSGIPILKRDVAGDASESALLKCIELCCGSVQGMRDQYTKVAEIPFNSTNKYQLSVHLNKNEGESKHLLVMKGAPERILDRCSTILIQGKEQPLDDEMKDSFQNAYMELGGLGERVLGFCHFQLPDDQFAEGFQFDCEEVNFPTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNEVDPRDAKACVVHGGDLKDLSAEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSKTDKLVNERLISIAYGQIGMIQALAGFFTYFVILAENGFLPSRLLGIRVDWDNKFCNDLEDSYGQQWTYEQRKIVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMRNKILIFGLFEETALAAFL
[ "GO:0006970", "GO:0050896", "GO:0009628", "GO:0009651", "GO:0006950", "GO:0008150", "GO:0042538", "GO:0006972", "GO:0045178", "GO:0009925", "GO:0110165", "GO:0016323", "GO:0098590", "GO:0071944", "GO:0005575", "GO:0016020", "GO:0005886", "GO:0015399", "GO:0008556", "GO:0008554", "GO:0015079", "GO:0140358", "GO:0022890", "GO:0005215", "GO:0015662", "GO:1901702", "GO:0022853", "GO:0042626", "GO:0015075", "GO:0005391", "GO:0022857", "GO:0015318", "GO:0008324", "GO:0140657", "GO:0046873", "GO:0015081", "GO:0003674", "GO:0019829", "GO:0022804" ]
[ "GO:0008150", "GO:0050896", "GO:0009628", "GO:0006950", "GO:0006970", "GO:0009651", "GO:0006972", "GO:0042538" ]
[ "GO:0003674", "GO:0005215", "GO:0140657", "GO:0042626", "GO:0022857", "GO:0140358", "GO:1901702", "GO:0015075", "GO:0015318", "GO:0019829", "GO:0022804", "GO:0015399", "GO:0008556", "GO:0008554", "GO:0015079", "GO:0022890", "GO:0015662", "GO:0022853", "GO:0008324", "GO:0015081", "GO:0005391", "GO:0046873" ]
[ "GO:0005575", "GO:0110165", "GO:0045178", "GO:0071944", "GO:0016020", "GO:0009925", "GO:0098590", "GO:0005886", "GO:0016323" ]
[ "IPR006068", "IPR023299", "IPR018303", "IPR023298", "IPR008250", "IPR050510", "IPR036412", "IPR023214", "IPR005775", "IPR001757", "IPR044492" ]
af_db/AF-A0A060D574-F1-model_v4.cif.gz
null
null
null
A0A060W139
Alpha-2A adrenergic receptor (Alpha-2A adrenoreceptor)
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
390
Cell membrane {ECO:0000256|ARBA:ARBA00004651}; Multi-pass membrane protein {ECO:0000256|ARBA:ARBA00004651}.
MGCDNLTNSNKTLPGRLPYTVQTSVPLTILVGILILLTVFGNVLVVIAVFTSRALRAPQNLFLVSLACADILVATLVMPFSLANELMGYWYFGQVWCEIYLALDVLFCTSSITHLCAISLDRYWSVTQAIEYNSKRTPRRIKCIVLFVWVLAAIISFPPLISMEKEGAKEEGPTCKINEEKWYIIFSSTASFFAPCVIMILVYVRIYQVAKNRTRAPPGERRRGNNNPDKSQRNREGGRDGVEEVNGIDVGEECSSSDGNENQCSIKMKLRKGKTKVSQVKLEDPSPKDYDAQQCVKVSRWKGRQNREKRFTFVLAVVMGVFVVCWFPFFFTYTLTAICESCCVPETLFNFFFWFGYCNSSLNPVIYTIFNNDFRRSFKKILCKKDRRGL
[ "GO:0051716", "GO:0051602", "GO:0009628", "GO:0009987", "GO:0051952", "GO:0065007", "GO:0023052", "GO:1903530", "GO:0032811", "GO:0033604", "GO:0051046", "GO:0051049", "GO:0051051", "GO:0008150", "GO:0071875", "GO:0050896", "GO:0050789", "GO:0014060", "GO:0051953", "GO:0050433", "GO:0048523", "GO:0048519", "GO:0007186", "GO:0051048", "GO:0032879", "GO:1903531", "GO:0007154", "GO:0007165", "GO:0050794" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0023052", "GO:0050896", "GO:0050789", "GO:0048519", "GO:0051716", "GO:0009628", "GO:0051051", "GO:0048523", "GO:0032879", "GO:0007154", "GO:0007165", "GO:0050794", "GO:0051602", "GO:1903530", "GO:0051049", "GO:0051953", "GO:0007186", "GO:0051048", "GO:1903531", "GO:0051952", "GO:0033604", "GO:0051046", "GO:0071875", "GO:0050433", "GO:0032811", "GO:0014060" ]
null
null
[ "IPR002233", "IPR000276", "IPR017452" ]
af_db/AF-A0A060W139-F1-model_v4.cif.gz
8022.A0A060W139
[ "8022.A0A060ZAK0", "8022.A0A060W8V2", "8022.A0A060XVD9", "8022.A0A060XC17", "8022.A0A060WL89", "8022.A0A060YP44", "8022.A0A060Z6I0", "8022.C1BH40", "8022.A0A060WEW9", "8022.A0A060Z6E2", "8022.A0A060Z1D1", "8022.A0A060Y8H5", "8022.A0A060WHA4", "8022.A0A060YR57", "8022.A0A060Y2Z0", "8022.Q7SZV5" ]
[ { "protein2": "8022.A0A060ZAK0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 416, "database": 571, "textmining": 89, "combined_score": 751 }, { "protein2": "8022.A0A060W8V2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 596, "textmining": 0, "combined_score": 728 }, { "protein2": "8022.A0A060XVD9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 291, "database": 783, "textmining": 0, "combined_score": 839 }, { "protein2": "8022.A0A060XC17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 571, "textmining": 0, "combined_score": 708 }, { "protein2": "8022.A0A060WL89", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 579, "textmining": 0, "combined_score": 716 }, { "protein2": "8022.A0A060YP44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 523, "textmining": 88, "combined_score": 716 }, { "protein2": "8022.A0A060Z6I0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 401, "database": 523, "textmining": 88, "combined_score": 716 }, { "protein2": "8022.C1BH40", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 626, "database": 523, "textmining": 0, "combined_score": 816 }, { "protein2": "8022.A0A060WEW9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 579, "textmining": 0, "combined_score": 716 }, { "protein2": "8022.A0A060Z6E2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 579, "textmining": 0, "combined_score": 716 }, { "protein2": "8022.A0A060Z1D1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 626, "database": 523, "textmining": 0, "combined_score": 816 }, { "protein2": "8022.A0A060Y8H5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 349, "database": 596, "textmining": 0, "combined_score": 725 }, { "protein2": "8022.A0A060WHA4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 149, "experimental": 267, "database": 571, "textmining": 86, "combined_score": 722 }, { "protein2": "8022.A0A060YR57", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 579, "textmining": 0, "combined_score": 716 }, { "protein2": "8022.A0A060Y2Z0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 355, "database": 579, "textmining": 0, "combined_score": 716 }, { "protein2": "8022.Q7SZV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 387, "database": 568, "textmining": 86, "combined_score": 736 } ]
A0A060WMZ6
TIR domain-containing protein
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
230
null
MGLCVVLLLFFLLAAVAVKVFDIDLALLFRGVFKCCGRSEDGKVYDAYVVYQMDGLDQEREEKVYHFVSIVLPTVLEKKCGFRLFIHGRDDLPGEDNMELVEDCMRLSRRLIVILTPSSSTWSGSGGQGSCGQWGYSSSLTTAGDYDCQVGLLQALVHSEMNVILIQLGDMGEGGYTHLPPGLQHLVRKSAPLMWHEGRRGSTLPNSSFWKRVRYMMPWPRSTSFDNQLI
[ "GO:1901223", "GO:0002764", "GO:0031347", "GO:0051641", "GO:0009968", "GO:0065007", "GO:0034504", "GO:0010648", "GO:0023057", "GO:0002831", "GO:0032103", "GO:0051179", "GO:0045089", "GO:0033365", "GO:0048518", "GO:0050776", "GO:0008150", "GO:0002758", "GO:0045088", "GO:0002757", "GO:0050896", "GO:0050789", "GO:0048584", "GO:0010646", "GO:0002833", "GO:0080134", "GO:0002684", "GO:0050794", "GO:0009966", "GO:0048583", "GO:1901222", "GO:0002221", "GO:0051716", "GO:0070727", "GO:0002376", "GO:0050778", "GO:0032101", "GO:0023051", "GO:0009987", "GO:0002682", "GO:0023052", "GO:0031349", "GO:1902532", "GO:0002253", "GO:0002224", "GO:0008104", "GO:0033036", "GO:0048523", "GO:0048519", "GO:0048585", "GO:1902531", "GO:0007154", "GO:0007165", "GO:0002218", "GO:0005622", "GO:0031090", "GO:0043226", "GO:0031967", "GO:0016234", "GO:0031965", "GO:0005783", "GO:0031975", "GO:0005575", "GO:0005635", "GO:0016020", "GO:0043231", "GO:0043229", "GO:0110165", "GO:0005737", "GO:0043227", "GO:0012505", "GO:0005634" ]
[ "GO:0008150", "GO:0065007", "GO:0051179", "GO:0048518", "GO:0050896", "GO:0050789", "GO:0002376", "GO:0009987", "GO:0023052", "GO:0048519", "GO:0051641", "GO:0023057", "GO:0048584", "GO:0002684", "GO:0050794", "GO:0048583", "GO:0051716", "GO:0023051", "GO:0002682", "GO:0002253", "GO:0033036", "GO:0048523", "GO:0048585", "GO:0007154", "GO:0007165", "GO:0002764", "GO:0009968", "GO:0010648", "GO:0002831", "GO:0032103", "GO:0050776", "GO:0002757", "GO:0010646", "GO:0002833", "GO:0080134", "GO:0009966", "GO:0070727", "GO:0050778", "GO:0032101", "GO:0031349", "GO:0002218", "GO:0031347", "GO:0045089", "GO:0002758", "GO:0045088", "GO:1902532", "GO:0008104", "GO:1902531", "GO:1901223", "GO:0033365", "GO:1901222", "GO:0002221", "GO:0034504", "GO:0002224" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0031975", "GO:0016020", "GO:0005737", "GO:0012505", "GO:0031090", "GO:0031967", "GO:0016234", "GO:0005783", "GO:0005635", "GO:0043229", "GO:0043227", "GO:0031965", "GO:0043231", "GO:0005634" ]
[ "IPR015621", "IPR000157", "IPR035897" ]
af_db/AF-A0A060WMZ6-F1-model_v4.cif.gz
8022.A0A060WMZ6
[ "8022.A0A060W2E3", "8022.A0A060WBT7", "8022.A0A060XXD6", "8022.A0A060YNP8", "8022.A0A060Z0U0", "8022.A0A060WYH3", "8022.A0A060X3S2", "8022.A0A060WTK5", "8022.C1BEZ2", "8022.A0A060ZXZ7", "8022.A0A061AEF4", "8022.A0A060WVY3", "8022.A0A060VYK6", "8022.A0A060WD93", "8022.A0A060YIW1", "8022.A0A060YIQ8", "8022.A0A060YRQ4", "8022.A0A060WQS0", "8022.A0A060Z3R0", "8022.A0A060YP34" ]
[ { "protein2": "8022.A0A060W2E3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 571, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060WBT7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 0, "database": 778, "textmining": 276, "combined_score": 835 }, { "protein2": "8022.A0A060XXD6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 541, "database": 787, "textmining": 134, "combined_score": 908 }, { "protein2": "8022.A0A060YNP8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 828, "textmining": 494, "combined_score": 939 }, { "protein2": "8022.A0A060Z0U0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 686, "database": 787, "textmining": 389, "combined_score": 955 }, { "protein2": "8022.A0A060WYH3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 571, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060X3S2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 823, "textmining": 391, "combined_score": 887 }, { "protein2": "8022.A0A060WTK5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 686, "database": 787, "textmining": 389, "combined_score": 955 }, { "protein2": "8022.C1BEZ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 571, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060ZXZ7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 322, "database": 597, "textmining": 359, "combined_score": 815 }, { "protein2": "8022.A0A061AEF4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 0, "database": 762, "textmining": 133, "combined_score": 789 }, { "protein2": "8022.A0A060WVY3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 0, "database": 778, "textmining": 276, "combined_score": 835 }, { "protein2": "8022.A0A060VYK6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 571, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060WD93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 86, "experimental": 929, "database": 830, "textmining": 505, "combined_score": 993 }, { "protein2": "8022.A0A060YIW1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 322, "database": 597, "textmining": 264, "combined_score": 781 }, { "protein2": "8022.A0A060YIQ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 541, "database": 787, "textmining": 134, "combined_score": 908 }, { "protein2": "8022.A0A060YRQ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 571, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060WQS0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 362, "database": 571, "textmining": 86, "combined_score": 727 }, { "protein2": "8022.A0A060Z3R0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 0, "database": 762, "textmining": 133, "combined_score": 789 }, { "protein2": "8022.A0A060YP34", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 0, "database": 778, "textmining": 276, "combined_score": 835 } ]
A0A060XAF0
Fructose-1,6-bisphosphatase 1 (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 1) (Liver FBPase)
Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations, acting as a rate-limiting enzyme in gluconeogenesis. Plays a role in regulating glucose sensing and insulin secretion of pancreatic beta-cells. Appears to modulate glycerol gluconeogenesis in liver. Important regulator of appetite and adiposity; increased expression of the protein in liver after nutrient excess increases circulating satiety hormones and reduces appetite-stimulating neuropeptides and thus seems to provide a feedback mechanism to limit weight gain. {ECO:0000256|ARBA:ARBA00037308}.
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
337
null
MSERCAFDTNVVTLTRFVQEEGRKAKGTGELTTLLNSICTAVKAISTAVRKAGIANLYGIAGSTNVTGDQVKKLDVLSNDMVINMIKSSFTSCVLVSEENERALIVEPEKRGKYIVCFDPLDGSSNIDCLVSIGTIFAIYRKTTDDEPNEKDALQSGRHIVAAGYALYGSATMMVLSTGQGVNCFMLDPSIGEFILTDKDVKIKKRGKIYSLNEGYAQHFYPDITEYLKKKKYPEDGSAPYGGRYVGSMVADVHRTLVYGGIFLYPANVKSPKGKLRLLYECNPMSFIIEQAGGMATTGEMNVLDIKPENIHQRVPVVLGSPEDVQEYIAIYKKTRM
[ "GO:0050896", "GO:0009743", "GO:0010033", "GO:1901700", "GO:0034284", "GO:0009749", "GO:0008150", "GO:0042221", "GO:0009746", "GO:0019203", "GO:0042578", "GO:0042132", "GO:0003824", "GO:0016788", "GO:0003674", "GO:0016791", "GO:0050308", "GO:0016787" ]
[ "GO:0008150", "GO:0050896", "GO:0042221", "GO:0010033", "GO:1901700", "GO:0009743", "GO:0034284", "GO:0009746", "GO:0009749" ]
[ "GO:0003674", "GO:0003824", "GO:0016787", "GO:0016788", "GO:0042578", "GO:0016791", "GO:0019203", "GO:0050308", "GO:0042132" ]
null
[ "IPR044015", "IPR000146", "IPR033391", "IPR028343", "IPR020548" ]
af_db/AF-A0A060XAF0-F1-model_v4.cif.gz
8022.A0A060XAF0
[ "8022.A0A060VZM1", "8022.A0A060YS35", "8022.A0A060YAR4", "8022.A0A060XD08", "8022.A0A060Y6E6", "8022.A0A060Y974", "8022.A0A060X6R6", "8022.A0A060X6L1", "8022.A0A060Y2F6", "8022.A0A060XIP8", "8022.A0A060WDZ2", "8022.A0A060WWX4", "8022.A0A060VUG3", "8022.A0A060YIC2", "8022.A0A060XFI2", "8022.A0A060YAI9", "8022.A0A060YDE0", "8022.A0A060Z098", "8022.A0A060XE19", "8022.A0A060X7X1", "8022.A0A060WET7", "8022.A0A060YQT4", "8022.A0A060VNR1", "8022.A0A060Y0E2", "8022.A0A060WKY9", "8022.A0A060Y572", "8022.A0A060XQD6", "8022.A0A060Z8Y1", "8022.A0A060Y5A1", "8022.A0A060XH89", "8022.A0A060WBE2", "8022.A0A060VU68", "8022.A0A060YAU7", "8022.A0A060W078", "8022.A0A060VXB7", "8022.A0A060XXJ7", "8022.A0A060VVS9", "8022.A0A060VTT5", "8022.A0A060VPT7", "8022.A0A060XP04", "8022.A0A060X0C8", "8022.A0A060VW41", "8022.A0A060YIV6", "8022.A0A060Z666", "8022.A0A060W1Q7", "8022.A0A060XV20", "8022.A0A060YVM5", "8022.A0A060WTE4", "8022.A0A060Y149", "8022.A0A060XRV8", "8022.A0A060Z9H8", "8022.A0A060VNK8", "8022.A0A060Z2V0", "8022.A0A060XPQ5", "8022.A0A060YHN8", "8022.A0A060VMK2", "8022.A0A060WHT6", "8022.A0A060WEA8", "8022.A0A060Z5H7", "8022.A0A060VPR7", "8022.A0A060Z2Q3", "8022.A0A060X554", "8022.A0A060WTT7", "8022.A0A060XDI7", "8022.A0A060WUD2", "8022.A0A060WKL9", "8022.A0A060Z1V4", "8022.A0A060WN66", "8022.A0A060YVQ1", "8022.A0A060X451", "8022.A0A060Z1R4", "8022.A0A060WD05", "8022.A0A060X3G2", "8022.A0A060YBF1", "8022.A0A060XQG3", "8022.A0A060YKF3", "8022.A0A060ZEY9", "8022.A0A060XNA5", "8022.A0A060WZJ0", "8022.A0A060VWF5", "8022.A0A060Y609", "8022.A0A060WDJ5", "8022.A0A060X713", "8022.A0A060Y1A1", "8022.A0A060WI24", "8022.A0A060W743", "8022.A0A060Y3N4", "8022.A0A060WV51", "8022.A0A060WFB8", "8022.A0A060X7J3", "8022.A0A060Z2J6", "8022.A0A060X567", "8022.A0A060XB28", "8022.A0A060X323", "8022.A0A060YEC4", "8022.A0A060VYV2", "8022.A0A060X0T4", "8022.A0A060VVE5", "8022.A0A060Z6C0", "8022.A0A060XEE3", "8022.A0A060X7Z0", "8022.A0A060X7A0", "8022.A0A060YTU9", "8022.A0A060YSX6", "8022.A0A060W9M9", "8022.A0A060YVM7", "8022.A0A060YZW8", "8022.A0A060Z7Y7", "8022.A0A060YGA7", "8022.A0A060YK26", "8022.A0A060YKK6", "8022.A0A060XVB1", "8022.A0A060YV08", "8022.A0A060XEX5", "8022.A0A060W0T4", "8022.A0A060W458", "8022.A0A060XBK0", "8022.A0A060X2I1", "8022.A0A060Y7I6", "8022.A0A060XY35", "8022.A0A060VZK5", "8022.A0A060XTV2", "8022.A0A060WV84", "8022.A0A060W147", "8022.A0A060XZ30", "8022.A0A060XFS1", "8022.A0A060ZB08", "8022.A0A060ZAC2", "8022.A0A060YFA3", "8022.A0A060Y3Q3", "8022.A0A060WUI1", "8022.A0A060YLD3", "8022.A0A060WBZ8", "8022.A0A060X1D5", "8022.A0A060W2P0", "8022.A0A060Z8F9", "8022.A0A060XQL0", "8022.A0A060Z973", "8022.A0A060Y6U5", "8022.A0A060WAF6", "8022.A0A060YW82", "8022.A0A060YYC4", "8022.A0A060WN41", "8022.A0A060XHN5", "8022.A0A060WBT3", "8022.A0A060WHB9", "8022.A0A060WVQ0", "8022.A0A060VVL9", "8022.A0A060X8A4", "8022.A0A060WPX1", "8022.A0A060X816", "8022.A0A060ZPA8", "8022.A0A060X6V3", "8022.A0A060X1J6", "8022.A0A060X807", "8022.A0A060Y9T0", "8022.A0A060VXR5", "8022.A0A060VVZ9" ]
[ { "protein2": "8022.A0A060VZM1", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060YS35", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 816, "textmining": 308, "combined_score": 923 }, { "protein2": "8022.A0A060YAR4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 75, "experimental": 0, "database": 670, "textmining": 378, "combined_score": 793 }, { "protein2": "8022.A0A060XD08", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 825, "textmining": 308, "combined_score": 926 }, { "protein2": "8022.A0A060Y6E6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 830, "textmining": 44, "combined_score": 830 }, { "protein2": "8022.A0A060Y974", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 816, "textmining": 186, "combined_score": 848 }, { "protein2": "8022.A0A060X6R6", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060X6L1", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 568, "textmining": 411, "combined_score": 738 }, { "protein2": "8022.A0A060Y2F6", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 277, "database": 706, "textmining": 325, "combined_score": 861 }, { "protein2": "8022.A0A060XIP8", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060WDZ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 352, "combined_score": 875 }, { "protein2": "8022.A0A060WWX4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 80, "experimental": 0, "database": 670, "textmining": 309, "combined_score": 771 }, { "protein2": "8022.A0A060VUG3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 352, "combined_score": 875 }, { "protein2": "8022.A0A060YIC2", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 261, "combined_score": 853 }, { "protein2": "8022.A0A060XFI2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 155, "database": 816, "textmining": 0, "combined_score": 837 }, { "protein2": "8022.A0A060YAI9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 746, "database": 0, "textmining": 309, "combined_score": 816 }, { "protein2": "8022.A0A060YDE0", "neighborhood": 175, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 0, "database": 830, "textmining": 505, "combined_score": 931 }, { "protein2": "8022.A0A060Z098", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060XE19", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 654, "textmining": 225, "combined_score": 746 }, { "protein2": "8022.A0A060X7X1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 654, "textmining": 225, "combined_score": 746 }, { "protein2": "8022.A0A060WET7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 153, "database": 829, "textmining": 0, "combined_score": 848 }, { "protein2": "8022.A0A060YQT4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 51, "experimental": 0, "database": 736, "textmining": 123, "combined_score": 761 }, { "protein2": "8022.A0A060VNR1", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 825, "textmining": 186, "combined_score": 856 }, { "protein2": "8022.A0A060Y0E2", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060WKY9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 738, "database": 0, "textmining": 338, "combined_score": 819 }, { "protein2": "8022.A0A060Y572", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 137, "experimental": 0, "database": 816, "textmining": 379, "combined_score": 893 }, { "protein2": "8022.A0A060XQD6", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060Z8Y1", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 825, "textmining": 308, "combined_score": 926 }, { "protein2": "8022.A0A060Y5A1", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060XH89", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 715, "database": 0, "textmining": 326, "combined_score": 799 }, { "protein2": "8022.A0A060WBE2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 827, "textmining": 275, "combined_score": 879 }, { "protein2": "8022.A0A060VU68", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 352, "combined_score": 875 }, { "protein2": "8022.A0A060YAU7", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 137, "experimental": 0, "database": 816, "textmining": 379, "combined_score": 893 }, { "protein2": "8022.A0A060W078", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 738, "database": 0, "textmining": 338, "combined_score": 819 }, { "protein2": "8022.A0A060VXB7", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 825, "textmining": 186, "combined_score": 856 }, { "protein2": "8022.A0A060XXJ7", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 349, "combined_score": 751 }, { "protein2": "8022.A0A060VVS9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 783, "textmining": 199, "combined_score": 818 }, { "protein2": "8022.A0A060VTT5", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060VPT7", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 277, "database": 706, "textmining": 325, "combined_score": 861 }, { "protein2": "8022.A0A060XP04", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 760, "textmining": 186, "combined_score": 802 }, { "protein2": "8022.A0A060X0C8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 654, "textmining": 225, "combined_score": 746 }, { "protein2": "8022.A0A060VW41", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 75, "experimental": 0, "database": 670, "textmining": 378, "combined_score": 793 }, { "protein2": "8022.A0A060YIV6", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 261, "combined_score": 853 }, { "protein2": "8022.A0A060Z666", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 816, "textmining": 186, "combined_score": 848 }, { "protein2": "8022.A0A060W1Q7", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 261, "combined_score": 880 }, { "protein2": "8022.A0A060XV20", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 277, "database": 706, "textmining": 325, "combined_score": 861 }, { "protein2": "8022.A0A060YVM5", "neighborhood": 166, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 827, "textmining": 451, "combined_score": 922 }, { "protein2": "8022.A0A060WTE4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 220, "combined_score": 788 }, { "protein2": "8022.A0A060Y149", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 0, "database": 736, "textmining": 123, "combined_score": 768 }, { "protein2": "8022.A0A060XRV8", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 137, "experimental": 0, "database": 816, "textmining": 379, "combined_score": 893 }, { "protein2": "8022.A0A060Z9H8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060VNK8", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 261, "combined_score": 880 }, { "protein2": "8022.A0A060Z2V0", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 825, "textmining": 186, "combined_score": 856 }, { "protein2": "8022.A0A060XPQ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 715, "database": 0, "textmining": 326, "combined_score": 799 }, { "protein2": "8022.A0A060YHN8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 654, "textmining": 225, "combined_score": 746 }, { "protein2": "8022.A0A060VMK2", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 816, "textmining": 308, "combined_score": 923 }, { "protein2": "8022.A0A060WHT6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 80, "experimental": 0, "database": 670, "textmining": 309, "combined_score": 771 }, { "protein2": "8022.A0A060WEA8", "neighborhood": 51, "fusion": 0, "cooccurence": 0, "coexpression": 137, "experimental": 0, "database": 816, "textmining": 379, "combined_score": 893 }, { "protein2": "8022.A0A060Z5H7", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060VPR7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 220, "combined_score": 788 }, { "protein2": "8022.A0A060Z2Q3", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060X554", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 568, "textmining": 411, "combined_score": 738 }, { "protein2": "8022.A0A060WTT7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 785, "textmining": 0, "combined_score": 787 }, { "protein2": "8022.A0A060XDI7", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 825, "textmining": 186, "combined_score": 856 }, { "protein2": "8022.A0A060WUD2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 785, "textmining": 0, "combined_score": 787 }, { "protein2": "8022.A0A060WKL9", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060Z1V4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 783, "textmining": 199, "combined_score": 818 }, { "protein2": "8022.A0A060WN66", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 785, "textmining": 0, "combined_score": 787 }, { "protein2": "8022.A0A060YVQ1", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060X451", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 568, "textmining": 411, "combined_score": 738 }, { "protein2": "8022.A0A060Z1R4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 51, "experimental": 0, "database": 736, "textmining": 123, "combined_score": 761 }, { "protein2": "8022.A0A060WD05", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 827, "textmining": 275, "combined_score": 879 }, { "protein2": "8022.A0A060X3G2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 80, "experimental": 0, "database": 670, "textmining": 309, "combined_score": 771 }, { "protein2": "8022.A0A060YBF1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 51, "experimental": 0, "database": 736, "textmining": 123, "combined_score": 761 }, { "protein2": "8022.A0A060XQG3", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060YKF3", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 261, "combined_score": 853 }, { "protein2": "8022.A0A060ZEY9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 0, "database": 736, "textmining": 123, "combined_score": 768 }, { "protein2": "8022.A0A060XNA5", "neighborhood": 49, "fusion": 0, "cooccurence": 0, "coexpression": 866, "experimental": 0, "database": 0, "textmining": 519, "combined_score": 933 }, { "protein2": "8022.A0A060WZJ0", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 220, "combined_score": 852 }, { "protein2": "8022.A0A060VWF5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 75, "experimental": 0, "database": 670, "textmining": 378, "combined_score": 793 }, { "protein2": "8022.A0A060Y609", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 220, "combined_score": 852 }, { "protein2": "8022.A0A060WDJ5", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 261, "combined_score": 880 }, { "protein2": "8022.A0A060X713", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 816, "textmining": 220, "combined_score": 852 }, { "protein2": "8022.A0A060Y1A1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 746, "database": 0, "textmining": 309, "combined_score": 816 }, { "protein2": "8022.A0A060WI24", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 261, "combined_score": 880 }, { "protein2": "8022.A0A060W743", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 832, "textmining": 366, "combined_score": 888 }, { "protein2": "8022.A0A060Y3N4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060WV51", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 654, "textmining": 225, "combined_score": 746 }, { "protein2": "8022.A0A060WFB8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 832, "textmining": 225, "combined_score": 876 }, { "protein2": "8022.A0A060X7J3", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060Z2J6", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060X567", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 825, "textmining": 186, "combined_score": 856 }, { "protein2": "8022.A0A060XB28", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 660, "textmining": 276, "combined_score": 813 }, { "protein2": "8022.A0A060X323", "neighborhood": 151, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 277, "database": 706, "textmining": 325, "combined_score": 861 }, { "protein2": "8022.A0A060YEC4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 665, "database": 0, "textmining": 309, "combined_score": 758 }, { "protein2": "8022.A0A060VYV2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 665, "database": 0, "textmining": 309, "combined_score": 758 }, { "protein2": "8022.A0A060X0T4", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060VVE5", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 772, "textmining": 276, "combined_score": 874 }, { "protein2": "8022.A0A060Z6C0", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 261, "combined_score": 880 }, { "protein2": "8022.A0A060XEE3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 738, "database": 0, "textmining": 338, "combined_score": 819 }, { "protein2": "8022.A0A060X7Z0", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 261, "combined_score": 853 }, { "protein2": "8022.A0A060X7A0", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060YTU9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 831, "textmining": 0, "combined_score": 832 }, { "protein2": "8022.A0A060YSX6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 155, "database": 816, "textmining": 0, "combined_score": 837 }, { "protein2": "8022.A0A060W9M9", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 825, "textmining": 261, "combined_score": 880 }, { "protein2": "8022.A0A060YVM7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 220, "combined_score": 788 }, { "protein2": "8022.A0A060YZW8", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 76, "experimental": 0, "database": 652, "textmining": 277, "combined_score": 750 }, { "protein2": "8022.A0A060Z7Y7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 654, "textmining": 225, "combined_score": 746 }, { "protein2": "8022.A0A060YGA7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 785, "textmining": 0, "combined_score": 787 }, { "protein2": "8022.A0A060YK26", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060YKK6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 779, "textmining": 391, "combined_score": 861 }, { "protein2": "8022.A0A060XVB1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060YV08", "neighborhood": 166, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 827, "textmining": 451, "combined_score": 922 }, { "protein2": "8022.A0A060XEX5", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 772, "textmining": 276, "combined_score": 874 }, { "protein2": "8022.A0A060W0T4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060W458", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 256, "database": 556, "textmining": 279, "combined_score": 751 }, { "protein2": "8022.A0A060XBK0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060X2I1", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060Y7I6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060XY35", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 825, "textmining": 308, "combined_score": 926 }, { "protein2": "8022.A0A060VZK5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 783, "textmining": 199, "combined_score": 818 }, { "protein2": "8022.A0A060XTV2", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 256, "database": 556, "textmining": 279, "combined_score": 751 }, { "protein2": "8022.A0A060WV84", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 772, "textmining": 276, "combined_score": 874 }, { "protein2": "8022.A0A060W147", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060XZ30", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 785, "textmining": 261, "combined_score": 853 }, { "protein2": "8022.A0A060XFS1", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060ZB08", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 825, "textmining": 186, "combined_score": 856 }, { "protein2": "8022.A0A060ZAC2", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 816, "textmining": 308, "combined_score": 923 }, { "protein2": "8022.A0A060YFA3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 0, "database": 736, "textmining": 123, "combined_score": 768 }, { "protein2": "8022.A0A060Y3Q3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 665, "database": 0, "textmining": 309, "combined_score": 758 }, { "protein2": "8022.A0A060WUI1", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 772, "textmining": 276, "combined_score": 874 }, { "protein2": "8022.A0A060YLD3", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 827, "textmining": 276, "combined_score": 904 }, { "protein2": "8022.A0A060WBZ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 832, "textmining": 225, "combined_score": 876 }, { "protein2": "8022.A0A060X1D5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 654, "textmining": 225, "combined_score": 746 }, { "protein2": "8022.A0A060W2P0", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 827, "textmining": 186, "combined_score": 857 }, { "protein2": "8022.A0A060Z8F9", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 366, "experimental": 0, "database": 816, "textmining": 308, "combined_score": 923 }, { "protein2": "8022.A0A060XQL0", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 256, "database": 556, "textmining": 279, "combined_score": 751 }, { "protein2": "8022.A0A060Z973", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 0, "database": 785, "textmining": 0, "combined_score": 787 }, { "protein2": "8022.A0A060Y6U5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 830, "textmining": 0, "combined_score": 845 }, { "protein2": "8022.A0A060WAF6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 602, "textmining": 275, "combined_score": 722 }, { "protein2": "8022.A0A060YW82", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 90, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 720 }, { "protein2": "8022.A0A060YYC4", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 816, "textmining": 186, "combined_score": 848 }, { "protein2": "8022.A0A060WN41", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 654, "textmining": 225, "combined_score": 746 }, { "protein2": "8022.A0A060XHN5", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 772, "textmining": 276, "combined_score": 874 }, { "protein2": "8022.A0A060WBT3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 155, "database": 816, "textmining": 0, "combined_score": 837 }, { "protein2": "8022.A0A060WHB9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 654, "textmining": 225, "combined_score": 746 }, { "protein2": "8022.A0A060WVQ0", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 827, "textmining": 276, "combined_score": 904 }, { "protein2": "8022.A0A060VVL9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 783, "textmining": 199, "combined_score": 818 }, { "protein2": "8022.A0A060X8A4", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060WPX1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 665, "database": 0, "textmining": 309, "combined_score": 758 }, { "protein2": "8022.A0A060X816", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060ZPA8", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060X6V3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 0, "database": 654, "textmining": 225, "combined_score": 746 }, { "protein2": "8022.A0A060X1J6", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 0, "database": 625, "textmining": 243, "combined_score": 710 }, { "protein2": "8022.A0A060X807", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 746, "database": 0, "textmining": 309, "combined_score": 816 }, { "protein2": "8022.A0A060Y9T0", "neighborhood": 45, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 816, "textmining": 186, "combined_score": 848 }, { "protein2": "8022.A0A060VXR5", "neighborhood": 52, "fusion": 0, "cooccurence": 0, "coexpression": 138, "experimental": 0, "database": 652, "textmining": 185, "combined_score": 737 }, { "protein2": "8022.A0A060VVZ9", "neighborhood": 91, "fusion": 0, "cooccurence": 0, "coexpression": 161, "experimental": 158, "database": 772, "textmining": 276, "combined_score": 874 } ]
A0A060XFW6
Histidine kinase/HSP90-like ATPase domain-containing protein
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
773
null
MDTSAQSNTQEGIKISEIPFYFPASESRGDLRYWQHFIQEKSTEQIKMPEEMRQEEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPTKLDNGKELKIDVIPNVEERTLTLIDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAERVTVITKHNDDEQYIWESSAGGSFTVKVDTGEPMLRGTKVILHMKEDQTEYVEEKRVKEVVKKHSQFIGYPITLFVEKEREKEISDDEAEEEEKAEKEEKEEKEAEDKPKIEDVGSDDEEDSKDKDKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITMEEYGEFYKSLTNDWEEHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCEELIPEYLNFVRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCMELFGELAEDRENYNKFYDGFSKNLKLGIHEDSQNRKKLSELLRYHSSQSGDELTSLTEYLTRMKDNQKSIYYITGESKDQVANSAFVERVRKRGFEVLYMTEPIDEYCVQQLKEFDGKTLVSVTKEGLELPEDEEEKKKMDEDKTKFENLCKLMKEILDKKVEKVTVSNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKADLDKNDKAVKDLVILLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGIDDDEVIPEEPTSAPAPDEIPPLEGDDDASRMEEVD
[ "GO:0043627", "GO:0009719", "GO:0050896", "GO:0042221", "GO:0008150", "GO:0010033", "GO:0009725", "GO:0005622", "GO:0043229", "GO:0043226", "GO:0110165", "GO:0005737", "GO:0005575", "GO:0043227", "GO:0005634", "GO:0043231" ]
[ "GO:0008150", "GO:0050896", "GO:0009719", "GO:0042221", "GO:0010033", "GO:0009725", "GO:0043627" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0005737", "GO:0043229", "GO:0043227", "GO:0043231", "GO:0005634" ]
[ "IPR036890", "IPR003594", "IPR019805", "IPR037196", "IPR001404", "IPR020575", "IPR020568" ]
af_db/AF-A0A060XFW6-F1-model_v4.cif.gz
8022.A0A060XFW6
[ "8022.A0A060YVZ8", "8022.A0A060XPD1", "8022.A0A060YJ56", "8022.A0A060Y8C8", "8022.A0A060XDA6", "8022.A0A060WLY5", "8022.A0A060WDB5", "8022.A0A060W9K2", "8022.A0A060X045", "8022.A0A060WWJ0", "8022.A0A060XT88", "8022.A0A060YN29", "8022.A0A060YN11", "8022.A0A060W4Z4", "8022.A0A060VPQ2", "8022.A0A060X6P0", "8022.A0A060WIX5", "8022.A0A060WG53", "8022.A0A060XJ59", "8022.A0A060ZHH4", "8022.A0A060W9K4", "8022.A0A060WZS5", "8022.A0A060Y0C6", "8022.A0A060XKB8", "8022.A0A060W4C3", "8022.A0A060ZAW0", "8022.A0A060Y172", "8022.A0A060YK54", "8022.A0A060ZG95", "8022.A0A060YGW4", "8022.A0A060XKC3", "8022.A0A060VP33", "8022.A0A060X3Q0", "8022.A0A060Y737", "8022.A0A060YIV9", "8022.A0A060XER7", "8022.A0A060YT34", "8022.A0A060YFZ6", "8022.A0A060XQ11", "8022.A0A060WET1", "8022.A0A060XPT8", "8022.A0A060Y9R6", "8022.A0A060VW75", "8022.A0A060X924", "8022.A0A060W5A4", "8022.A0A060Y0Y6", "8022.A0A060YAW5", "8022.A0A060Z9W8", "8022.A0A060X7C9", "8022.A0A060Z2T4", "8022.A0A060WIQ5", "8022.A0A060W8B2", "8022.A0A060YBV5", "8022.A0A060X3H7", "8022.A0A060WFG1", "8022.A0A060YT33", "8022.A0A060WKX6", "8022.A0A060WIX3", "8022.A0A060YJZ7", "8022.A0A060XXY2", "8022.A0A060Y7Y9", "8022.A0A060XIQ6", "8022.A0A060XRA2", "8022.A0A060WHU5", "8022.A0A060VXN4", "8022.A0A060XAR9", "8022.A0A060XVH3", "8022.A0A060Y0G1", "8022.A0A060W0X7", "8022.A0A060WQT0", "8022.A0A060X2J6", "8022.A0A060XIH3", "8022.A0A060WMD2", "8022.A0A060X483", "8022.A0A060WZ00", "8022.A0A060YN57", "8022.A0A060X9Q4", "8022.A0A060XID6", "8022.A0A060Y1G5", "8022.A0A060XWL9", "8022.A0A060XKH1", "8022.A0A060W1A6", "8022.C1BFD3", "8022.A0A060WGH6", "8022.A0A060WIM8", "8022.A0A060W5H0", "8022.A0A060VTU3", "8022.A0A060XT73", "8022.A0A060YNP1", "8022.A0A060WR23", "8022.A0A060YRY2", "8022.A0A060Y265", "8022.A0A060YDR5", "8022.A0A060YHQ7", "8022.A0A060W3L2", "8022.A0A060XI54", "8022.A0A060WW29", "8022.A0A060X881", "8022.A0A060WPZ6", "8022.A0A060Y842", "8022.A0A060Z4C3", "8022.A0A060WLD4", "8022.A0A060Z4M3", "8022.A0A060YBU0", "8022.A0A060YMV4", "8022.A0A060W6U8", "8022.A0A060VUX6", "8022.A0A060WT07", "8022.A0A060XAW7", "8022.A0A060WWH4", "8022.A0A060WNH4", "8022.A0A060WNW6", "8022.A0A060WIM0", "8022.A0A060WRM4", "8022.A0A060YNK9", "8022.A0A060XBL7", "8022.A0A060XSH9", "8022.A0A060XPN2", "8022.A0A060WKN9", "8022.A0A060X1N4", "8022.C1BG62", "8022.A0A060X8B1", "8022.A0A060YP71", "8022.A0A060XBJ4", "8022.A0A060Z7B1", "8022.A0A060VSJ9", "8022.A0A060WFI2", "8022.A0A060XR67", "8022.A0A060W1U9", "8022.A0A060XBN4", "8022.A0A060YSJ4", "8022.A0A060YZ22", "8022.A0A060VYB4", "8022.A0A060WN02", "8022.A0A060X1R9", "8022.A0A060XG31", "8022.A0A060Y8T5", "8022.A0A060YPV1", "8022.A0A060WET2", "8022.A0A060X011", "8022.A0A060W9A6", "8022.A0A060ZU15", "8022.A0A060WSW3", "8022.A0A060X5C5", "8022.A0A060WIJ5", "8022.A0A060Y1M3", "8022.A0A060Y1T3", "8022.A0A060VTD2", "8022.A0A060YVG1", "8022.A0A060X996", "8022.A0A060Y0S7", "8022.A0A060WT46", "8022.A0A060VVY9", "8022.A0A060WTE7", "8022.A0A060WZ23", "8022.A0A060Y2D4", "8022.A0A060WME3", "8022.A0A060YQ33", "8022.A0A060Z0S6", "8022.A0A060YLY2", "8022.A0A060X1K0", "8022.A0A060VTJ4", "8022.A0A060YT46", "8022.A0A060XRY9", "8022.A0A060WXS1", "8022.A0A060X0G4", "8022.A0A060WS71", "8022.A0A060YVB4", "8022.A0A060WZ37", "8022.A0A060Y6Y0", "8022.A0A060YEB2", "8022.A0A060WU94", "8022.A0A060WTK7", "8022.A0A060WES3", "8022.A0A060YGJ9", "8022.A0A060VP96", "8022.A0A060WKD4", "8022.A0A060W5D0", "8022.A0A060Z3A5", "8022.A0A060W9Q2", "8022.A0A060YBC7", "8022.A0A060X8W2", "8022.A0A060YDZ8", "8022.A0A060ZJV2", "8022.A0A061A6Z5", "8022.A0A060XVG3", "8022.A0A060XVX5", "8022.A0A060XVV6", "8022.A0A060XNA7", "8022.C1BG90", "8022.A0A060XFQ8", "8022.A0A060X6R7", "8022.A0A060X5Q3", "8022.A0A060WUJ2", "8022.A0A060XRF4", "8022.A0A060XV15", "8022.A0A060WHY1", "8022.A0A060Y668", "8022.A0A060WDE0", "8022.A0A060X0K1", "8022.A0A060VMS2", "8022.A0A060YP00", "8022.A0A060X7R3", "8022.A0A060WSJ3", "8022.A0A060XRB2", "8022.A0A060Y2M8", "8022.A0A060XIH9", "8022.A0A060Z3P3", "8022.A0A060YC16", "8022.A0A060XRN9", "8022.A0A060WJV4", "8022.A0A060VXZ3", "8022.A0A060XLB8", "8022.A0A060XKL0", "8022.A0A060VSV9", "8022.A0A060WIW0", "8022.A0A060X8I2", "8022.A0A060WX48", "8022.A0A060XM16", "8022.A0A060X0B9", "8022.A0A060XFQ3", "8022.A0A060XWV3", "8022.A0A060X2Y0", "8022.A0A060WZJ2", "8022.A0A060WXM8", "8022.A0A060WKE4", "8022.A0A060ZIZ8", "8022.A0A060XG86", "8022.A0A061ADP7", "8022.A0A060WQ48", "8022.A0A060XSP1", "8022.A0A060W1W2", "8022.A0A060XX32", "8022.A0A060Y8X7", "8022.A0A060ZEP6", "8022.A0A060Y0I2", "8022.A0A060YP66", "8022.A0A060XQN1", "8022.A0A060XYC7", "8022.A0A060XS96", "8022.A0A060W5B2", "8022.A0A060X173", "8022.A0A060YBS9", "8022.A0A060XI31", "8022.A0A060XPW0", "8022.A0A060YHY9", "8022.A0A060X7A6", "8022.A0A060X795", "8022.A0A060YYJ1", "8022.A0A060YN23", "8022.A0A060XXH3", "8022.A0A060WP57", "8022.A0A060XQG8", "8022.A0A060VYX8", "8022.A0A060WBD3", "8022.A0A060WWC7", "8022.A0A060YX95", "8022.A0A060Y956", "8022.A0A060VU47", "8022.A0A060W321", "8022.A0A060Y4J9", "8022.A0A060WZL8", "8022.A0A060WCV3", "8022.Q9PT09", "8022.A0A060YAV2", "8022.A0A060YSP2", "8022.A0A060VWL5", "8022.A0A060VTB1", "8022.A0A060Z671", "8022.A0A060X9N1", "8022.A0A060XLH8", "8022.A0A060XTM1", "8022.A0A060WS21", "8022.A0A060X6P4", "8022.A0A060WGQ7", "8022.A0A060XKZ0", "8022.A0A060X747", "8022.A0A060VZB1", "8022.A0A060WF01", "8022.A0A060Z3H2", "8022.A0A060WC37", "8022.A0A060Z2Q6", "8022.A0A060WGA5", "8022.A0A060Y0Z6", "8022.A0A060XU63", "8022.A0A060YC57", "8022.A0A060WW88", "8022.A0A060X0I3", "8022.A0A060VTX5", "8022.A0A060ZHR8", "8022.A0A060YNU6", "8022.A0A060WZL3", "8022.A0A060X925", "8022.A0A060X100", "8022.A0A060X3D1", "8022.A0A060Z5F3", "8022.A0A060WM62", "8022.A0A060YC34", "8022.A0A060XMU7", "8022.A0A060VZD9", "8022.A0A060XUR0", "8022.A0A060VUJ1", "8022.A0A060VN15", "8022.A0A060VNA2", "8022.A0A060YTQ4", "8022.A0A060YCE9", "8022.A0A060WLB7", "8022.A0A060WS33", "8022.A0A060YL26", "8022.A0A060Z011", "8022.A0A060XVP2", "8022.A0A060YZM3", "8022.A0A060Z608", "8022.A0A060X833", "8022.A0A060W2P2", "8022.A0A060XS93", "8022.A0A060XU96", "8022.A0A060Z5T3", "8022.A0A060YKD2", "8022.A0A060W590", "8022.A0A060XLI5", "8022.A0A060XFZ8", "8022.A0A060W9R5", "8022.A0A060Z753", "8022.A0A060WWK9", "8022.A0A060WVU0", "8022.A0A060VTX8", "8022.A0A060YIJ4", "8022.A0A060YS73", "8022.A0A060XT19", "8022.A0A060WQJ1", "8022.A0A060XUV0", "8022.A0A060YJ53", "8022.A0A060X1H7", "8022.A0A060Z1D6", "8022.A0A060WTV3", "8022.A0A061A939", "8022.A0A060W511", "8022.A0A060XMQ8", "8022.A0A060X313", "8022.A0A060XZQ6", "8022.A0A060X5S5", "8022.A0A060YDB5", "8022.A0A060XV60", "8022.A0A060Y5M1", "8022.A0A060XF94", "8022.A0A060WTC8", "8022.A0A060X621", "8022.A0A060WE23", "8022.A0A060Y0A6", "8022.A0A060X0Z3", "8022.A0A060XLX9", "8022.A0A060VUI9", "8022.A0A060Z698", "8022.A0A060XH83", "8022.A0A060WPC3", "8022.A0A060WDF7", "8022.A0A060XFF6", "8022.A0A060WMF6", "8022.A0A060WT77", "8022.A0A060XH19", "8022.A0A060YGX2", "8022.A0A060YJ10", "8022.A0A060YPZ8", "8022.A0A060YQ01", "8022.A0A060XKP9", "8022.A0A060WJQ6", "8022.A0A060W549", "8022.A0A060XMD3", "8022.A0A060XQK3", "8022.A0A060YIG6", "8022.A0A060X8Y7", "8022.A0A060YQ36", "8022.A0A060X0Y4", "8022.A0A060XKV5", "8022.A0A060ZGX8", "8022.A0A060VRH7", "8022.A0A060XTG2", "8022.A0A060WQ49", "8022.A0A060YDJ4", "8022.A0A060Z3C0", "8022.A0A060YPE8", "8022.A0A060WU49", "8022.A0A060YTB0", "8022.A0A060Y7X2", "8022.A0A060X189", "8022.A0A060VZ05", "8022.A0A060YG86", "8022.A0A060XFD4", "8022.A0A060WTN3", "8022.O93245", "8022.A0A060VPK1", "8022.A0A060Z6H0", "8022.A0A060XMQ9", "8022.A0A060XN97", "8022.A0A060XAD4", "8022.A0A060Z048", "8022.A0A060YXQ1", "8022.A0A060WE12", "8022.A0A060X0B5", "8022.A0A060W593", "8022.A0A060XL01", "8022.A0A060VNI0", "8022.A0A060YMA6", "8022.A0A060ZAX5", "8022.A0A060VM58", "8022.A0A060WTG9", "8022.A0A060Z269", "8022.A0A060XH10", "8022.A0A060W0Z6", "8022.A0A060XU67", "8022.A0A060YFC5", "8022.A0A060XC97", "8022.A0A060WFL5", "8022.A0A060YDC6", "8022.A0A060W3W8", "8022.A0A060Y9Q0", "8022.A0A061AD99", "8022.A0A060Y028", "8022.A0A060X8R3", "8022.A0A060W2L4", "8022.A0A060Y887", "8022.A0A060X2T0", "8022.A0A060YYY0", "8022.A0A060YXU2", "8022.A0A060XYX3", "8022.A0A060YL36", "8022.A0A060XXQ2", "8022.A0A060YTF9", "8022.A0A060YB73", "8022.A0A060Y544", "8022.A0A060YGK7", "8022.A0A060Z192", "8022.A0A060VNG5", "8022.A0A060YDW3", "8022.A0A060YDC0", "8022.A0A060W6N9", "8022.A0A060Z3A1", "8022.A0A060VR91", "8022.A0A060WRN7", "8022.A0A060XY82", "8022.A0A060Y386", "8022.A0A060XUE1", "8022.A0A060VVC5", "8022.A0A060WKB0", "8022.A0A060W7T8", "8022.A0A060ZDS2", "8022.A0A061AF65", "8022.A0A060XS17", "8022.A0A060ZHH3", "8022.A0A060ZGE1", "8022.A0A060Y3A3", "8022.A0A060X691", "8022.A0A060W5Y1", "8022.A0A060XPD8", "8022.A0A060W7A6", "8022.A0A060XUA5", "8022.A0A060XI97", "8022.A0A060VMW3", "8022.A0A060XL60", "8022.A0A060WI07", "8022.A0A061AFA1", "8022.A0A060Z858", "8022.A0A060XJK9", "8022.A0A060WZC6", "8022.A0A061A773", "8022.A0A060YQQ2", "8022.A0A060VSN0", "8022.A0A060Y7A8", "8022.A0A060WD16", "8022.A0A060XQ05", "8022.A0A060ZCJ0", "8022.A0A060YUG1", "8022.A0A060Z5L0", "8022.A0A060WZP5", "8022.A0A060W187", "8022.A0A060ZC75", "8022.A0A060XJW3", "8022.A0A060Z216", "8022.A0A060WN55", "8022.A0A060XH67", "8022.A0A060VQQ6", "8022.A0A060XYL7", "8022.A0A060Y4G5", "8022.A0A060YV64", "8022.A0A060XHR4", "8022.A0A060XHX0", "8022.A0A060X2P2", "8022.A0A060YDW9", "8022.A0A060XTQ9", "8022.A0A060X382", "8022.A0A060W9T8", "8022.A0A060WI90", "8022.A0A060X462", "8022.A0A060Z793", "8022.A0A060YFT4" ]
[ { "protein2": "8022.A0A060YVZ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 863, "database": 736, "textmining": 345, "combined_score": 974 }, { "protein2": "8022.A0A060XPD1", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 239, "database": 560, "textmining": 196, "combined_score": 709 }, { "protein2": "8022.A0A060YJ56", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 422, "textmining": 184, "combined_score": 773 }, { "protein2": "8022.A0A060Y8C8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 749, "database": 431, "textmining": 228, "combined_score": 883 }, { "protein2": "8022.A0A060XDA6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 573, "textmining": 85, "combined_score": 724 }, { "protein2": "8022.A0A060WLY5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 551, "textmining": 110, "combined_score": 860 }, { "protein2": "8022.A0A060WDB5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060W9K2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 501, "experimental": 672, "database": 594, "textmining": 312, "combined_score": 949 }, { "protein2": "8022.A0A060X045", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 203, "experimental": 704, "database": 569, "textmining": 231, "combined_score": 911 }, { "protein2": "8022.A0A060WWJ0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 414, "database": 566, "textmining": 86, "combined_score": 747 }, { "protein2": "8022.A0A060XT88", "neighborhood": 48, "fusion": 0, "cooccurence": 0, "coexpression": 192, "experimental": 311, "database": 430, "textmining": 182, "combined_score": 707 }, { "protein2": "8022.A0A060YN29", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 551, "textmining": 110, "combined_score": 860 }, { "protein2": "8022.A0A060YN11", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 551, "textmining": 110, "combined_score": 860 }, { "protein2": "8022.A0A060W4Z4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060VPQ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060X6P0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 673, "database": 0, "textmining": 350, "combined_score": 778 }, { "protein2": "8022.A0A060WIX5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 494, "textmining": 151, "combined_score": 821 }, { "protein2": "8022.A0A060WG53", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 121, "combined_score": 836 }, { "protein2": "8022.A0A060XJ59", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060ZHH4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 749, "database": 431, "textmining": 228, "combined_score": 883 }, { "protein2": "8022.A0A060W9K4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 573, "textmining": 85, "combined_score": 724 }, { "protein2": "8022.A0A060WZS5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 839, "textmining": 75, "combined_score": 895 }, { "protein2": "8022.A0A060Y0C6", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 751, "database": 333, "textmining": 309, "combined_score": 880 }, { "protein2": "8022.A0A060XKB8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 414, "database": 566, "textmining": 86, "combined_score": 747 }, { "protein2": "8022.A0A060W4C3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 662, "database": 736, "textmining": 237, "combined_score": 925 }, { "protein2": "8022.A0A060ZAW0", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060Y172", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 752, "experimental": 892, "database": 639, "textmining": 406, "combined_score": 993 }, { "protein2": "8022.A0A060YK54", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 863, "database": 736, "textmining": 345, "combined_score": 974 }, { "protein2": "8022.A0A060ZG95", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 571, "textmining": 263, "combined_score": 793 }, { "protein2": "8022.A0A060YGW4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 291, "experimental": 366, "database": 335, "textmining": 230, "combined_score": 739 }, { "protein2": "8022.A0A060XKC3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 824, "textmining": 44, "combined_score": 881 }, { "protein2": "8022.A0A060VP33", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 112, "combined_score": 728 }, { "protein2": "8022.A0A060X3Q0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 745, "database": 599, "textmining": 206, "combined_score": 911 }, { "protein2": "8022.A0A060Y737", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 121, "combined_score": 836 }, { "protein2": "8022.A0A060YIV9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 662, "database": 736, "textmining": 237, "combined_score": 925 }, { "protein2": "8022.A0A060XER7", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 745, "database": 333, "textmining": 191, "combined_score": 866 }, { "protein2": "8022.A0A060YT34", "neighborhood": 53, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 694, "database": 81, "textmining": 219, "combined_score": 764 }, { "protein2": "8022.A0A060YFZ6", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 216, "combined_score": 751 }, { "protein2": "8022.A0A060XQ11", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 464, "experimental": 528, "database": 0, "textmining": 390, "combined_score": 834 }, { "protein2": "8022.A0A060WET1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 291, "experimental": 366, "database": 335, "textmining": 230, "combined_score": 739 }, { "protein2": "8022.A0A060XPT8", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 126, "combined_score": 723 }, { "protein2": "8022.A0A060Y9R6", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 77, "experimental": 472, "database": 333, "textmining": 211, "combined_score": 713 }, { "protein2": "8022.A0A060VW75", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 910, "textmining": 44, "combined_score": 939 }, { "protein2": "8022.A0A060X924", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 398, "textmining": 164, "combined_score": 757 }, { "protein2": "8022.A0A060W5A4", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 108, "combined_score": 717 }, { "protein2": "8022.A0A060Y0Y6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 662, "database": 736, "textmining": 237, "combined_score": 925 }, { "protein2": "8022.A0A060YAW5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 668, "database": 537, "textmining": 110, "combined_score": 851 }, { "protein2": "8022.A0A060Z9W8", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 121, "combined_score": 836 }, { "protein2": "8022.A0A060X7C9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 188, "database": 598, "textmining": 261, "combined_score": 742 }, { "protein2": "8022.A0A060Z2T4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 760, "database": 602, "textmining": 276, "combined_score": 924 }, { "protein2": "8022.A0A060WIQ5", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 317, "experimental": 716, "database": 481, "textmining": 233, "combined_score": 913 }, { "protein2": "8022.A0A060W8B2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 885, "database": 816, "textmining": 375, "combined_score": 985 }, { "protein2": "8022.A0A060YBV5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 494, "textmining": 151, "combined_score": 821 }, { "protein2": "8022.A0A060X3H7", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060WFG1", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 494, "textmining": 151, "combined_score": 821 }, { "protein2": "8022.A0A060YT33", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 155, "database": 736, "textmining": 119, "combined_score": 786 }, { "protein2": "8022.A0A060WKX6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 910, "textmining": 213, "combined_score": 950 }, { "protein2": "8022.A0A060WIX3", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 239, "database": 560, "textmining": 196, "combined_score": 709 }, { "protein2": "8022.A0A060YJZ7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 300, "database": 590, "textmining": 136, "combined_score": 735 }, { "protein2": "8022.A0A060XXY2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 537, "textmining": 158, "combined_score": 725 }, { "protein2": "8022.A0A060Y7Y9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 910, "textmining": 151, "combined_score": 946 }, { "protein2": "8022.A0A060XIQ6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 537, "textmining": 158, "combined_score": 725 }, { "protein2": "8022.A0A060XRA2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060WHU5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 756, "database": 431, "textmining": 227, "combined_score": 883 }, { "protein2": "8022.A0A060VXN4", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 136, "combined_score": 726 }, { "protein2": "8022.A0A060XAR9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 745, "database": 599, "textmining": 206, "combined_score": 911 }, { "protein2": "8022.A0A060XVH3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 628, "database": 418, "textmining": 151, "combined_score": 871 }, { "protein2": "8022.A0A060Y0G1", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 239, "database": 560, "textmining": 196, "combined_score": 709 }, { "protein2": "8022.A0A060W0X7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 365, "database": 499, "textmining": 152, "combined_score": 706 }, { "protein2": "8022.A0A060WQT0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 576, "textmining": 75, "combined_score": 723 }, { "protein2": "8022.A0A060X2J6", "neighborhood": 113, "fusion": 0, "cooccurence": 0, "coexpression": 376, "experimental": 676, "database": 428, "textmining": 262, "combined_score": 910 }, { "protein2": "8022.A0A060XIH3", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 255, "experimental": 468, "database": 385, "textmining": 308, "combined_score": 811 }, { "protein2": "8022.A0A060WMD2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 745, "database": 599, "textmining": 206, "combined_score": 911 }, { "protein2": "8022.A0A060X483", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 108, "combined_score": 717 }, { "protein2": "8022.A0A060WZ00", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 487, "database": 352, "textmining": 231, "combined_score": 801 }, { "protein2": "8022.A0A060YN57", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 650, "database": 0, "textmining": 222, "combined_score": 716 }, { "protein2": "8022.A0A060X9Q4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 749, "database": 431, "textmining": 228, "combined_score": 883 }, { "protein2": "8022.A0A060XID6", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 398, "textmining": 131, "combined_score": 748 }, { "protein2": "8022.A0A060Y1G5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 317, "experimental": 768, "database": 609, "textmining": 308, "combined_score": 951 }, { "protein2": "8022.A0A060XWL9", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 745, "database": 333, "textmining": 191, "combined_score": 866 }, { "protein2": "8022.A0A060XKH1", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 398, "textmining": 184, "combined_score": 763 }, { "protein2": "8022.A0A060W1A6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 54, "experimental": 410, "database": 568, "textmining": 216, "combined_score": 785 }, { "protein2": "8022.C1BFD3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 602, "textmining": 269, "combined_score": 701 }, { "protein2": "8022.A0A060WGH6", "neighborhood": 48, "fusion": 0, "cooccurence": 0, "coexpression": 192, "experimental": 311, "database": 430, "textmining": 182, "combined_score": 707 }, { "protein2": "8022.A0A060WIM8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 537, "textmining": 158, "combined_score": 725 }, { "protein2": "8022.A0A060W5H0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 176, "database": 608, "textmining": 152, "combined_score": 702 }, { "protein2": "8022.A0A060VTU3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 475, "database": 372, "textmining": 356, "combined_score": 851 }, { "protein2": "8022.A0A060XT73", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 269, "database": 823, "textmining": 0, "combined_score": 865 }, { "protein2": "8022.A0A060YNP1", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060WR23", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 594, "experimental": 362, "database": 0, "textmining": 140, "combined_score": 761 }, { "protein2": "8022.A0A060YRY2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 744, "database": 572, "textmining": 219, "combined_score": 916 }, { "protein2": "8022.A0A060Y265", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 628, "database": 418, "textmining": 151, "combined_score": 871 }, { "protein2": "8022.A0A060YDR5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 155, "database": 816, "textmining": 86, "combined_score": 845 }, { "protein2": "8022.A0A060YHQ7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 161, "database": 698, "textmining": 159, "combined_score": 768 }, { "protein2": "8022.A0A060W3L2", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 317, "experimental": 716, "database": 481, "textmining": 233, "combined_score": 913 }, { "protein2": "8022.A0A060XI54", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060WW29", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 494, "textmining": 151, "combined_score": 821 }, { "protein2": "8022.A0A060X881", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 573, "textmining": 85, "combined_score": 724 }, { "protein2": "8022.A0A060WPZ6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 538, "database": 434, "textmining": 186, "combined_score": 768 }, { "protein2": "8022.A0A060Y842", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060Z4C3", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060WLD4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 578, "database": 305, "textmining": 88, "combined_score": 709 }, { "protein2": "8022.A0A060Z4M3", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 113, "combined_score": 719 }, { "protein2": "8022.A0A060YBU0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 288, "database": 607, "textmining": 97, "combined_score": 725 }, { "protein2": "8022.A0A060YMV4", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 745, "database": 333, "textmining": 191, "combined_score": 866 }, { "protein2": "8022.A0A060W6U8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 714, "database": 0, "textmining": 308, "combined_score": 811 }, { "protein2": "8022.A0A060VUX6", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 121, "combined_score": 836 }, { "protein2": "8022.A0A060WT07", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 681, "database": 425, "textmining": 213, "combined_score": 898 }, { "protein2": "8022.A0A060XAW7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 659, "database": 525, "textmining": 108, "combined_score": 842 }, { "protein2": "8022.A0A060WWH4", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060WNH4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060WNW6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 537, "textmining": 158, "combined_score": 725 }, { "protein2": "8022.A0A060WIM0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 538, "database": 434, "textmining": 186, "combined_score": 768 }, { "protein2": "8022.A0A060WRM4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 546, "database": 467, "textmining": 86, "combined_score": 759 }, { "protein2": "8022.A0A060YNK9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 414, "database": 566, "textmining": 86, "combined_score": 747 }, { "protein2": "8022.A0A060XBL7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 659, "database": 525, "textmining": 108, "combined_score": 842 }, { "protein2": "8022.A0A060XSH9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 816, "textmining": 134, "combined_score": 838 }, { "protein2": "8022.A0A060XPN2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 140, "combined_score": 727 }, { "protein2": "8022.A0A060WKN9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 551, "textmining": 110, "combined_score": 860 }, { "protein2": "8022.A0A060X1N4", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 206, "database": 827, "textmining": 399, "combined_score": 910 }, { "protein2": "8022.C1BG62", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 107, "experimental": 276, "database": 610, "textmining": 82, "combined_score": 737 }, { "protein2": "8022.A0A060X8B1", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 594, "experimental": 362, "database": 0, "textmining": 140, "combined_score": 761 }, { "protein2": "8022.A0A060YP71", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 744, "database": 572, "textmining": 219, "combined_score": 916 }, { "protein2": "8022.A0A060XBJ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 155, "database": 816, "textmining": 119, "combined_score": 851 }, { "protein2": "8022.A0A060Z7B1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060VSJ9", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 501, "experimental": 672, "database": 510, "textmining": 225, "combined_score": 930 }, { "protein2": "8022.A0A060WFI2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 745, "database": 599, "textmining": 206, "combined_score": 911 }, { "protein2": "8022.A0A060XR67", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 184, "experimental": 231, "database": 824, "textmining": 66, "combined_score": 883 }, { "protein2": "8022.A0A060W1U9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 155, "database": 736, "textmining": 119, "combined_score": 786 }, { "protein2": "8022.A0A060XBN4", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 494, "textmining": 151, "combined_score": 821 }, { "protein2": "8022.A0A060YSJ4", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 239, "database": 560, "textmining": 196, "combined_score": 709 }, { "protein2": "8022.A0A060YZ22", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 466, "database": 566, "textmining": 223, "combined_score": 860 }, { "protein2": "8022.A0A060VYB4", "neighborhood": 53, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 335, "database": 739, "textmining": 64, "combined_score": 825 }, { "protein2": "8022.A0A060WN02", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060X1R9", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060XG31", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 650, "database": 0, "textmining": 222, "combined_score": 716 }, { "protein2": "8022.A0A060Y8T5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 422, "textmining": 184, "combined_score": 773 }, { "protein2": "8022.A0A060YPV1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 387, "database": 568, "textmining": 177, "combined_score": 765 }, { "protein2": "8022.A0A060WET2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 112, "combined_score": 728 }, { "protein2": "8022.A0A060X011", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 160, "experimental": 390, "database": 385, "textmining": 232, "combined_score": 730 }, { "protein2": "8022.A0A060W9A6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 203, "experimental": 704, "database": 569, "textmining": 231, "combined_score": 911 }, { "protein2": "8022.A0A060ZU15", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 203, "experimental": 704, "database": 569, "textmining": 231, "combined_score": 911 }, { "protein2": "8022.A0A060WSW3", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 466, "database": 514, "textmining": 223, "combined_score": 843 }, { "protein2": "8022.A0A060X5C5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 413, "experimental": 804, "database": 0, "textmining": 389, "combined_score": 923 }, { "protein2": "8022.A0A060WIJ5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 466, "database": 566, "textmining": 223, "combined_score": 860 }, { "protein2": "8022.A0A060Y1M3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 681, "database": 425, "textmining": 213, "combined_score": 898 }, { "protein2": "8022.A0A060Y1T3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 743, "database": 333, "textmining": 268, "combined_score": 869 }, { "protein2": "8022.A0A060VTD2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 112, "combined_score": 728 }, { "protein2": "8022.A0A060YVG1", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060X996", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 414, "database": 566, "textmining": 86, "combined_score": 747 }, { "protein2": "8022.A0A060Y0S7", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 221, "experimental": 390, "database": 385, "textmining": 198, "combined_score": 738 }, { "protein2": "8022.A0A060WT46", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060VVY9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 576, "textmining": 75, "combined_score": 723 }, { "protein2": "8022.A0A060WTE7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 121, "combined_score": 836 }, { "protein2": "8022.A0A060WZ23", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 137, "experimental": 338, "database": 608, "textmining": 160, "combined_score": 786 }, { "protein2": "8022.A0A060Y2D4", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 206, "database": 827, "textmining": 88, "combined_score": 864 }, { "protein2": "8022.A0A060WME3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060YQ33", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 136, "experimental": 744, "database": 572, "textmining": 219, "combined_score": 916 }, { "protein2": "8022.A0A060Z0S6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 578, "database": 305, "textmining": 88, "combined_score": 709 }, { "protein2": "8022.A0A060YLY2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 501, "experimental": 672, "database": 510, "textmining": 225, "combined_score": 930 }, { "protein2": "8022.A0A060X1K0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 654, "textmining": 153, "combined_score": 819 }, { "protein2": "8022.A0A060VTJ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 827, "textmining": 44, "combined_score": 883 }, { "protein2": "8022.A0A060YT46", "neighborhood": 48, "fusion": 0, "cooccurence": 0, "coexpression": 734, "experimental": 288, "database": 0, "textmining": 308, "combined_score": 858 }, { "protein2": "8022.A0A060XRY9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 576, "textmining": 75, "combined_score": 723 }, { "protein2": "8022.A0A060WXS1", "neighborhood": 53, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 483, "database": 521, "textmining": 86, "combined_score": 756 }, { "protein2": "8022.A0A060X0G4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 681, "database": 425, "textmining": 422, "combined_score": 925 }, { "protein2": "8022.A0A060WS71", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 398, "textmining": 131, "combined_score": 748 }, { "protein2": "8022.A0A060YVB4", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 216, "combined_score": 751 }, { "protein2": "8022.A0A060WZ37", "neighborhood": 53, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 483, "database": 777, "textmining": 86, "combined_score": 886 }, { "protein2": "8022.A0A060Y6Y0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 622, "database": 573, "textmining": 233, "combined_score": 865 }, { "protein2": "8022.A0A060YEB2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 221, "experimental": 390, "database": 385, "textmining": 198, "combined_score": 738 }, { "protein2": "8022.A0A060WU94", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 291, "experimental": 366, "database": 335, "textmining": 230, "combined_score": 739 }, { "protein2": "8022.A0A060WTK7", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 151, "combined_score": 731 }, { "protein2": "8022.A0A060WES3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 394, "experimental": 475, "database": 372, "textmining": 400, "combined_score": 866 }, { "protein2": "8022.A0A060YGJ9", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060VP96", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 300, "database": 604, "textmining": 136, "combined_score": 744 }, { "protein2": "8022.A0A060WKD4", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 136, "combined_score": 726 }, { "protein2": "8022.A0A060W5D0", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 501, "experimental": 672, "database": 594, "textmining": 312, "combined_score": 949 }, { "protein2": "8022.A0A060Z3A5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060W9Q2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 216, "combined_score": 751 }, { "protein2": "8022.A0A060YBC7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 130, "combined_score": 838 }, { "protein2": "8022.A0A060X8W2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060YDZ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 203, "experimental": 704, "database": 569, "textmining": 231, "combined_score": 911 }, { "protein2": "8022.A0A060ZJV2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 216, "combined_score": 751 }, { "protein2": "8022.A0A061A6Z5", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 121, "combined_score": 836 }, { "protein2": "8022.A0A060XVG3", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 745, "database": 333, "textmining": 191, "combined_score": 866 }, { "protein2": "8022.A0A060XVX5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 551, "textmining": 110, "combined_score": 860 }, { "protein2": "8022.A0A060XVV6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 760, "database": 602, "textmining": 276, "combined_score": 924 }, { "protein2": "8022.A0A060XNA7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 414, "database": 566, "textmining": 86, "combined_score": 747 }, { "protein2": "8022.C1BG90", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 602, "textmining": 269, "combined_score": 701 }, { "protein2": "8022.A0A060XFQ8", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 398, "textmining": 184, "combined_score": 763 }, { "protein2": "8022.A0A060X6R7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 749, "database": 305, "textmining": 136, "combined_score": 836 }, { "protein2": "8022.A0A060X5Q3", "neighborhood": 46, "fusion": 0, "cooccurence": 0, "coexpression": 43, "experimental": 244, "database": 826, "textmining": 42, "combined_score": 863 }, { "protein2": "8022.A0A060WUJ2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 745, "database": 333, "textmining": 191, "combined_score": 866 }, { "protein2": "8022.A0A060XRF4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060XV15", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 578, "database": 305, "textmining": 88, "combined_score": 709 }, { "protein2": "8022.A0A060WHY1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 317, "experimental": 768, "database": 609, "textmining": 308, "combined_score": 951 }, { "protein2": "8022.A0A060Y668", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 188, "database": 770, "textmining": 262, "combined_score": 852 }, { "protein2": "8022.A0A060WDE0", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 494, "textmining": 151, "combined_score": 821 }, { "protein2": "8022.A0A060X0K1", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060VMS2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 538, "database": 434, "textmining": 186, "combined_score": 768 }, { "protein2": "8022.A0A060YP00", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 422, "textmining": 184, "combined_score": 773 }, { "protein2": "8022.A0A060X7R3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 551, "textmining": 110, "combined_score": 860 }, { "protein2": "8022.A0A060WSJ3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 551, "textmining": 110, "combined_score": 860 }, { "protein2": "8022.A0A060XRB2", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 388, "experimental": 577, "database": 372, "textmining": 229, "combined_score": 860 }, { "protein2": "8022.A0A060Y2M8", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 745, "database": 333, "textmining": 191, "combined_score": 866 }, { "protein2": "8022.A0A060XIH9", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 394, "experimental": 475, "database": 372, "textmining": 400, "combined_score": 866 }, { "protein2": "8022.A0A060Z3P3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 551, "textmining": 110, "combined_score": 860 }, { "protein2": "8022.A0A060YC16", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 596, "experimental": 158, "database": 0, "textmining": 234, "combined_score": 721 }, { "protein2": "8022.A0A060XRN9", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 108, "combined_score": 717 }, { "protein2": "8022.A0A060WJV4", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 136, "combined_score": 726 }, { "protein2": "8022.A0A060VXZ3", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 501, "experimental": 672, "database": 510, "textmining": 225, "combined_score": 930 }, { "protein2": "8022.A0A060XLB8", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 398, "experimental": 362, "database": 0, "textmining": 279, "combined_score": 703 }, { "protein2": "8022.A0A060XKL0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 578, "database": 305, "textmining": 88, "combined_score": 709 }, { "protein2": "8022.A0A060VSV9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 291, "experimental": 366, "database": 335, "textmining": 230, "combined_score": 739 }, { "protein2": "8022.A0A060WIW0", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 494, "textmining": 151, "combined_score": 821 }, { "protein2": "8022.A0A060X8I2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 760, "database": 602, "textmining": 276, "combined_score": 924 }, { "protein2": "8022.A0A060WX48", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 523, "database": 333, "textmining": 224, "combined_score": 746 }, { "protein2": "8022.A0A060XM16", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060X0B9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 52, "experimental": 387, "database": 568, "textmining": 177, "combined_score": 765 }, { "protein2": "8022.A0A060XFQ3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 43, "experimental": 285, "database": 510, "textmining": 277, "combined_score": 729 }, { "protein2": "8022.A0A060XWV3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 622, "database": 573, "textmining": 233, "combined_score": 865 }, { "protein2": "8022.A0A060X2Y0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060WZJ2", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 239, "database": 560, "textmining": 196, "combined_score": 709 }, { "protein2": "8022.A0A060WXM8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 413, "experimental": 804, "database": 0, "textmining": 389, "combined_score": 923 }, { "protein2": "8022.A0A060WKE4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 80, "experimental": 520, "database": 427, "textmining": 236, "combined_score": 780 }, { "protein2": "8022.A0A060ZIZ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 75, "experimental": 719, "database": 276, "textmining": 285, "combined_score": 847 }, { "protein2": "8022.A0A060XG86", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 221, "experimental": 390, "database": 385, "textmining": 198, "combined_score": 738 }, { "protein2": "8022.A0A061ADP7", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 422, "textmining": 184, "combined_score": 773 }, { "protein2": "8022.A0A060WQ48", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 415, "textmining": 184, "combined_score": 770 }, { "protein2": "8022.A0A060XSP1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 824, "textmining": 44, "combined_score": 881 }, { "protein2": "8022.A0A060W1W2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 596, "experimental": 158, "database": 0, "textmining": 234, "combined_score": 721 }, { "protein2": "8022.A0A060XX32", "neighborhood": 0, "fusion": 0, "cooccurence": 49, "coexpression": 0, "experimental": 0, "database": 910, "textmining": 0, "combined_score": 910 }, { "protein2": "8022.A0A060Y8X7", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 221, "experimental": 390, "database": 385, "textmining": 198, "combined_score": 738 }, { "protein2": "8022.A0A060ZEP6", "neighborhood": 53, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 335, "database": 739, "textmining": 64, "combined_score": 825 }, { "protein2": "8022.A0A060Y0I2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 291, "experimental": 366, "database": 335, "textmining": 230, "combined_score": 739 }, { "protein2": "8022.A0A060YP66", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 681, "database": 425, "textmining": 372, "combined_score": 919 }, { "protein2": "8022.A0A060XQN1", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 596, "experimental": 158, "database": 0, "textmining": 234, "combined_score": 721 }, { "protein2": "8022.A0A060XYC7", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 160, "experimental": 390, "database": 385, "textmining": 225, "combined_score": 727 }, { "protein2": "8022.A0A060XS96", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 108, "combined_score": 717 }, { "protein2": "8022.A0A060W5B2", "neighborhood": 53, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 694, "database": 81, "textmining": 219, "combined_score": 764 }, { "protein2": "8022.A0A060X173", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060YBS9", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 466, "database": 514, "textmining": 223, "combined_score": 843 }, { "protein2": "8022.A0A060XI31", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 546, "database": 467, "textmining": 86, "combined_score": 759 }, { "protein2": "8022.A0A060XPW0", "neighborhood": 0, "fusion": 0, "cooccurence": 49, "coexpression": 0, "experimental": 0, "database": 862, "textmining": 0, "combined_score": 863 }, { "protein2": "8022.A0A060YHY9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 747, "database": 530, "textmining": 275, "combined_score": 906 }, { "protein2": "8022.A0A060X7A6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 551, "textmining": 110, "combined_score": 860 }, { "protein2": "8022.A0A060X795", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 839, "textmining": 75, "combined_score": 895 }, { "protein2": "8022.A0A060YYJ1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 622, "database": 573, "textmining": 233, "combined_score": 865 }, { "protein2": "8022.A0A060YN23", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 551, "textmining": 110, "combined_score": 860 }, { "protein2": "8022.A0A060XXH3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 388, "experimental": 577, "database": 372, "textmining": 229, "combined_score": 860 }, { "protein2": "8022.A0A060WP57", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 415, "textmining": 184, "combined_score": 770 }, { "protein2": "8022.A0A060XQG8", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 745, "database": 333, "textmining": 191, "combined_score": 866 }, { "protein2": "8022.A0A060VYX8", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 77, "experimental": 472, "database": 333, "textmining": 211, "combined_score": 713 }, { "protein2": "8022.A0A060WBD3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 751, "database": 333, "textmining": 309, "combined_score": 880 }, { "protein2": "8022.A0A060WWC7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 537, "textmining": 158, "combined_score": 725 }, { "protein2": "8022.A0A060YX95", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 756, "database": 431, "textmining": 227, "combined_score": 883 }, { "protein2": "8022.A0A060Y956", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 86, "combined_score": 710 }, { "protein2": "8022.A0A060VU47", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 681, "database": 425, "textmining": 372, "combined_score": 919 }, { "protein2": "8022.A0A060W321", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060Y4J9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 622, "database": 573, "textmining": 233, "combined_score": 865 }, { "protein2": "8022.A0A060WZL8", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 475, "database": 372, "textmining": 231, "combined_score": 822 }, { "protein2": "8022.A0A060WCV3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 523, "database": 333, "textmining": 224, "combined_score": 746 }, { "protein2": "8022.Q9PT09", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 107, "experimental": 276, "database": 610, "textmining": 82, "combined_score": 737 }, { "protein2": "8022.A0A060YAV2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 747, "database": 530, "textmining": 275, "combined_score": 906 }, { "protein2": "8022.A0A060YSP2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 494, "textmining": 151, "combined_score": 821 }, { "protein2": "8022.A0A060VWL5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 466, "database": 514, "textmining": 223, "combined_score": 843 }, { "protein2": "8022.A0A060VTB1", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 398, "textmining": 131, "combined_score": 748 }, { "protein2": "8022.A0A060Z671", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 80, "experimental": 520, "database": 427, "textmining": 143, "combined_score": 754 }, { "protein2": "8022.A0A060X9N1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 578, "database": 305, "textmining": 88, "combined_score": 709 }, { "protein2": "8022.A0A060XLH8", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 239, "database": 560, "textmining": 196, "combined_score": 709 }, { "protein2": "8022.A0A060XTM1", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060WS21", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 161, "database": 698, "textmining": 159, "combined_score": 768 }, { "protein2": "8022.A0A060X6P4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 756, "database": 431, "textmining": 227, "combined_score": 883 }, { "protein2": "8022.A0A060WGQ7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060XKZ0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 760, "database": 602, "textmining": 276, "combined_score": 924 }, { "protein2": "8022.A0A060X747", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 538, "database": 434, "textmining": 186, "combined_score": 768 }, { "protein2": "8022.A0A060VZB1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 279, "database": 593, "textmining": 274, "combined_score": 768 }, { "protein2": "8022.A0A060WF01", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 494, "textmining": 151, "combined_score": 821 }, { "protein2": "8022.A0A060Z3H2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 494, "textmining": 151, "combined_score": 821 }, { "protein2": "8022.A0A060WC37", "neighborhood": 48, "fusion": 0, "cooccurence": 0, "coexpression": 192, "experimental": 311, "database": 430, "textmining": 182, "combined_score": 707 }, { "protein2": "8022.A0A060Z2Q6", "neighborhood": 48, "fusion": 0, "cooccurence": 0, "coexpression": 192, "experimental": 311, "database": 430, "textmining": 182, "combined_score": 707 }, { "protein2": "8022.A0A060WGA5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 188, "database": 770, "textmining": 262, "combined_score": 852 }, { "protein2": "8022.A0A060Y0Z6", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 388, "experimental": 577, "database": 372, "textmining": 229, "combined_score": 860 }, { "protein2": "8022.A0A060XU63", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 596, "experimental": 158, "database": 0, "textmining": 234, "combined_score": 721 }, { "protein2": "8022.A0A060YC57", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 206, "database": 827, "textmining": 451, "combined_score": 918 }, { "protein2": "8022.A0A060WW88", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 121, "combined_score": 836 }, { "protein2": "8022.A0A060X0I3", "neighborhood": 0, "fusion": 0, "cooccurence": 87, "coexpression": 184, "experimental": 231, "database": 824, "textmining": 66, "combined_score": 888 }, { "protein2": "8022.A0A060VTX5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060ZHR8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 714, "database": 0, "textmining": 308, "combined_score": 811 }, { "protein2": "8022.A0A060YNU6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 415, "database": 575, "textmining": 134, "combined_score": 771 }, { "protein2": "8022.A0A060WZL3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 681, "database": 425, "textmining": 213, "combined_score": 898 }, { "protein2": "8022.A0A060X925", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 300, "database": 604, "textmining": 136, "combined_score": 744 }, { "protein2": "8022.A0A060X100", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060X3D1", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 594, "experimental": 362, "database": 0, "textmining": 140, "combined_score": 761 }, { "protein2": "8022.A0A060Z5F3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 517, "textmining": 151, "combined_score": 711 }, { "protein2": "8022.A0A060WM62", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060YC34", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 130, "combined_score": 838 }, { "protein2": "8022.A0A060XMU7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 233, "combined_score": 857 }, { "protein2": "8022.A0A060VZD9", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 475, "database": 372, "textmining": 231, "combined_score": 822 }, { "protein2": "8022.A0A060XUR0", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060VUJ1", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 112, "combined_score": 728 }, { "protein2": "8022.A0A060VN15", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 827, "textmining": 44, "combined_score": 883 }, { "protein2": "8022.A0A060VNA2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 300, "database": 604, "textmining": 136, "combined_score": 744 }, { "protein2": "8022.A0A060YTQ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 546, "database": 467, "textmining": 86, "combined_score": 759 }, { "protein2": "8022.A0A060YCE9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060WLB7", "neighborhood": 53, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 483, "database": 777, "textmining": 86, "combined_score": 886 }, { "protein2": "8022.A0A060WS33", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 576, "textmining": 75, "combined_score": 723 }, { "protein2": "8022.A0A060YL26", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 537, "textmining": 158, "combined_score": 725 }, { "protein2": "8022.A0A060Z011", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 571, "textmining": 263, "combined_score": 793 }, { "protein2": "8022.A0A060XVP2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 140, "combined_score": 727 }, { "protein2": "8022.A0A060YZM3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 628, "database": 418, "textmining": 151, "combined_score": 871 }, { "protein2": "8022.A0A060Z608", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 650, "database": 0, "textmining": 222, "combined_score": 716 }, { "protein2": "8022.A0A060X833", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 418, "database": 420, "textmining": 183, "combined_score": 700 }, { "protein2": "8022.A0A060W2P2", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 681, "database": 425, "textmining": 213, "combined_score": 898 }, { "protein2": "8022.A0A060XS93", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 494, "textmining": 151, "combined_score": 821 }, { "protein2": "8022.A0A060XU96", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 269, "database": 823, "textmining": 0, "combined_score": 865 }, { "protein2": "8022.A0A060Z5T3", "neighborhood": 157, "fusion": 0, "cooccurence": 0, "coexpression": 619, "experimental": 274, "database": 0, "textmining": 310, "combined_score": 817 }, { "protein2": "8022.A0A060YKD2", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 681, "database": 425, "textmining": 213, "combined_score": 898 }, { "protein2": "8022.A0A060W590", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 622, "database": 573, "textmining": 233, "combined_score": 865 }, { "protein2": "8022.A0A060XLI5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 415, "textmining": 184, "combined_score": 770 }, { "protein2": "8022.A0A060XFZ8", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 745, "database": 333, "textmining": 191, "combined_score": 866 }, { "protein2": "8022.A0A060W9R5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 487, "database": 352, "textmining": 231, "combined_score": 801 }, { "protein2": "8022.A0A060Z753", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 398, "database": 571, "textmining": 263, "combined_score": 793 }, { "protein2": "8022.A0A060WWK9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060WVU0", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 239, "database": 560, "textmining": 196, "combined_score": 709 }, { "protein2": "8022.A0A060VTX8", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 136, "combined_score": 726 }, { "protein2": "8022.A0A060YIJ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060YS73", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 681, "database": 425, "textmining": 213, "combined_score": 898 }, { "protein2": "8022.A0A060XT19", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 239, "database": 560, "textmining": 196, "combined_score": 709 }, { "protein2": "8022.A0A060WQJ1", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 388, "experimental": 577, "database": 372, "textmining": 217, "combined_score": 857 }, { "protein2": "8022.A0A060XUV0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 910, "textmining": 213, "combined_score": 950 }, { "protein2": "8022.A0A060YJ53", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 551, "textmining": 110, "combined_score": 860 }, { "protein2": "8022.A0A060X1H7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 714, "database": 0, "textmining": 308, "combined_score": 811 }, { "protein2": "8022.A0A060Z1D6", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 362, "database": 0, "textmining": 204, "combined_score": 798 }, { "protein2": "8022.A0A060WTV3", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A061A939", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 654, "textmining": 153, "combined_score": 819 }, { "protein2": "8022.A0A060W511", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 414, "database": 566, "textmining": 86, "combined_score": 747 }, { "protein2": "8022.A0A060XMQ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 317, "experimental": 768, "database": 609, "textmining": 308, "combined_score": 951 }, { "protein2": "8022.A0A060X313", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 136, "combined_score": 726 }, { "protein2": "8022.A0A060XZQ6", "neighborhood": 48, "fusion": 0, "cooccurence": 0, "coexpression": 734, "experimental": 288, "database": 0, "textmining": 308, "combined_score": 858 }, { "protein2": "8022.A0A060X5S5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 160, "experimental": 390, "database": 385, "textmining": 265, "combined_score": 741 }, { "protein2": "8022.A0A060YDB5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 203, "experimental": 704, "database": 569, "textmining": 231, "combined_score": 911 }, { "protein2": "8022.A0A060XV60", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 654, "textmining": 153, "combined_score": 819 }, { "protein2": "8022.A0A060Y5M1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 578, "database": 305, "textmining": 88, "combined_score": 709 }, { "protein2": "8022.A0A060XF94", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 573, "textmining": 85, "combined_score": 724 }, { "protein2": "8022.A0A060WTC8", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060X621", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 288, "database": 607, "textmining": 97, "combined_score": 725 }, { "protein2": "8022.A0A060WE23", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 576, "textmining": 75, "combined_score": 723 }, { "protein2": "8022.A0A060Y0A6", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 464, "experimental": 528, "database": 0, "textmining": 390, "combined_score": 834 }, { "protein2": "8022.A0A060X0Z3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 749, "database": 305, "textmining": 136, "combined_score": 836 }, { "protein2": "8022.A0A060XLX9", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 422, "textmining": 184, "combined_score": 773 }, { "protein2": "8022.A0A060VUI9", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 160, "experimental": 390, "database": 385, "textmining": 265, "combined_score": 741 }, { "protein2": "8022.A0A060Z698", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 203, "experimental": 704, "database": 569, "textmining": 231, "combined_score": 911 }, { "protein2": "8022.A0A060XH83", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 140, "combined_score": 727 }, { "protein2": "8022.A0A060WPC3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 829, "textmining": 44, "combined_score": 884 }, { "protein2": "8022.A0A060WDF7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 714, "database": 0, "textmining": 308, "combined_score": 811 }, { "protein2": "8022.A0A060XFF6", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060WMF6", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060WT77", "neighborhood": 0, "fusion": 0, "cooccurence": 79, "coexpression": 184, "experimental": 231, "database": 824, "textmining": 66, "combined_score": 887 }, { "protein2": "8022.A0A060XH19", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 300, "database": 604, "textmining": 136, "combined_score": 744 }, { "protein2": "8022.A0A060YGX2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 136, "combined_score": 726 }, { "protein2": "8022.A0A060YJ10", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 398, "textmining": 164, "combined_score": 757 }, { "protein2": "8022.A0A060YPZ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 747, "database": 530, "textmining": 275, "combined_score": 906 }, { "protein2": "8022.A0A060YQ01", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 233, "combined_score": 857 }, { "protein2": "8022.A0A060XKP9", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 422, "textmining": 184, "combined_score": 773 }, { "protein2": "8022.A0A060WJQ6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 839, "textmining": 75, "combined_score": 895 }, { "protein2": "8022.A0A060W549", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060XMD3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 749, "database": 305, "textmining": 136, "combined_score": 836 }, { "protein2": "8022.A0A060XQK3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 760, "database": 602, "textmining": 276, "combined_score": 924 }, { "protein2": "8022.A0A060YIG6", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 362, "database": 0, "textmining": 204, "combined_score": 798 }, { "protein2": "8022.A0A060X8Y7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 415, "database": 575, "textmining": 134, "combined_score": 771 }, { "protein2": "8022.A0A060YQ36", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 749, "database": 305, "textmining": 136, "combined_score": 836 }, { "protein2": "8022.A0A060X0Y4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 475, "database": 372, "textmining": 231, "combined_score": 822 }, { "protein2": "8022.A0A060XKV5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 769, "database": 862, "textmining": 345, "combined_score": 977 }, { "protein2": "8022.A0A060ZGX8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 75, "experimental": 719, "database": 276, "textmining": 285, "combined_score": 847 }, { "protein2": "8022.A0A060VRH7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 622, "database": 573, "textmining": 233, "combined_score": 865 }, { "protein2": "8022.A0A060XTG2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 136, "combined_score": 726 }, { "protein2": "8022.A0A060WQ49", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 136, "combined_score": 726 }, { "protein2": "8022.A0A060YDJ4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 681, "database": 425, "textmining": 213, "combined_score": 898 }, { "protein2": "8022.A0A060Z3C0", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 216, "combined_score": 751 }, { "protein2": "8022.A0A060YPE8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 54, "experimental": 410, "database": 568, "textmining": 216, "combined_score": 785 }, { "protein2": "8022.A0A060WU49", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060YTB0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 54, "experimental": 410, "database": 568, "textmining": 216, "combined_score": 785 }, { "protein2": "8022.A0A060Y7X2", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 239, "database": 560, "textmining": 196, "combined_score": 709 }, { "protein2": "8022.A0A060X189", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 92, "experimental": 744, "database": 572, "textmining": 219, "combined_score": 911 }, { "protein2": "8022.A0A060VZ05", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 136, "combined_score": 726 }, { "protein2": "8022.A0A060YG86", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 678, "database": 551, "textmining": 110, "combined_score": 860 }, { "protein2": "8022.A0A060XFD4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 578, "database": 305, "textmining": 88, "combined_score": 709 }, { "protein2": "8022.A0A060WTN3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 681, "database": 425, "textmining": 372, "combined_score": 919 }, { "protein2": "8022.O93245", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 662, "database": 736, "textmining": 237, "combined_score": 925 }, { "protein2": "8022.A0A060VPK1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 291, "experimental": 366, "database": 335, "textmining": 230, "combined_score": 739 }, { "protein2": "8022.A0A060Z6H0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 414, "database": 566, "textmining": 86, "combined_score": 747 }, { "protein2": "8022.A0A060XMQ9", "neighborhood": 0, "fusion": 0, "cooccurence": 86, "coexpression": 184, "experimental": 231, "database": 824, "textmining": 66, "combined_score": 888 }, { "protein2": "8022.A0A060XN97", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 650, "database": 0, "textmining": 222, "combined_score": 716 }, { "protein2": "8022.A0A060XAD4", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 398, "textmining": 164, "combined_score": 757 }, { "protein2": "8022.A0A060Z048", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060YXQ1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 668, "database": 537, "textmining": 110, "combined_score": 851 }, { "protein2": "8022.A0A060WE12", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 54, "experimental": 649, "database": 423, "textmining": 225, "combined_score": 831 }, { "protein2": "8022.A0A060X0B5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 487, "database": 352, "textmining": 231, "combined_score": 801 }, { "protein2": "8022.A0A060W593", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 415, "database": 575, "textmining": 134, "combined_score": 771 }, { "protein2": "8022.A0A060XL01", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 654, "textmining": 153, "combined_score": 819 }, { "protein2": "8022.A0A060VNI0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 415, "database": 575, "textmining": 134, "combined_score": 771 }, { "protein2": "8022.A0A060YMA6", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 745, "database": 333, "textmining": 191, "combined_score": 866 }, { "protein2": "8022.A0A060ZAX5", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060VM58", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 466, "database": 514, "textmining": 223, "combined_score": 843 }, { "protein2": "8022.A0A060WTG9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 578, "database": 305, "textmining": 88, "combined_score": 709 }, { "protein2": "8022.A0A060Z269", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 80, "experimental": 520, "database": 427, "textmining": 236, "combined_score": 780 }, { "protein2": "8022.A0A060XH10", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 578, "database": 305, "textmining": 88, "combined_score": 709 }, { "protein2": "8022.A0A060W0Z6", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 523, "database": 333, "textmining": 224, "combined_score": 746 }, { "protein2": "8022.A0A060XU67", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 602, "textmining": 269, "combined_score": 701 }, { "protein2": "8022.A0A060YFC5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 466, "database": 566, "textmining": 223, "combined_score": 860 }, { "protein2": "8022.A0A060XC97", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060WFL5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060YDC6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 42, "experimental": 769, "database": 862, "textmining": 345, "combined_score": 977 }, { "protein2": "8022.A0A060W3W8", "neighborhood": 0, "fusion": 0, "cooccurence": 49, "coexpression": 0, "experimental": 0, "database": 862, "textmining": 0, "combined_score": 863 }, { "protein2": "8022.A0A060Y9Q0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 0, "database": 816, "textmining": 134, "combined_score": 838 }, { "protein2": "8022.A0A061AD99", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 140, "combined_score": 727 }, { "protein2": "8022.A0A060Y028", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 563, "experimental": 362, "database": 0, "textmining": 374, "combined_score": 812 }, { "protein2": "8022.A0A060X8R3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 578, "database": 305, "textmining": 88, "combined_score": 709 }, { "protein2": "8022.A0A060W2L4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 517, "textmining": 151, "combined_score": 711 }, { "protein2": "8022.A0A060Y887", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 388, "experimental": 577, "database": 372, "textmining": 229, "combined_score": 860 }, { "protein2": "8022.A0A060X2T0", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 626, "experimental": 0, "database": 0, "textmining": 276, "combined_score": 722 }, { "protein2": "8022.A0A060YYY0", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060YXU2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060XYX3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 155, "database": 816, "textmining": 86, "combined_score": 845 }, { "protein2": "8022.A0A060YL36", "neighborhood": 53, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 483, "database": 777, "textmining": 86, "combined_score": 886 }, { "protein2": "8022.A0A060XXQ2", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 626, "experimental": 0, "database": 0, "textmining": 276, "combined_score": 722 }, { "protein2": "8022.A0A060YTF9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 75, "experimental": 719, "database": 276, "textmining": 285, "combined_score": 847 }, { "protein2": "8022.A0A060YB73", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 457, "database": 525, "textmining": 125, "combined_score": 754 }, { "protein2": "8022.A0A060Y544", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 487, "database": 352, "textmining": 231, "combined_score": 801 }, { "protein2": "8022.A0A060YGK7", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 745, "database": 333, "textmining": 191, "combined_score": 866 }, { "protein2": "8022.A0A060Z192", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 546, "database": 467, "textmining": 86, "combined_score": 759 }, { "protein2": "8022.A0A060VNG5", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 381, "experimental": 475, "database": 372, "textmining": 276, "combined_score": 835 }, { "protein2": "8022.A0A060YDW3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 376, "database": 570, "textmining": 214, "combined_score": 770 }, { "protein2": "8022.A0A060YDC0", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 681, "database": 425, "textmining": 213, "combined_score": 898 }, { "protein2": "8022.A0A060W6N9", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 388, "experimental": 577, "database": 372, "textmining": 229, "combined_score": 860 }, { "protein2": "8022.A0A060Z3A1", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 506, "database": 419, "textmining": 376, "combined_score": 813 }, { "protein2": "8022.A0A060VR91", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 594, "experimental": 362, "database": 0, "textmining": 140, "combined_score": 761 }, { "protein2": "8022.A0A060WRN7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 745, "database": 599, "textmining": 206, "combined_score": 911 }, { "protein2": "8022.A0A060XY82", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 745, "database": 333, "textmining": 191, "combined_score": 866 }, { "protein2": "8022.A0A060Y386", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 745, "database": 333, "textmining": 191, "combined_score": 866 }, { "protein2": "8022.A0A060XUE1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 414, "database": 566, "textmining": 86, "combined_score": 747 }, { "protein2": "8022.A0A060VVC5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 747, "database": 530, "textmining": 275, "combined_score": 906 }, { "protein2": "8022.A0A060WKB0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 576, "textmining": 75, "combined_score": 723 }, { "protein2": "8022.A0A060W7T8", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 239, "database": 560, "textmining": 196, "combined_score": 709 }, { "protein2": "8022.A0A060ZDS2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 414, "database": 566, "textmining": 86, "combined_score": 747 }, { "protein2": "8022.A0A061AF65", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 650, "database": 0, "textmining": 222, "combined_score": 716 }, { "protein2": "8022.A0A060XS17", "neighborhood": 46, "fusion": 0, "cooccurence": 0, "coexpression": 43, "experimental": 244, "database": 830, "textmining": 42, "combined_score": 867 }, { "protein2": "8022.A0A060ZHH3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060ZGE1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 756, "database": 431, "textmining": 227, "combined_score": 883 }, { "protein2": "8022.A0A060Y3A3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 752, "experimental": 892, "database": 639, "textmining": 406, "combined_score": 993 }, { "protein2": "8022.A0A060X691", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 756, "database": 431, "textmining": 227, "combined_score": 883 }, { "protein2": "8022.A0A060W5Y1", "neighborhood": 0, "fusion": 0, "cooccurence": 49, "coexpression": 0, "experimental": 0, "database": 826, "textmining": 0, "combined_score": 827 }, { "protein2": "8022.A0A060XPD8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 537, "textmining": 158, "combined_score": 725 }, { "protein2": "8022.A0A060W7A6", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 523, "database": 333, "textmining": 224, "combined_score": 746 }, { "protein2": "8022.A0A060XUA5", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 216, "combined_score": 751 }, { "protein2": "8022.A0A060XI97", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 749, "database": 305, "textmining": 136, "combined_score": 836 }, { "protein2": "8022.A0A060VMW3", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 388, "experimental": 577, "database": 372, "textmining": 217, "combined_score": 857 }, { "protein2": "8022.A0A060XL60", "neighborhood": 48, "fusion": 0, "cooccurence": 0, "coexpression": 192, "experimental": 311, "database": 430, "textmining": 182, "combined_score": 707 }, { "protein2": "8022.A0A060WI07", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 494, "textmining": 151, "combined_score": 821 }, { "protein2": "8022.A0A061AFA1", "neighborhood": 157, "fusion": 0, "cooccurence": 0, "coexpression": 619, "experimental": 274, "database": 0, "textmining": 310, "combined_score": 817 }, { "protein2": "8022.A0A060Z858", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 681, "database": 425, "textmining": 213, "combined_score": 898 }, { "protein2": "8022.A0A060XJK9", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 255, "experimental": 468, "database": 385, "textmining": 308, "combined_score": 811 }, { "protein2": "8022.A0A060WZC6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 80, "experimental": 520, "database": 427, "textmining": 236, "combined_score": 780 }, { "protein2": "8022.A0A061A773", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 121, "combined_score": 836 }, { "protein2": "8022.A0A060YQQ2", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 121, "combined_score": 836 }, { "protein2": "8022.A0A060VSN0", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 375, "textmining": 108, "combined_score": 727 }, { "protein2": "8022.A0A060Y7A8", "neighborhood": 53, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 483, "database": 834, "textmining": 86, "combined_score": 915 }, { "protein2": "8022.A0A060WD16", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 611, "database": 494, "textmining": 151, "combined_score": 821 }, { "protein2": "8022.A0A060XQ05", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 622, "database": 573, "textmining": 233, "combined_score": 865 }, { "protein2": "8022.A0A060ZCJ0", "neighborhood": 47, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 239, "database": 560, "textmining": 196, "combined_score": 709 }, { "protein2": "8022.A0A060YUG1", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 380, "database": 398, "textmining": 131, "combined_score": 748 }, { "protein2": "8022.A0A060Z5L0", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060WZP5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 415, "database": 575, "textmining": 134, "combined_score": 771 }, { "protein2": "8022.A0A060W187", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 68, "experimental": 743, "database": 333, "textmining": 268, "combined_score": 869 }, { "protein2": "8022.A0A060ZC75", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 760, "database": 602, "textmining": 276, "combined_score": 924 }, { "protein2": "8022.A0A060XJW3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 576, "textmining": 75, "combined_score": 723 }, { "protein2": "8022.A0A060Z216", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060WN55", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 317, "experimental": 768, "database": 609, "textmining": 308, "combined_score": 951 }, { "protein2": "8022.A0A060XH67", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 650, "database": 0, "textmining": 222, "combined_score": 716 }, { "protein2": "8022.A0A060VQQ6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 80, "experimental": 520, "database": 427, "textmining": 236, "combined_score": 780 }, { "protein2": "8022.A0A060XYL7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 388, "experimental": 577, "database": 372, "textmining": 229, "combined_score": 860 }, { "protein2": "8022.A0A060Y4G5", "neighborhood": 0, "fusion": 0, "cooccurence": 85, "coexpression": 184, "experimental": 231, "database": 824, "textmining": 66, "combined_score": 888 }, { "protein2": "8022.A0A060YV64", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 227, "experimental": 611, "database": 417, "textmining": 138, "combined_score": 831 }, { "protein2": "8022.A0A060XHR4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 475, "database": 372, "textmining": 356, "combined_score": 851 }, { "protein2": "8022.A0A060XHX0", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 304, "experimental": 370, "database": 352, "textmining": 126, "combined_score": 723 }, { "protein2": "8022.A0A060X2P2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 80, "experimental": 520, "database": 652, "textmining": 308, "combined_score": 879 }, { "protein2": "8022.A0A060YDW9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 654, "textmining": 153, "combined_score": 819 }, { "protein2": "8022.A0A060XTQ9", "neighborhood": 57, "fusion": 0, "cooccurence": 0, "coexpression": 128, "experimental": 745, "database": 333, "textmining": 191, "combined_score": 866 }, { "protein2": "8022.A0A060X382", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 372, "experimental": 556, "database": 404, "textmining": 121, "combined_score": 836 }, { "protein2": "8022.A0A060W9T8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 155, "database": 816, "textmining": 119, "combined_score": 851 }, { "protein2": "8022.A0A060WI90", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 538, "database": 434, "textmining": 186, "combined_score": 768 }, { "protein2": "8022.A0A060X462", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 71, "experimental": 749, "database": 431, "textmining": 228, "combined_score": 883 }, { "protein2": "8022.A0A060Z793", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 188, "database": 770, "textmining": 262, "combined_score": 852 }, { "protein2": "8022.A0A060YFT4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 137, "experimental": 338, "database": 608, "textmining": 160, "combined_score": 786 } ]
A0A060XV60
Nitric oxide synthase (EC 1.14.13.39)
Produces nitric oxide (NO) which is a messenger molecule with diverse functions. {ECO:0000256|PIRNR:PIRNR000333}.
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
1,083
Cytoplasm, cytosol {ECO:0000256|ARBA:ARBA00004514}.
MKLLQDDETKLSHQTKPNKWETRANRCPFSIPVRNVKDGSSLKDMLHHQAVKNQPCTSKVCEGSVMTPKALLRGPKVSTLEILPQAIDLINQYYKSFKIPKIEHHLARLEEITMEIDSTGTYQLTVEELAFGARQAWRNAPRCIGRIQWSNLQLFDARKCKTTQEMFQFLCEHLQFATNGGNLRSAITVFPPRKEDGHDFRVWNSQLLKYAGYQMPDGSIQGDPSSVEFTKICIQLGWKPQYGLFDVLPLVLQVNGEDPDLYEIPPHLILEVSMEHPQHKWFQDLGLKWYALPAVSNMLMEIGGLEFPACPFNGWYMGTEIGVRDFCDYQRYNILEEVGRRMGLETHKLSSLWKDQALVTINVAVIYSFQKNKVTITDHHSAAESFMKHLETEFRLRGGCPADWAWLVPPMSGSLTPIFHQEMVNYILSPFFYYQPDPWMTHVWRNGEMCLKKQQISFKAVARAALFSSTLMSRVLAKRVRCTVLYATETGKSQTLAQRLNSMLNGAFNSRLLCMEDYNFSDMEQESLLVVVTSTFGNGDSPGNGESFKKQLFSLQYLRNKLRYCVFGLGSRMYPQFCAFAHAVDAKLEELGAERVTPTGEGDELNGQEEAFSAWALTALKDAYKEFKIQGQLSLQLPGAERFCEAWDPLRHRVAVESCPQDRITALSAIHSKTVFPMKLKSKHNLQSPHSSRSTILVELERERSAEVMNFAPGDHVGVFPGNLPQLVAGILKFLPHTPPTNQCLRLEYRSDTCRDDEKNWQTVGRIPACPLSQALTYFLDVTTPPSQNLLHKLSQLAKQEGHRQRLLTLAKDSQEYTTWKMFRVPNFLEVLEEFPSLELSAAFLLSQLPLLKPRLYSISSSPQLHPNELHLTLTVLNYHTQDGQGPLHHGVCSTWLDTIKKGDLVPCFIYSSGGFHLPAEPSTPVILVGAGSGIAPFRSFWQQRLHDMKHPEFSESPMSLVFGCQSSETDHLYKEETLEMRRRGVLKSVTNAYSRQPGLPKVYVQDVLRERMAEEVLSVLHQKEGHFYVCGGVNMAQGVTLAVQEILSSQLGITLTQAGEYLTQLKIQKRYHEDIFGAQFQK
[ "GO:0006952", "GO:0009605", "GO:0050896", "GO:0051707", "GO:0009607", "GO:0042742", "GO:0009617", "GO:0006950", "GO:0050829", "GO:0098542", "GO:0008150", "GO:0044419", "GO:0043207", "GO:0016709", "GO:0003674", "GO:0004497", "GO:0016705", "GO:0003824", "GO:0004517", "GO:0016491" ]
[ "GO:0008150", "GO:0050896", "GO:0044419", "GO:0009605", "GO:0051707", "GO:0009607", "GO:0006950", "GO:0006952", "GO:0009617", "GO:0098542", "GO:0043207", "GO:0042742", "GO:0050829" ]
[ "GO:0003674", "GO:0003824", "GO:0016491", "GO:0004497", "GO:0016705", "GO:0016709", "GO:0004517" ]
null
[ "IPR003097", "IPR017927", "IPR001094", "IPR008254", "IPR001709", "IPR029039", "IPR039261", "IPR023173", "IPR050607", "IPR044943", "IPR044940", "IPR044944", "IPR012144", "IPR004030", "IPR036119", "IPR001433", "IPR017938" ]
af_db/AF-A0A060XV60-F1-model_v4.cif.gz
8022.A0A060XV60
[ "8022.A0A060YPW7", "8022.A0A060Z493", "8022.A0A060VUH5", "8022.A0A060VY42", "8022.A0A060X0R0", "8022.A0A060ZIY0", "8022.A0A060X8W2", "8022.A0A060Y668", "8022.A0A060WT46", "8022.A0A060XNB3", "8022.A0A060YQL0", "8022.A0A060WME3", "8022.A0A060X1K0", "8022.A0A060WMY9", "8022.A0A060XQR2", "8022.A0A060Y2D4", "8022.A0A060YDZ6", "8022.A0A060XTQ8", "8022.A0A060YCJ5", "8022.A0A060WAP3", "8022.A0A060XX32", "8022.A0A060XFL1", "8022.A0A060W734", "8022.A0A060XPW0", "8022.A0A060YSI8", "8022.A0A060XRH3", "8022.A0A060X0X9", "8022.A0A060Y6B4", "8022.C1BFS0", "8022.A0A060W0G4", "8022.A0A060YQ30", "8022.A0A060WPB0", "8022.A0A060XHA1", "8022.A0A060YV61", "8022.A0A060WRK3", "8022.A0A060XT26", "8022.A0A060XBQ4", "8022.A0A060X2Y0", "8022.A0A060WZJ2", "8022.A0A060WNA1", "8022.A0A060ZHH7", "8022.A0A060X7E4", "8022.A0A060VM68", "8022.A0A060YT33", "8022.A0A060WIX3", "8022.A0A061ADX4", "8022.A0A060Y0G1", "8022.A0A060YRP0", "8022.A0A060WDB5", "8022.A0A060VPQ2", "8022.A0A060Z8E9", "8022.A0A060XPD1", "8022.A0A060ZEH8", "8022.A0A060X1J3", "8022.A0A060WPC7", "8022.A0A060YT17", "8022.A0A060WUS8", "8022.A0A060WNH4", "8022.A0A060X1G8", "8022.A0A060X1N4", "8022.A0A060VTH2", "8022.A0A060XBJ4", "8022.A0A060Z7B1", "8022.A0A060XR67", "8022.A0A060W1U9", "8022.A0A060YSJ4", "8022.A0A060WC75", "8022.A0A060VXP1", "8022.A0A060WCQ1", "8022.A0A060X2J6", "8022.A0A060YGK5", "8022.A0A060XYR9", "8022.A0A060XNC5", "8022.A0A060YDR5", "8022.A0A060WGM4", "8022.A0A060YC89", "8022.A0A060Y842", "8022.A0A060Y8F7", "8022.A0A060XF24", "8022.A0A060W049", "8022.A0A060W3W8", "8022.A0A060XCT2", "8022.A0A060WFL5", "8022.A0A061A6B0", "8022.A0A060VW47", "8022.I7KJN7", "8022.A0A060YAG9", "8022.A0A060W162", "8022.A0A060YWN2", "8022.A0A060YXU2", "8022.A0A060XYX3", "8022.A0A060YB73", "8022.A0A060WA19", "8022.A0A060X3G7", "8022.A0A060YX93", "8022.A0A060W596", "8022.A0A060XMQ9", "8022.A0A060W2E5", "8022.A0A060WC73", "8022.A0A060YMX6", "8022.A0A060WKC5", "8022.A0A060XBU7", "8022.A0A060YBL7", "8022.A0A060Y4G5", "8022.A0A060X194", "8022.A0A060YDW9", "8022.A0A060W9T8", "8022.A0A060Z793", "8022.A0A060WNQ7", "8022.A0A060WAD8", "8022.A0A060WCU7", "8022.A0A060W7T8", "8022.A0A060ZA76", "8022.A0A060W5Y1", "8022.A0A060VY35", "8022.A0A060YGU6", "8022.A0A060YS39", "8022.A0A060ZCJ0", "8022.A0A060WPM5", "8022.A0A060WGA5", "8022.A0A060YC57", "8022.A0A060X0I3", "8022.A0A060YJY5", "8022.A0A060YD44", "8022.A0A060WNP6", "8022.A0A060YCE9", "8022.A0A060WRK6", "8022.A0A060W4D0", "8022.A0A060XEY0", "8022.A0A060WHF9", "8022.A0A060WYW2", "8022.A0A060Z057", "8022.A0A060XLH8", "8022.A0A060Y0K9", "8022.A0A060Y5V9", "8022.A0A060WT77", "8022.A0A060VUY8", "8022.A0A060XE59", "8022.A0A060W893", "8022.A0A060ZDN1", "8022.A0A060YI86", "8022.A0A060WU49", "8022.A0A060Y7X2", "8022.A0A060WWK9", "8022.A0A060W698", "8022.A0A060WVU0", "8022.A0A060YIJ4", "8022.A0A060XFW6", "8022.A0A060YFN8", "8022.A0A060W713", "8022.A0A060WVX9", "8022.A0A060XT19", "8022.A0A060WHS3", "8022.A0A060VMH2", "8022.A0A060WHE5", "8022.A0A060XIU8", "8022.A0A060YH41" ]
[ { "protein2": "8022.A0A060YPW7", "neighborhood": 154, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 0, "database": 0, "textmining": 230, "combined_score": 737 }, { "protein2": "8022.A0A060Z493", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 266, "database": 833, "textmining": 410, "combined_score": 921 }, { "protein2": "8022.A0A060VUH5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 916, "textmining": 378, "combined_score": 945 }, { "protein2": "8022.A0A060VY42", "neighborhood": 46, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 82, "database": 602, "textmining": 265, "combined_score": 709 }, { "protein2": "8022.A0A060X0R0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 178, "database": 824, "textmining": 186, "combined_score": 871 }, { "protein2": "8022.A0A060ZIY0", "neighborhood": 43, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 680, "database": 554, "textmining": 219, "combined_score": 890 }, { "protein2": "8022.A0A060X8W2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 816, "textmining": 87, "combined_score": 883 }, { "protein2": "8022.A0A060Y668", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 455, "database": 782, "textmining": 259, "combined_score": 904 }, { "protein2": "8022.A0A060WT46", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 816, "textmining": 87, "combined_score": 883 }, { "protein2": "8022.A0A060XNB3", "neighborhood": 116, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 325, "database": 585, "textmining": 261, "combined_score": 813 }, { "protein2": "8022.A0A060YQL0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 703, "textmining": 77, "combined_score": 714 }, { "protein2": "8022.A0A060WME3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 812, "textmining": 87, "combined_score": 880 }, { "protein2": "8022.A0A060X1K0", "neighborhood": 0, "fusion": 0, "cooccurence": 66, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 0, "combined_score": 831 }, { "protein2": "8022.A0A060WMY9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 379, "database": 568, "textmining": 89, "combined_score": 734 }, { "protein2": "8022.A0A060XQR2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 703, "textmining": 109, "combined_score": 724 }, { "protein2": "8022.A0A060Y2D4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 324, "database": 835, "textmining": 112, "combined_score": 892 }, { "protein2": "8022.A0A060YDZ6", "neighborhood": 116, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 325, "database": 585, "textmining": 261, "combined_score": 813 }, { "protein2": "8022.A0A060XTQ8", "neighborhood": 43, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 680, "database": 554, "textmining": 219, "combined_score": 890 }, { "protein2": "8022.A0A060YCJ5", "neighborhood": 43, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 680, "database": 554, "textmining": 219, "combined_score": 890 }, { "protein2": "8022.A0A060WAP3", "neighborhood": 49, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 153, "database": 654, "textmining": 86, "combined_score": 711 }, { "protein2": "8022.A0A060XX32", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 654, "textmining": 153, "combined_score": 819 }, { "protein2": "8022.A0A060XFL1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 157, "database": 721, "textmining": 64, "combined_score": 762 }, { "protein2": "8022.A0A060W734", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 429, "textmining": 308, "combined_score": 894 }, { "protein2": "8022.A0A060XPW0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 654, "textmining": 153, "combined_score": 819 }, { "protein2": "8022.A0A060YSI8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 172, "database": 835, "textmining": 308, "combined_score": 897 }, { "protein2": "8022.A0A060XRH3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 54, "database": 828, "textmining": 64, "combined_score": 835 }, { "protein2": "8022.A0A060X0X9", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 385, "experimental": 0, "database": 650, "textmining": 230, "combined_score": 840 }, { "protein2": "8022.A0A060Y6B4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 157, "database": 721, "textmining": 64, "combined_score": 762 }, { "protein2": "8022.C1BFS0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 705, "database": 0, "textmining": 105, "combined_score": 724 }, { "protein2": "8022.A0A060W0G4", "neighborhood": 46, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 749 }, { "protein2": "8022.A0A060YQ30", "neighborhood": 49, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 153, "database": 654, "textmining": 86, "combined_score": 711 }, { "protein2": "8022.A0A060WPB0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 379, "database": 568, "textmining": 89, "combined_score": 734 }, { "protein2": "8022.A0A060XHA1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 266, "database": 833, "textmining": 410, "combined_score": 921 }, { "protein2": "8022.A0A060YV61", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 157, "database": 721, "textmining": 64, "combined_score": 762 }, { "protein2": "8022.A0A060WRK3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 379, "database": 568, "textmining": 89, "combined_score": 734 }, { "protein2": "8022.A0A060XT26", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 754, "database": 429, "textmining": 308, "combined_score": 894 }, { "protein2": "8022.A0A060XBQ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 167, "database": 721, "textmining": 130, "combined_score": 780 }, { "protein2": "8022.A0A060X2Y0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 826, "textmining": 87, "combined_score": 889 }, { "protein2": "8022.A0A060WZJ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 482, "database": 772, "textmining": 114, "combined_score": 886 }, { "protein2": "8022.A0A060WNA1", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 721, "textmining": 159, "combined_score": 759 }, { "protein2": "8022.A0A060ZHH7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 836, "textmining": 311, "combined_score": 919 }, { "protein2": "8022.A0A060X7E4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 836, "textmining": 311, "combined_score": 919 }, { "protein2": "8022.A0A060VM68", "neighborhood": 48, "fusion": 0, "cooccurence": 0, "coexpression": 48, "experimental": 187, "database": 527, "textmining": 275, "combined_score": 701 }, { "protein2": "8022.A0A060YT33", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 338, "database": 760, "textmining": 158, "combined_score": 854 }, { "protein2": "8022.A0A060WIX3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 482, "database": 772, "textmining": 114, "combined_score": 886 }, { "protein2": "8022.A0A061ADX4", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 172, "database": 835, "textmining": 86, "combined_score": 866 }, { "protein2": "8022.A0A060Y0G1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 482, "database": 772, "textmining": 114, "combined_score": 886 }, { "protein2": "8022.A0A060YRP0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 835, "textmining": 200, "combined_score": 862 }, { "protein2": "8022.A0A060WDB5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 826, "textmining": 87, "combined_score": 889 }, { "protein2": "8022.A0A060VPQ2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 812, "textmining": 87, "combined_score": 880 }, { "protein2": "8022.A0A060Z8E9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 266, "database": 833, "textmining": 410, "combined_score": 921 }, { "protein2": "8022.A0A060XPD1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 482, "database": 772, "textmining": 114, "combined_score": 886 }, { "protein2": "8022.A0A060ZEH8", "neighborhood": 154, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 0, "database": 0, "textmining": 230, "combined_score": 737 }, { "protein2": "8022.A0A060X1J3", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 385, "experimental": 0, "database": 650, "textmining": 230, "combined_score": 840 }, { "protein2": "8022.A0A060WPC7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 307, "database": 785, "textmining": 183, "combined_score": 867 }, { "protein2": "8022.A0A060YT17", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 379, "database": 568, "textmining": 89, "combined_score": 734 }, { "protein2": "8022.A0A060WUS8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 760, "textmining": 86, "combined_score": 775 }, { "protein2": "8022.A0A060WNH4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 812, "textmining": 87, "combined_score": 880 }, { "protein2": "8022.A0A060X1G8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 155, "database": 712, "textmining": 64, "combined_score": 754 }, { "protein2": "8022.A0A060X1N4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 324, "database": 834, "textmining": 390, "combined_score": 925 }, { "protein2": "8022.A0A060VTH2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 836, "textmining": 311, "combined_score": 919 }, { "protein2": "8022.A0A060XBJ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 338, "database": 824, "textmining": 213, "combined_score": 900 }, { "protein2": "8022.A0A060Z7B1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 816, "textmining": 87, "combined_score": 883 }, { "protein2": "8022.A0A060XR67", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 721, "textmining": 86, "combined_score": 815 }, { "protein2": "8022.A0A060W1U9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 338, "database": 760, "textmining": 158, "combined_score": 854 }, { "protein2": "8022.A0A060YSJ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 482, "database": 772, "textmining": 114, "combined_score": 886 }, { "protein2": "8022.A0A060WC75", "neighborhood": 46, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 82, "database": 602, "textmining": 265, "combined_score": 709 }, { "protein2": "8022.A0A060VXP1", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 721, "textmining": 159, "combined_score": 759 }, { "protein2": "8022.A0A060WCQ1", "neighborhood": 107, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 0, "database": 736, "textmining": 308, "combined_score": 827 }, { "protein2": "8022.A0A060X2J6", "neighborhood": 55, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 44, "database": 830, "textmining": 140, "combined_score": 850 }, { "protein2": "8022.A0A060YGK5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 836, "textmining": 311, "combined_score": 919 }, { "protein2": "8022.A0A060XYR9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 352, "database": 715, "textmining": 366, "combined_score": 872 }, { "protein2": "8022.A0A060XNC5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 178, "database": 824, "textmining": 186, "combined_score": 871 }, { "protein2": "8022.A0A060YDR5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 338, "database": 824, "textmining": 86, "combined_score": 884 }, { "protein2": "8022.A0A060WGM4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 379, "database": 568, "textmining": 89, "combined_score": 734 }, { "protein2": "8022.A0A060YC89", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 721, "textmining": 159, "combined_score": 759 }, { "protein2": "8022.A0A060Y842", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 816, "textmining": 87, "combined_score": 883 }, { "protein2": "8022.A0A060Y8F7", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 721, "textmining": 159, "combined_score": 759 }, { "protein2": "8022.A0A060XF24", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 760, "textmining": 86, "combined_score": 775 }, { "protein2": "8022.A0A060W049", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 157, "database": 721, "textmining": 64, "combined_score": 762 }, { "protein2": "8022.A0A060W3W8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 654, "textmining": 153, "combined_score": 819 }, { "protein2": "8022.A0A060XCT2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 70, "experimental": 0, "database": 835, "textmining": 375, "combined_score": 895 }, { "protein2": "8022.A0A060WFL5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 812, "textmining": 87, "combined_score": 880 }, { "protein2": "8022.A0A061A6B0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 155, "database": 712, "textmining": 64, "combined_score": 754 }, { "protein2": "8022.A0A060VW47", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 654, "textmining": 153, "combined_score": 819 }, { "protein2": "8022.I7KJN7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 172, "database": 830, "textmining": 308, "combined_score": 894 }, { "protein2": "8022.A0A060YAG9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 167, "database": 721, "textmining": 130, "combined_score": 780 }, { "protein2": "8022.A0A060W162", "neighborhood": 154, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 0, "database": 0, "textmining": 230, "combined_score": 737 }, { "protein2": "8022.A0A060YWN2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 155, "database": 712, "textmining": 64, "combined_score": 754 }, { "protein2": "8022.A0A060YXU2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 826, "textmining": 87, "combined_score": 889 }, { "protein2": "8022.A0A060XYX3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 338, "database": 824, "textmining": 86, "combined_score": 884 }, { "protein2": "8022.A0A060YB73", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 816, "textmining": 87, "combined_score": 883 }, { "protein2": "8022.A0A060WA19", "neighborhood": 154, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 0, "database": 0, "textmining": 230, "combined_score": 737 }, { "protein2": "8022.A0A060X3G7", "neighborhood": 48, "fusion": 0, "cooccurence": 0, "coexpression": 48, "experimental": 187, "database": 527, "textmining": 275, "combined_score": 701 }, { "protein2": "8022.A0A060YX93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 760, "textmining": 86, "combined_score": 775 }, { "protein2": "8022.A0A060W596", "neighborhood": 48, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 0, "database": 816, "textmining": 108, "combined_score": 834 }, { "protein2": "8022.A0A060XMQ9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 721, "textmining": 86, "combined_score": 815 }, { "protein2": "8022.A0A060W2E5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 157, "database": 721, "textmining": 64, "combined_score": 762 }, { "protein2": "8022.A0A060WC73", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 836, "textmining": 311, "combined_score": 919 }, { "protein2": "8022.A0A060YMX6", "neighborhood": 116, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 325, "database": 585, "textmining": 261, "combined_score": 813 }, { "protein2": "8022.A0A060WKC5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 157, "database": 721, "textmining": 64, "combined_score": 762 }, { "protein2": "8022.A0A060XBU7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 172, "database": 830, "textmining": 308, "combined_score": 894 }, { "protein2": "8022.A0A060YBL7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 703, "textmining": 60, "combined_score": 708 }, { "protein2": "8022.A0A060Y4G5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 721, "textmining": 86, "combined_score": 815 }, { "protein2": "8022.A0A060X194", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 385, "experimental": 0, "database": 650, "textmining": 230, "combined_score": 840 }, { "protein2": "8022.A0A060YDW9", "neighborhood": 0, "fusion": 0, "cooccurence": 55, "coexpression": 0, "experimental": 0, "database": 827, "textmining": 0, "combined_score": 829 }, { "protein2": "8022.A0A060W9T8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 338, "database": 824, "textmining": 213, "combined_score": 900 }, { "protein2": "8022.A0A060Z793", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 455, "database": 782, "textmining": 259, "combined_score": 904 }, { "protein2": "8022.A0A060WNQ7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 703, "textmining": 44, "combined_score": 703 }, { "protein2": "8022.A0A060WAD8", "neighborhood": 49, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 153, "database": 654, "textmining": 86, "combined_score": 711 }, { "protein2": "8022.A0A060WCU7", "neighborhood": 46, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 835, "textmining": 333, "combined_score": 885 }, { "protein2": "8022.A0A060W7T8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 482, "database": 772, "textmining": 114, "combined_score": 886 }, { "protein2": "8022.A0A060ZA76", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 836, "textmining": 311, "combined_score": 919 }, { "protein2": "8022.A0A060W5Y1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 654, "textmining": 153, "combined_score": 819 }, { "protein2": "8022.A0A060VY35", "neighborhood": 107, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 0, "database": 736, "textmining": 308, "combined_score": 827 }, { "protein2": "8022.A0A060YGU6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 344, "database": 836, "textmining": 311, "combined_score": 919 }, { "protein2": "8022.A0A060YS39", "neighborhood": 49, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 153, "database": 654, "textmining": 86, "combined_score": 711 }, { "protein2": "8022.A0A060ZCJ0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 482, "database": 569, "textmining": 114, "combined_score": 784 }, { "protein2": "8022.A0A060WPM5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 379, "database": 568, "textmining": 89, "combined_score": 734 }, { "protein2": "8022.A0A060WGA5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 455, "database": 782, "textmining": 259, "combined_score": 904 }, { "protein2": "8022.A0A060YC57", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 324, "database": 829, "textmining": 401, "combined_score": 924 }, { "protein2": "8022.A0A060X0I3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 721, "textmining": 86, "combined_score": 815 }, { "protein2": "8022.A0A060YJY5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 155, "database": 712, "textmining": 64, "combined_score": 754 }, { "protein2": "8022.A0A060YD44", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 157, "database": 721, "textmining": 64, "combined_score": 762 }, { "protein2": "8022.A0A060WNP6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 705, "database": 0, "textmining": 105, "combined_score": 724 }, { "protein2": "8022.A0A060YCE9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 816, "textmining": 87, "combined_score": 883 }, { "protein2": "8022.A0A060WRK6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 307, "database": 785, "textmining": 183, "combined_score": 867 }, { "protein2": "8022.A0A060W4D0", "neighborhood": 48, "fusion": 0, "cooccurence": 0, "coexpression": 48, "experimental": 187, "database": 527, "textmining": 275, "combined_score": 701 }, { "protein2": "8022.A0A060XEY0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 157, "database": 721, "textmining": 64, "combined_score": 762 }, { "protein2": "8022.A0A060WHF9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 307, "database": 785, "textmining": 183, "combined_score": 867 }, { "protein2": "8022.A0A060WYW2", "neighborhood": 42, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 787, "textmining": 231, "combined_score": 829 }, { "protein2": "8022.A0A060Z057", "neighborhood": 153, "fusion": 0, "cooccurence": 0, "coexpression": 385, "experimental": 0, "database": 650, "textmining": 230, "combined_score": 840 }, { "protein2": "8022.A0A060XLH8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 482, "database": 569, "textmining": 114, "combined_score": 784 }, { "protein2": "8022.A0A060Y0K9", "neighborhood": 43, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 680, "database": 554, "textmining": 219, "combined_score": 890 }, { "protein2": "8022.A0A060Y5V9", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 614, "experimental": 0, "database": 679, "textmining": 308, "combined_score": 918 }, { "protein2": "8022.A0A060WT77", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 721, "textmining": 86, "combined_score": 815 }, { "protein2": "8022.A0A060VUY8", "neighborhood": 43, "fusion": 0, "cooccurence": 0, "coexpression": 129, "experimental": 680, "database": 554, "textmining": 219, "combined_score": 890 }, { "protein2": "8022.A0A060XE59", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 157, "database": 721, "textmining": 64, "combined_score": 762 }, { "protein2": "8022.A0A060W893", "neighborhood": 46, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 736, "textmining": 86, "combined_score": 749 }, { "protein2": "8022.A0A060ZDN1", "neighborhood": 49, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 153, "database": 654, "textmining": 86, "combined_score": 711 }, { "protein2": "8022.A0A060YI86", "neighborhood": 159, "fusion": 0, "cooccurence": 0, "coexpression": 614, "experimental": 0, "database": 679, "textmining": 308, "combined_score": 918 }, { "protein2": "8022.A0A060WU49", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 812, "textmining": 87, "combined_score": 880 }, { "protein2": "8022.A0A060Y7X2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 482, "database": 772, "textmining": 114, "combined_score": 886 }, { "protein2": "8022.A0A060WWK9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 812, "textmining": 87, "combined_score": 880 }, { "protein2": "8022.A0A060W698", "neighborhood": 46, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 82, "database": 602, "textmining": 265, "combined_score": 709 }, { "protein2": "8022.A0A060WVU0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 482, "database": 772, "textmining": 114, "combined_score": 886 }, { "protein2": "8022.A0A060YIJ4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 360, "database": 826, "textmining": 87, "combined_score": 889 }, { "protein2": "8022.A0A060XFW6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 433, "database": 654, "textmining": 153, "combined_score": 819 }, { "protein2": "8022.A0A060YFN8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 266, "database": 833, "textmining": 410, "combined_score": 921 }, { "protein2": "8022.A0A060W713", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 705, "database": 0, "textmining": 105, "combined_score": 724 }, { "protein2": "8022.A0A060WVX9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 157, "database": 721, "textmining": 64, "combined_score": 762 }, { "protein2": "8022.A0A060XT19", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 482, "database": 772, "textmining": 114, "combined_score": 886 }, { "protein2": "8022.A0A060WHS3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 167, "database": 721, "textmining": 130, "combined_score": 780 }, { "protein2": "8022.A0A060VMH2", "neighborhood": 56, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 721, "textmining": 159, "combined_score": 759 }, { "protein2": "8022.A0A060WHE5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 155, "database": 712, "textmining": 64, "combined_score": 754 }, { "protein2": "8022.A0A060XIU8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 0, "database": 760, "textmining": 86, "combined_score": 775 }, { "protein2": "8022.A0A060YH41", "neighborhood": 49, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 153, "database": 654, "textmining": 86, "combined_score": 711 } ]
A0A060Z0U0
Interleukin-1
null
Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
254
Cytoplasm, cytosol {ECO:0000256|ARBA:ARBA00004514}. Lysosome {ECO:0000256|ARBA:ARBA00004371}. Secreted, extracellular exosome {ECO:0000256|ARBA:ARBA00004550}.
MEFESNCSLMKNTSASVAWSSKLPQGLDVEISHHPITLRCVANLIIAMERLNGGKGFTLGRDEGLLNFLLESAVEVLELESARTEASSRAAFSSKGEYECSVTDSENKCWVLNEGSMELHAIMLQGGSSYHKVHLNLSTYITPVPSETKARPVALGIKGSNLYLSCITSEGTPTLHLEEVADKEQLKSINHESDMVRFLFYKQDTGVDISTLESAHYRNWFISTALQQDNTKMVNMCQRATLNRNTTFTVQRHN
[ "GO:0009893", "GO:0060255", "GO:0065007", "GO:0010628", "GO:0048518", "GO:0008150", "GO:0010604", "GO:0050789", "GO:0019222", "GO:0048519", "GO:0010605", "GO:0010629", "GO:0010468", "GO:0009892" ]
[ "GO:0008150", "GO:0065007", "GO:0048518", "GO:0050789", "GO:0048519", "GO:0009893", "GO:0019222", "GO:0009892", "GO:0060255", "GO:0010604", "GO:0010605", "GO:0010628", "GO:0010629", "GO:0010468" ]
null
null
[ "IPR000975", "IPR008996" ]
af_db/AF-A0A060Z0U0-F1-model_v4.cif.gz
8022.A0A060Z0U0
[ "8022.A0A060WX21", "8022.A0A060WI11", "8022.A0A060YC27", "8022.A0A060YIW1", "8022.A0A060YA72", "8022.A0A060YP34", "8022.A0A060YX71", "8022.A0A060YA09", "8022.A0A060YKJ1", "8022.A0A060WYC1", "8022.A0A060VXI5", "8022.W1I939", "8022.A0A060VVP8", "8022.A0A060XA82", "8022.A0A060ZXZ7", "8022.A0A060YU62", "8022.A0A060XQB8", "8022.A0A060Z1N9", "8022.A0A060YXU1", "8022.A0A060XMN7", "8022.A0A060XPX7", "8022.A0A060YRF1", "8022.A0A060XUA7", "8022.A0A060Z4Q6", "8022.A0A060WMR1", "8022.A0A060X3S2", "8022.A0A060X035", "8022.A0A060YIA4", "8022.A0A060YTR0", "8022.A0A060YCT9", "8022.A0A060YF61", "8022.A0A060WBT7", "8022.Q8QFQ0", "8022.A0A060XD94", "8022.A0A060XFH8", "8022.C1BEY3", "8022.A0A060Y043", "8022.A0A060X063", "8022.A0A060XGI5", "8022.A0A060VZ13", "8022.A0A060WGW1", "8022.A0A060Z3R0", "8022.A0A060ZDV9", "8022.A0A060XZ47", "8022.A0A060X8T7", "8022.A0A060X8C6", "8022.A0A060VNB2", "8022.A0A060YV84", "8022.A0A060WTK5", "8022.A0A060Y8G1", "8022.A0A060Z6D6", "8022.A0A060Z6R5", "8022.A0A060YHN1", "8022.A0A060WD93", "8022.A0A060XHF7", "8022.A0A061AEF4", "8022.A0A060ZGH4", "8022.A0A060XF80", "8022.A0A061ACZ0", "8022.A0A060XAE5", "8022.A0A060YTI8", "8022.A0A060W114", "8022.A0A060VZJ8", "8022.A0A060W995", "8022.A0A060WD54", "8022.A0A060WU24", "8022.A0A060YVB1", "8022.A0A060X986", "8022.A0A060WL45", "8022.A0A060Y6M5", "8022.A0A060YFH5", "8022.A0A060X3H8", "8022.A0A060XIE4", "8022.A0A060W3D8", "8022.A0A060VUM0", "8022.A0A060XTS9", "8022.A0A060Z424", "8022.A0A060W518", "8022.A0A060YRT0", "8022.A0A060XMR6", "8022.A0A060YUC8", "8022.A0A060VVA1", "8022.A0A060YIQ8", "8022.A0A060W037", "8022.Q1G669", "8022.A0A060WUH7", "8022.A0A060YG76", "8022.A0A060Y952", "8022.A0A060WC91", "8022.A0A061A315", "8022.A0A060X3D3", "8022.A0A060XFJ7", "8022.A0A060XPX2", "8022.A0A060WRJ1", "8022.A0A060W2H2", "8022.A0A060ZEP6", "8022.A0A060WH57", "8022.A0A060XQ00", "8022.A0A060XR03", "8022.A0A060Y7T2", "8022.A0A060W128", "8022.A0A060WVY3", "8022.A0A060YUZ8", "8022.A0A060WT74", "8022.A0A060Z7Q9", "8022.A0A060YYT8", "8022.A0A060XA36", "8022.C1BI02", "8022.A0A060VTL5", "8022.A0A060W4P9", "8022.A0A060XXD6", "8022.A0A060WA83", "8022.A0A060VT18", "8022.A0A060W2M3", "8022.A0A060WSV1", "8022.A0A060XB50", "8022.A0A060X9U8", "8022.A0A060Z1J2", "8022.A0A060XLZ6", "8022.A0A060W766", "8022.A0A060WMZ6", "8022.A0A060ZZG4", "8022.A0A060XKG4", "8022.A0A060YGA1", "8022.A0A060XG27", "8022.A0A060XIZ5", "8022.A0A060YBG9", "8022.A0A060YSX0", "8022.A0A060VYB4", "8022.A0A060XW82", "8022.A0A060XVY3", "8022.W0TYL2", "8022.A0A060WQB0", "8022.A0A060X1J2", "8022.A0A060X7P8", "8022.A0A060Z4I6", "8022.A0A060W2H8", "8022.A0A060WPH7", "8022.A0A060YNP8", "8022.A0A060XPJ8", "8022.A0A060X8V7", "8022.A0A060YQ81", "8022.A0A060W820", "8022.A0A060VNW8", "8022.A0A060VY72", "8022.A0A060WJ39", "8022.A0A060X285", "8022.A0A060Y084", "8022.A0A060XRW9", "8022.A0A060W9P9", "8022.A0A060YKY4", "8022.A0A060WPR8", "8022.A0A060YHB3", "8022.A0A060WBI2", "8022.A0A060Y558", "8022.A0A060YAX3" ]
[ { "protein2": "8022.A0A060WX21", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 140, "experimental": 535, "database": 824, "textmining": 440, "combined_score": 955 }, { "protein2": "8022.A0A060WI11", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 236, "combined_score": 726 }, { "protein2": "8022.A0A060YC27", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 826, "textmining": 367, "combined_score": 896 }, { "protein2": "8022.A0A060YIW1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 137, "experimental": 53, "database": 699, "textmining": 505, "combined_score": 861 }, { "protein2": "8022.A0A060YA72", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 333, "database": 507, "textmining": 332, "combined_score": 767 }, { "protein2": "8022.A0A060YP34", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 853, "database": 910, "textmining": 450, "combined_score": 992 }, { "protein2": "8022.A0A060YX71", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 273, "database": 650, "textmining": 46, "combined_score": 740 }, { "protein2": "8022.A0A060YA09", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060YKJ1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060WYC1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 910, "textmining": 367, "combined_score": 946 }, { "protein2": "8022.A0A060VXI5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.W1I939", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 236, "combined_score": 726 }, { "protein2": "8022.A0A060VVP8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060XA82", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 236, "combined_score": 726 }, { "protein2": "8022.A0A060ZXZ7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 110, "database": 699, "textmining": 506, "combined_score": 856 }, { "protein2": "8022.A0A060YU62", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 500, "experimental": 0, "database": 0, "textmining": 443, "combined_score": 709 }, { "protein2": "8022.A0A060XQB8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 92, "experimental": 0, "database": 824, "textmining": 380, "combined_score": 892 }, { "protein2": "8022.A0A060Z1N9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060YXU1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 74, "experimental": 0, "database": 670, "textmining": 191, "combined_score": 731 }, { "protein2": "8022.A0A060XMN7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 333, "database": 507, "textmining": 332, "combined_score": 767 }, { "protein2": "8022.A0A060XPX7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 236, "combined_score": 726 }, { "protein2": "8022.A0A060YRF1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 630, "experimental": 0, "database": 289, "textmining": 507, "combined_score": 858 }, { "protein2": "8022.A0A060XUA7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 333, "database": 507, "textmining": 279, "combined_score": 748 }, { "protein2": "8022.A0A060Z4Q6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 273, "database": 419, "textmining": 504, "combined_score": 775 }, { "protein2": "8022.A0A060WMR1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 686, "database": 787, "textmining": 389, "combined_score": 955 }, { "protein2": "8022.A0A060X3S2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 73, "experimental": 265, "database": 327, "textmining": 507, "combined_score": 743 }, { "protein2": "8022.A0A060X035", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 830, "textmining": 367, "combined_score": 899 }, { "protein2": "8022.A0A060YIA4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 760, "textmining": 236, "combined_score": 828 }, { "protein2": "8022.A0A060YTR0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 167, "database": 573, "textmining": 423, "combined_score": 780 }, { "protein2": "8022.A0A060YCT9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 393, "combined_score": 782 }, { "protein2": "8022.A0A060YF61", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 273, "database": 650, "textmining": 46, "combined_score": 740 }, { "protein2": "8022.A0A060WBT7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 853, "database": 910, "textmining": 450, "combined_score": 992 }, { "protein2": "8022.Q8QFQ0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 215, "experimental": 0, "database": 572, "textmining": 437, "combined_score": 794 }, { "protein2": "8022.A0A060XD94", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060XFH8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 200, "combined_score": 744 }, { "protein2": "8022.C1BEY3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 827, "textmining": 450, "combined_score": 908 }, { "protein2": "8022.A0A060Y043", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 189, "combined_score": 710 }, { "protein2": "8022.A0A060X063", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 450, "combined_score": 803 }, { "protein2": "8022.A0A060XGI5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 0, "database": 910, "textmining": 269, "combined_score": 933 }, { "protein2": "8022.A0A060VZ13", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 74, "experimental": 0, "database": 910, "textmining": 452, "combined_score": 950 }, { "protein2": "8022.A0A060WGW1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 215, "experimental": 0, "database": 572, "textmining": 437, "combined_score": 794 }, { "protein2": "8022.A0A060Z3R0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 0, "database": 834, "textmining": 275, "combined_score": 878 }, { "protein2": "8022.A0A060ZDV9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060XZ47", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 0, "database": 910, "textmining": 269, "combined_score": 933 }, { "protein2": "8022.A0A060X8T7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 273, "database": 650, "textmining": 46, "combined_score": 740 }, { "protein2": "8022.A0A060X8C6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 236, "combined_score": 726 }, { "protein2": "8022.A0A060VNB2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 827, "textmining": 450, "combined_score": 908 }, { "protein2": "8022.A0A060YV84", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 145, "experimental": 612, "database": 862, "textmining": 483, "combined_score": 973 }, { "protein2": "8022.A0A060WTK5", "neighborhood": 0, "fusion": 0, "cooccurence": 53, "coexpression": 0, "experimental": 0, "database": 910, "textmining": 0, "combined_score": 911 }, { "protein2": "8022.A0A060Y8G1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060Z6D6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 50, "database": 743, "textmining": 109, "combined_score": 763 }, { "protein2": "8022.A0A060Z6R5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 372, "database": 533, "textmining": 451, "combined_score": 840 }, { "protein2": "8022.A0A060YHN1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 333, "database": 507, "textmining": 332, "combined_score": 767 }, { "protein2": "8022.A0A060WD93", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 953, "database": 835, "textmining": 507, "combined_score": 995 }, { "protein2": "8022.A0A060XHF7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 236, "combined_score": 726 }, { "protein2": "8022.A0A061AEF4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 0, "database": 830, "textmining": 275, "combined_score": 875 }, { "protein2": "8022.A0A060ZGH4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 273, "database": 419, "textmining": 504, "combined_score": 775 }, { "protein2": "8022.A0A060XF80", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 189, "combined_score": 710 }, { "protein2": "8022.A0A061ACZ0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 273, "database": 650, "textmining": 46, "combined_score": 740 }, { "protein2": "8022.A0A060XAE5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060YTI8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 0, "database": 607, "textmining": 345, "combined_score": 739 }, { "protein2": "8022.A0A060W114", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 273, "database": 650, "textmining": 46, "combined_score": 740 }, { "protein2": "8022.A0A060VZJ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 0, "database": 760, "textmining": 218, "combined_score": 808 }, { "protein2": "8022.A0A060W995", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060WD54", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060WU24", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 215, "experimental": 0, "database": 572, "textmining": 437, "combined_score": 794 }, { "protein2": "8022.A0A060YVB1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060X986", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 450, "combined_score": 803 }, { "protein2": "8022.A0A060WL45", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 500, "experimental": 0, "database": 0, "textmining": 443, "combined_score": 709 }, { "protein2": "8022.A0A060Y6M5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060YFH5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 167, "database": 573, "textmining": 423, "combined_score": 780 }, { "protein2": "8022.A0A060X3H8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060XIE4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 155, "database": 492, "textmining": 508, "combined_score": 774 }, { "protein2": "8022.A0A060W3D8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 180, "combined_score": 738 }, { "protein2": "8022.A0A060VUM0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 921, "database": 0, "textmining": 442, "combined_score": 954 }, { "protein2": "8022.A0A060XTS9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 0, "database": 824, "textmining": 269, "combined_score": 869 }, { "protein2": "8022.A0A060Z424", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 74, "experimental": 0, "database": 670, "textmining": 191, "combined_score": 731 }, { "protein2": "8022.A0A060W518", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060YRT0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 183, "combined_score": 707 }, { "protein2": "8022.A0A060XMR6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060YUC8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060VVA1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 0, "database": 824, "textmining": 269, "combined_score": 869 }, { "protein2": "8022.A0A060YIQ8", "neighborhood": 0, "fusion": 0, "cooccurence": 173, "coexpression": 58, "experimental": 0, "database": 862, "textmining": 450, "combined_score": 933 }, { "protein2": "8022.A0A060W037", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.Q1G669", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 415, "experimental": 0, "database": 272, "textmining": 505, "combined_score": 770 }, { "protein2": "8022.A0A060WUH7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060YG76", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060Y952", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 233, "combined_score": 755 }, { "protein2": "8022.A0A060WC91", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A061A315", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 686, "database": 787, "textmining": 389, "combined_score": 955 }, { "protein2": "8022.A0A060X3D3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 333, "database": 507, "textmining": 332, "combined_score": 767 }, { "protein2": "8022.A0A060XFJ7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 0, "database": 760, "textmining": 218, "combined_score": 808 }, { "protein2": "8022.A0A060XPX2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 145, "experimental": 612, "database": 862, "textmining": 483, "combined_score": 973 }, { "protein2": "8022.A0A060WRJ1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060W2H2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 236, "combined_score": 726 }, { "protein2": "8022.A0A060ZEP6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 116, "database": 829, "textmining": 88, "combined_score": 854 }, { "protein2": "8022.A0A060WH57", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 74, "experimental": 0, "database": 670, "textmining": 191, "combined_score": 731 }, { "protein2": "8022.A0A060XQ00", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060XR03", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 236, "combined_score": 726 }, { "protein2": "8022.A0A060Y7T2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060W128", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 180, "combined_score": 738 }, { "protein2": "8022.A0A060WVY3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 853, "database": 910, "textmining": 450, "combined_score": 992 }, { "protein2": "8022.A0A060YUZ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060WT74", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 69, "experimental": 0, "database": 607, "textmining": 345, "combined_score": 739 }, { "protein2": "8022.A0A060Z7Q9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 273, "database": 618, "textmining": 44, "combined_score": 715 }, { "protein2": "8022.A0A060YYT8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 50, "database": 743, "textmining": 109, "combined_score": 763 }, { "protein2": "8022.A0A060XA36", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 140, "experimental": 535, "database": 828, "textmining": 440, "combined_score": 956 }, { "protein2": "8022.C1BI02", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 114, "experimental": 0, "database": 827, "textmining": 450, "combined_score": 908 }, { "protein2": "8022.A0A060VTL5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 760, "textmining": 236, "combined_score": 828 }, { "protein2": "8022.A0A060W4P9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 75, "experimental": 937, "database": 910, "textmining": 507, "combined_score": 997 }, { "protein2": "8022.A0A060XXD6", "neighborhood": 0, "fusion": 0, "cooccurence": 149, "coexpression": 58, "experimental": 0, "database": 862, "textmining": 450, "combined_score": 931 }, { "protein2": "8022.A0A060WA83", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 55, "experimental": 155, "database": 492, "textmining": 505, "combined_score": 772 }, { "protein2": "8022.A0A060VT18", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 314, "database": 824, "textmining": 87, "combined_score": 882 }, { "protein2": "8022.A0A060W2M3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060WSV1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 0, "database": 760, "textmining": 218, "combined_score": 808 }, { "protein2": "8022.A0A060XB50", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060X9U8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 314, "database": 824, "textmining": 87, "combined_score": 882 }, { "protein2": "8022.A0A060Z1J2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 57, "experimental": 167, "database": 573, "textmining": 423, "combined_score": 780 }, { "protein2": "8022.A0A060XLZ6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 67, "experimental": 333, "database": 507, "textmining": 332, "combined_score": 767 }, { "protein2": "8022.A0A060W766", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 500, "experimental": 0, "database": 0, "textmining": 443, "combined_score": 709 }, { "protein2": "8022.A0A060WMZ6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 686, "database": 787, "textmining": 389, "combined_score": 955 }, { "protein2": "8022.A0A060ZZG4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 49, "experimental": 686, "database": 787, "textmining": 389, "combined_score": 955 }, { "protein2": "8022.A0A060XKG4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 333, "database": 507, "textmining": 279, "combined_score": 748 }, { "protein2": "8022.A0A060YGA1", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 215, "experimental": 0, "database": 572, "textmining": 437, "combined_score": 794 }, { "protein2": "8022.A0A060XG27", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 372, "database": 533, "textmining": 271, "combined_score": 776 }, { "protein2": "8022.A0A060XIZ5", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060YBG9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 74, "experimental": 0, "database": 910, "textmining": 452, "combined_score": 950 }, { "protein2": "8022.A0A060YSX0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 102, "experimental": 0, "database": 826, "textmining": 404, "combined_score": 898 }, { "protein2": "8022.A0A060VYB4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 66, "experimental": 116, "database": 829, "textmining": 88, "combined_score": 854 }, { "protein2": "8022.A0A060XW82", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 0, "database": 910, "textmining": 218, "combined_score": 928 }, { "protein2": "8022.A0A060XVY3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 124, "experimental": 372, "database": 533, "textmining": 451, "combined_score": 840 }, { "protein2": "8022.W0TYL2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 145, "experimental": 612, "database": 827, "textmining": 483, "combined_score": 966 }, { "protein2": "8022.A0A060WQB0", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 500, "experimental": 0, "database": 0, "textmining": 443, "combined_score": 709 }, { "protein2": "8022.A0A060X1J2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 74, "experimental": 0, "database": 670, "textmining": 191, "combined_score": 731 }, { "protein2": "8022.A0A060X7P8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 273, "database": 650, "textmining": 46, "combined_score": 740 }, { "protein2": "8022.A0A060Z4I6", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060W2H8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 828, "textmining": 130, "combined_score": 843 }, { "protein2": "8022.A0A060WPH7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 314, "database": 824, "textmining": 87, "combined_score": 882 }, { "protein2": "8022.A0A060YNP8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 74, "experimental": 0, "database": 699, "textmining": 507, "combined_score": 850 }, { "protein2": "8022.A0A060XPJ8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 180, "combined_score": 738 }, { "protein2": "8022.A0A060X8V7", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 58, "experimental": 155, "database": 492, "textmining": 508, "combined_score": 774 }, { "protein2": "8022.A0A060YQ81", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 333, "database": 507, "textmining": 189, "combined_score": 710 }, { "protein2": "8022.A0A060W820", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 180, "combined_score": 738 }, { "protein2": "8022.A0A060VNW8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060VY72", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 139, "experimental": 0, "database": 826, "textmining": 367, "combined_score": 896 }, { "protein2": "8022.A0A060WJ39", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 74, "experimental": 0, "database": 670, "textmining": 191, "combined_score": 731 }, { "protein2": "8022.A0A060X285", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060Y084", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 273, "database": 650, "textmining": 46, "combined_score": 740 }, { "protein2": "8022.A0A060XRW9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060W9P9", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060YKY4", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 79, "experimental": 372, "database": 533, "textmining": 271, "combined_score": 776 }, { "protein2": "8022.A0A060WPR8", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 0, "database": 910, "textmining": 218, "combined_score": 928 }, { "protein2": "8022.A0A060YHB3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 372, "database": 533, "textmining": 83, "combined_score": 707 }, { "protein2": "8022.A0A060WBI2", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 0, "database": 760, "textmining": 218, "combined_score": 808 }, { "protein2": "8022.A0A060Y558", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 56, "experimental": 314, "database": 824, "textmining": 87, "combined_score": 882 }, { "protein2": "8022.A0A060YAX3", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 65, "experimental": 0, "database": 827, "textmining": 269, "combined_score": 871 } ]
A0A068PF27
Progonadoliberin [Cleaved into: Gonadoliberin (Gonadotropin-releasing hormone) (GnRH) (Luliberin) (Luteinizing hormone-releasing hormone) (LH-RH); GnRH-associated peptide (GnRH-associated peptide)]
Stimulates the secretion of gonadotropins. {ECO:0000256|RuleBase:RU000635}.
Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
43
Secreted {ECO:0000256|ARBA:ARBA00004613, ECO:0000256|RuleBase:RU000635}.
LAQHWSYGLQPGGKRNAENLVESFQEIANEMENLREVKEAECP
[ "GO:1904014", "GO:0050896", "GO:1901698", "GO:0010033", "GO:1901700", "GO:0043279", "GO:0008150", "GO:0042221", "GO:0014070", "GO:0010243", "GO:0071867", "GO:0043204", "GO:0043025", "GO:0043005", "GO:0110165", "GO:0030424", "GO:0036477", "GO:0042995", "GO:0005575", "GO:0120025", "GO:0044297" ]
[ "GO:0008150", "GO:0050896", "GO:0042221", "GO:1901698", "GO:0010033", "GO:1901700", "GO:1904014", "GO:0014070", "GO:0010243", "GO:0043279", "GO:0071867" ]
null
[ "GO:0005575", "GO:0110165", "GO:0043204", "GO:0036477", "GO:0042995", "GO:0044297", "GO:0043025", "GO:0120025", "GO:0043005", "GO:0030424" ]
[ "IPR002012", "IPR019792", "IPR004079" ]
af_db/AF-A0A068PF27-F1-model_v4.cif.gz
null
null
null
A0A023PXP4
Putative uncharacterized protein YLR235C
null
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
132
null
MLIGAPSNMRLRGALELLWRRLLHGLMQLRLVLKMHICSQLNHAIKRRAFLKTKGGKNALHGCLDTVINLQESILAGIRLVPVLPILLDYVLYNISLGGMTFADFLEVLLHFSALEGLCKGVFEADGLEAVH
[ "GO:0033554", "GO:0051716", "GO:0050896", "GO:0006950", "GO:0006974", "GO:0009987", "GO:0008150" ]
[ "GO:0008150", "GO:0050896", "GO:0009987", "GO:0051716", "GO:0006950", "GO:0033554", "GO:0006974" ]
null
null
null
af_db/AF-A0A023PXP4-F1-model_v4.cif.gz
4932.YLR235C
[ "4932.YLR234W", "4932.YLR236C" ]
[ { "protein2": "4932.YLR234W", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 88, "experimental": 0, "database": 0, "textmining": 691, "combined_score": 706 }, { "protein2": "4932.YLR236C", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 96, "experimental": 0, "database": 0, "textmining": 831, "combined_score": 840 } ]
A0A023GPJ3
Chronophage, isoform J
null
Drosophila melanogaster (Fruit fly)
1,140
Nucleus {ECO:0000256|ARBA:ARBA00004123}.
MDRDAEEGRPLSLVNRRPSISAPISGRKSAPASAAAAVAAAAAAAAAAAAASSTASGSRIHTPPPSPADLLADGASSTPKRLVDENDNTTPKDSETGATTLDSNAAPSSPAAIERQSSGDSSCEMEEQQDRQDKQSQPKQAKVKQEPYDEEGVNHHQNQDDDDDEEMEERSLAKRPKMELVDAEANTVHTEPSNYTCSTCKTRYTSAWRLIQHVQHSHGVKIYVESPGGGATLTVATPAALNNSALALAAAAAAASASGLASPQPAVSPNPAVTSSAKRSSPLGAAGSTILSTSVSSTCSNSLVNTSGGSISNTSSIGSPQQQQLQLQQQQAQQQQQRVQQQQRENLASAMAAGMRHHPLLPPPEAMHANPFQLLRMPLPPALAQAGNVVPTVAPLFGRPSPADHYRMEQLVSEQFRHHGFNLAAAAAAAQAQFNANGQVVGGVVSGSGEPRPPSSSSSGSQRGSVPPAALPPPSLSSQQQQQQQQAVQQQQQQGAQQQLQSAQQQQQSQQQSQQQQQITPGLVGGAGGSLKLEPQQMDFYSQRLRQLAGTTSPGAGSTVNSSSPSPRQKQSPHFASPSPSQQQQQQLATIPRPHSLTPPEKLGDASSENGSLGLILASTPRSASTPPSKTGDVSLQEPIAHCYSCSYCDKKFRFENNLIIHQRTHTGEKPYKCTACDFECSHIQKLMKHMRVHRSPADDQDNQDNQDDGSNADSLETNEADNDEDPNPDESEEELGDGDNDPDGDGDLDGEDEDEDELEECEDMDYKAEDLSVSNRIDGKSQSPKTTSSGATSLVGELMDKFGLSNIAQYSEAYKQALQESGRKEAAAAAAAAAAAADNNNRGGAGAPLSDKLNGLPVAALRLRDEFAKNCNMFQQPQDGGAPSQVPLFNPFPNPFELSKRMKMDGGDWWGMSQALHRNEALFENLKLKPLGLGGANSLIQGPLLKKESRQRNDTCEFCGKVFKNCSNLTVHRRSHTGEKPYKCELCSYACAQSSKLTRHMKTHGRTGKDVYRCRFCDMPFSVPSTLEKHMRKCVVNQGKAAAAANAVAAAQAAQAAAQHIQAAAQQAQAVQAQAVQAQAAQQSQQQQQQLSPMGVVGYPPQFVSGHNLSLPGSVSGDNDSNASSSMTGVHPISLKEEA
[ "GO:0046888", "GO:0065008", "GO:0023051", "GO:0065007", "GO:0002792", "GO:0010648", "GO:0023057", "GO:1903530", "GO:0051046", "GO:0051049", "GO:0051051", "GO:0008150", "GO:0090276", "GO:0002791", "GO:0010817", "GO:0090087", "GO:0050789", "GO:0010646", "GO:0048523", "GO:0048519", "GO:0090278", "GO:0032879", "GO:0051048", "GO:1903531", "GO:0046883", "GO:0050794", "GO:0005737", "GO:0005829", "GO:0005575", "GO:0005622", "GO:0110165" ]
[ "GO:0008150", "GO:0065007", "GO:0050789", "GO:0048519", "GO:0065008", "GO:0023051", "GO:0023057", "GO:0051051", "GO:0048523", "GO:0032879", "GO:0050794", "GO:0046888", "GO:0010648", "GO:1903530", "GO:0051049", "GO:0010817", "GO:0010646", "GO:0051048", "GO:1903531", "GO:0046883", "GO:0002792", "GO:0051046", "GO:0090276", "GO:0090087", "GO:0090278", "GO:0002791" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005737", "GO:0005829", "GO:0005622" ]
[ "IPR051497", "IPR036236", "IPR013087" ]
af_db/AF-A0A023GPJ3-F1-model_v4.cif.gz
null
null
null
A0A096MIW4
Serpin family C member 1
null
Rattus norvegicus (Rat)
123
null
MEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSNLVSANRLFGDKSLTFNESYQDVSEIVYGAKLQPLDFKENPEQSRVTINNWVANKTEGRIKDVIPQGAIDELTALVLVNTIYFKGIM
[ "GO:0006952", "GO:0048732", "GO:0051234", "GO:0009605", "GO:0009991", "GO:0032502", "GO:0002376", "GO:0030879", "GO:0002526", "GO:0065008", "GO:0048856", "GO:0065007", "GO:0046903", "GO:0051179", "GO:0002437", "GO:0006950", "GO:0050878", "GO:0008150", "GO:0042221", "GO:0006954", "GO:0007589", "GO:0007584", "GO:0002438", "GO:0050896", "GO:0031667", "GO:0006955", "GO:0007595", "GO:0006810", "GO:0048513", "GO:0110165", "GO:0005575", "GO:0005576", "GO:0005615", "GO:0030234", "GO:0098772", "GO:0005488", "GO:0061135", "GO:1901681", "GO:0030414", "GO:0008201", "GO:0061134", "GO:0004866", "GO:0004867", "GO:0004857", "GO:0003674", "GO:0097367", "GO:0005515", "GO:0005539", "GO:0140678" ]
[ "GO:0008150", "GO:0032502", "GO:0002376", "GO:0065007", "GO:0051179", "GO:0050896", "GO:0051234", "GO:0009605", "GO:0065008", "GO:0048856", "GO:0006950", "GO:0042221", "GO:0006955", "GO:0006952", "GO:0009991", "GO:0002437", "GO:0050878", "GO:0007584", "GO:0006810", "GO:0048513", "GO:0048732", "GO:0046903", "GO:0006954", "GO:0007589", "GO:0002438", "GO:0031667", "GO:0030879", "GO:0002526", "GO:0007595" ]
[ "GO:0003674", "GO:0098772", "GO:0005488", "GO:0030234", "GO:1901681", "GO:0097367", "GO:0005515", "GO:0140678", "GO:0008201", "GO:0061134", "GO:0004857", "GO:0005539", "GO:0061135", "GO:0030414", "GO:0004866", "GO:0004867" ]
[ "GO:0005575", "GO:0110165", "GO:0005576", "GO:0005615" ]
[ "IPR023796", "IPR000215", "IPR036186", "IPR042178" ]
null
null
null
null
A0A096MJR8
ADP-ribosylation factor like GTPase 13B
null
Rattus norvegicus (Rat)
401
null
RQNGRNEGDNVRSAKTPSDIRKAYIGKRYLNEKVPEVLHLVLQIHKFLVSLFNLRELCFSHAGLWTRTRLLLSQQPYGSSKPYVTSVPGDRCPLLVFVGTGLANKQDKEGALGEADVIECLSLEKLVNEHKCLCQIEPCSAVLGYGKKIDKSIKKGLYWLLHIIAKDFDALSERIQKDTTEQRALEEQEKCERAERVRKLREEREQEQTELDGTSGLAEMDSGPVLTNPFQPIAAVIIENEKKQEKEKKKKTAEKDSDVGHPEHKGEQEGAESQNEAGGCLRNPHRDVVNSYKEALSQQLDNEDELDQRVSEPGDNSKKKTKKLRMKRSHRVEPVNTDESAPKSPTPPPPPPPVGWGTPKVTRLPKLEPLGETRHNDFYGKPLPPLAVRQRPNGDAQDMIS
[ "GO:0010038", "GO:0050896", "GO:1901700", "GO:0010035", "GO:0042221", "GO:1902074", "GO:0008150", "GO:0010226" ]
[ "GO:0008150", "GO:0050896", "GO:0042221", "GO:1901700", "GO:0010035", "GO:1902074", "GO:0010038", "GO:0010226" ]
null
null
[ "IPR051995", "IPR027417" ]
null
null
null
null
A0A0A6YVS5
Protocadherin gamma subfamily C, 4
null
Mus musculus (Mouse)
131
null
MAAMPSTQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
[ "GO:0050808", "GO:0009987", "GO:0016043", "GO:0065007", "GO:0071840", "GO:1901214", "GO:1901215", "GO:0043066", "GO:0042981", "GO:0008150", "GO:0060548", "GO:0043524", "GO:0010941", "GO:0050789", "GO:0034330", "GO:0043523", "GO:0043069", "GO:0048523", "GO:0043067", "GO:0048519", "GO:0050794", "GO:0110165", "GO:0005575", "GO:0016020" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0050789", "GO:0048519", "GO:0071840", "GO:0048523", "GO:0050794", "GO:0016043", "GO:0060548", "GO:0010941", "GO:1901214", "GO:1901215", "GO:0034330", "GO:0043069", "GO:0043067", "GO:0050808", "GO:0043066", "GO:0042981", "GO:0043524", "GO:0043523" ]
null
[ "GO:0005575", "GO:0110165", "GO:0016020" ]
[ "IPR031904" ]
af_db/AF-A0A0A6YVS5-F1-model_v4.cif.gz
null
null
null
A0A0B4KED6
Defective proboscis extension response 12, isoform D
null
Drosophila melanogaster (Fruit fly)
321
null
MPMVPPRLLLRLRRPLHLMELRILLLCLPTLLLATTLEPDQKSILTDNDWKKLWMRGGINGDSKLDNNLDSSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLNTVVVRHIFLT
[ "GO:0008037", "GO:0050808", "GO:0032502", "GO:0048869", "GO:0008039", "GO:0009987", "GO:0048856", "GO:0022008", "GO:0016043", "GO:0071840", "GO:0007275", "GO:0008038", "GO:0008150", "GO:0007399", "GO:0048468", "GO:0034330", "GO:0030154", "GO:0030182", "GO:0032501", "GO:0048731", "GO:0048666", "GO:0048699" ]
[ "GO:0008150", "GO:0032502", "GO:0009987", "GO:0032501", "GO:0008037", "GO:0048869", "GO:0048856", "GO:0071840", "GO:0007275", "GO:0016043", "GO:0008038", "GO:0048468", "GO:0030154", "GO:0048731", "GO:0008039", "GO:0022008", "GO:0007399", "GO:0034330", "GO:0030182", "GO:0048666", "GO:0050808", "GO:0048699" ]
null
null
[ "IPR007110", "IPR036179", "IPR013783", "IPR013098", "IPR003599", "IPR003598", "IPR037448" ]
af_db/AF-A0A0B4KED6-F1-model_v4.cif.gz
null
null
null
A0A0B4KEJ7
Coronin
null
Drosophila melanogaster (Fruit fly)
535
null
MSFRVVRSSKFRHVYGQALKREQCYDNIRVSKSSWDSTFCAVNPKFLAIIVESAGGGAFIVLPHNKVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPDGGLSRTLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSHPDIVYSACFNWDGSKLVTTCKDKKIRIYDPRTAELESEAMCHEGSKATRAIFLRHGLIFTTGFNRSSERQYSLRAPDALNEPIVMVELDTSNGVMFPLYDADTNMIYLCGKGDSVIRYFEVTPEPPFVHYINTFQTTEPQRGIGLMPKRGCDVTTCEVAKFYRMNNNGLCQVISMTVPRKSDLFQEDLYPDTLAEDAAITAEEWIDGKDADPITFSLKDRVSIVQGGYVSSSVNKSLPAKKAGNILNKPRGDSASSGATSSSAGGGNFASGNNNEASEGGPPAAVLSEKDLRTIQDEIRKLKAIIVKQENRIRALEAKEDARNKNGSDAAPASAGAATSDGKASESANDHASTSAGTSKDED
[ "GO:0006952", "GO:0009605", "GO:0032502", "GO:0048856", "GO:0061061", "GO:0006950", "GO:0008150", "GO:0043207", "GO:0050896", "GO:0007527", "GO:0007525", "GO:0051707", "GO:0009620", "GO:0050832", "GO:0009607", "GO:0098542", "GO:0044419" ]
[ "GO:0008150", "GO:0032502", "GO:0050896", "GO:0044419", "GO:0009605", "GO:0048856", "GO:0006950", "GO:0051707", "GO:0009607", "GO:0006952", "GO:0061061", "GO:0043207", "GO:0009620", "GO:0098542", "GO:0007525", "GO:0050832", "GO:0007527" ]
null
null
[ "IPR015505", "IPR015048", "IPR015943", "IPR019775", "IPR001680" ]
af_db/AF-A0A0B4KEJ7-F1-model_v4.cif.gz
7227.FBpp0307639
[ "7227.FBpp0081260", "7227.FBpp0079746", "7227.FBpp0302793", "7227.FBpp0088450", "7227.FBpp0084124", "7227.FBpp0301603", "7227.FBpp0083898" ]
[ { "protein2": "7227.FBpp0081260", "neighborhood": 141, "fusion": 0, "cooccurence": 0, "coexpression": 184, "experimental": 0, "database": 0, "textmining": 650, "combined_score": 733 }, { "protein2": "7227.FBpp0079746", "neighborhood": 131, "fusion": 877, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 0, "textmining": 0, "combined_score": 889 }, { "protein2": "7227.FBpp0302793", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 119, "experimental": 726, "database": 0, "textmining": 530, "combined_score": 876 }, { "protein2": "7227.FBpp0088450", "neighborhood": 233, "fusion": 0, "cooccurence": 0, "coexpression": 97, "experimental": 0, "database": 0, "textmining": 619, "combined_score": 713 }, { "protein2": "7227.FBpp0084124", "neighborhood": 141, "fusion": 0, "cooccurence": 0, "coexpression": 236, "experimental": 0, "database": 0, "textmining": 587, "combined_score": 705 }, { "protein2": "7227.FBpp0301603", "neighborhood": 417, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 0, "textmining": 625, "combined_score": 772 }, { "protein2": "7227.FBpp0083898", "neighborhood": 187, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 0, "textmining": 662, "combined_score": 713 } ]
A0A075BR52
Draculin-like 3 (Draculin-like, tandem duplicate 3)
null
Danio rerio (Zebrafish) (Brachydanio rerio)
631
Nucleus {ECO:0000256|ARBA:ARBA00004123}.
MEIEDSENMKDTTEPCRTEHCDDTEGQRDHMEGNKEGETEAKKSVACFHCKKRFTCKAHLQVHMRVHNKKKQKDRKATAEKLHTCDKSGKSFAYKSSLKKHMINHSGEKKHTCDQCGKSFPFKVYLEQHMLIHTGETLHECDQCGKSFRSKGEVKIHMLIHTGEKPHKCDQCGKSFRSKGEVKIHMLIHTGEKPHECDQCGKSFRSKGEVKIHMLIHTRKKPHECDQCGKSFRSKGEVKQHMSIHTGLKPYKCEECGKFFAQKNNLQVHMKVHTGEKPYRCDQCGKCFPYKQSLKLHLEIHAKGNPYTCDECGKSFKTCLQFRSHMTLHPEYKPYKCDQCEKSYGREDHLQRHMKYHTGEKPHKCEHCGKSFQMRDLLRSHLMVHREVKPYTCDQCGKGFTLKKCYNEHMNIHTGERPYTCDQCGKGFPYEQSLNLHMRFHRGEKPFTCDQCGQSFSQKGAYNIHMKIHTGEKPYTCDQCGMSFRHGSSLKLHMTHHTGEKPFHCDQCDKCYSTALFLKNHMKTHNKDQIYSCLTCGKTFNLLGCLRMHEKRHTLVKPFMCFDCGKCYFTDTELKQHLSVHSNERPYMCSLCFKSFSRMDSLKKHEKTHNRKIQNHHHDEGEHDQTSLLKG
[ "GO:0032502", "GO:0030097", "GO:0048468", "GO:0009790", "GO:0048856", "GO:0035162", "GO:0048869", "GO:0030154", "GO:0009987", "GO:0007275", "GO:0060215", "GO:0032501", "GO:0048568", "GO:0048513", "GO:0008150" ]
[ "GO:0008150", "GO:0032502", "GO:0009987", "GO:0032501", "GO:0048856", "GO:0048869", "GO:0007275", "GO:0048468", "GO:0009790", "GO:0030154", "GO:0048513", "GO:0030097", "GO:0048568", "GO:0035162", "GO:0060215" ]
null
null
[ "IPR050752", "IPR036236", "IPR013087" ]
af_db/AF-A0A075BR52-F1-model_v4.cif.gz
null
null
null
A0A0A0MQJ7
CDKN1A interacting zinc finger protein 1
null
Mus musculus (Mouse)
194
null
MFNPQLQQQQQLQQQQQQLQQQLQQQQLQQQQQQILQLQQLLQQSPPQASLSIPVSRGLPQQSSPQQLLSLQGLHSTSLLNGPMLQRALLLQQLQGLDQFAMPPATYDGASLTMPTATLGNLRAFNVTAPSLAAPSLTPPQMVTPNLQQFFPQATRQSLLGPPPVGVPINPSQLNHSGRNTQKQARTPSSTTPN
[ "GO:0090329", "GO:0051641", "GO:0045935", "GO:0065007", "GO:0034504", "GO:0051179", "GO:0051651", "GO:0033365", "GO:0048518", "GO:0008150", "GO:0032298", "GO:2000105", "GO:0010604", "GO:0048522", "GO:0051052", "GO:0050789", "GO:0031325", "GO:0019222", "GO:0051054", "GO:0006275", "GO:0051457", "GO:0051235", "GO:0050794", "GO:0032507", "GO:0051171", "GO:0009893", "GO:0072595", "GO:0070727", "GO:0060255", "GO:0030174", "GO:0009987", "GO:0031323", "GO:0019219", "GO:0045740", "GO:0080090", "GO:0008104", "GO:0045185", "GO:0033036", "GO:0051173", "GO:0005622", "GO:0043229", "GO:0043226", "GO:0110165", "GO:0005575", "GO:0043227", "GO:0005634", "GO:0043231", "GO:0030332", "GO:0005515", "GO:0005488", "GO:0003674" ]
[ "GO:0008150", "GO:0065007", "GO:0051179", "GO:0048518", "GO:0050789", "GO:0009987", "GO:0051641", "GO:0051651", "GO:0048522", "GO:0019222", "GO:0051235", "GO:0050794", "GO:0009893", "GO:0033036", "GO:0010604", "GO:0031325", "GO:0032507", "GO:0051171", "GO:0070727", "GO:0060255", "GO:0031323", "GO:0080090", "GO:0045185", "GO:0051173", "GO:0045935", "GO:0051052", "GO:0051054", "GO:0072595", "GO:0019219", "GO:0008104", "GO:0033365", "GO:0006275", "GO:0051457", "GO:0045740", "GO:0090329", "GO:0034504", "GO:0032298", "GO:2000105", "GO:0030174" ]
[ "GO:0003674", "GO:0005488", "GO:0005515", "GO:0030332" ]
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0043229", "GO:0043227", "GO:0043231", "GO:0005634" ]
[ "IPR026811" ]
af_db/AF-A0A0A0MQJ7-F1-model_v4.cif.gz
null
null
null
A0A0A6YVQ0
CDKN1A interacting zinc finger protein 1
null
Mus musculus (Mouse)
57
null
MFNPQLQQQQQLQQQQQQLQQQLQQQQLQQQQQQILQLQQLLQQSPPQASLSIPVSR
[ "GO:0090329", "GO:0051641", "GO:0045935", "GO:0065007", "GO:0034504", "GO:0051179", "GO:0051651", "GO:0033365", "GO:0048518", "GO:0008150", "GO:0032298", "GO:2000105", "GO:0010604", "GO:0048522", "GO:0051052", "GO:0050789", "GO:0031325", "GO:0019222", "GO:0051054", "GO:0006275", "GO:0051457", "GO:0051235", "GO:0050794", "GO:0032507", "GO:0051171", "GO:0009893", "GO:0072595", "GO:0070727", "GO:0060255", "GO:0030174", "GO:0009987", "GO:0031323", "GO:0019219", "GO:0045740", "GO:0080090", "GO:0008104", "GO:0045185", "GO:0033036", "GO:0051173", "GO:0005622", "GO:0043229", "GO:0043226", "GO:0110165", "GO:0005575", "GO:0043227", "GO:0005634", "GO:0043231", "GO:0030332", "GO:0005515", "GO:0005488", "GO:0003674" ]
[ "GO:0008150", "GO:0065007", "GO:0051179", "GO:0048518", "GO:0050789", "GO:0009987", "GO:0051641", "GO:0051651", "GO:0048522", "GO:0019222", "GO:0051235", "GO:0050794", "GO:0009893", "GO:0033036", "GO:0010604", "GO:0031325", "GO:0032507", "GO:0051171", "GO:0070727", "GO:0060255", "GO:0031323", "GO:0080090", "GO:0045185", "GO:0051173", "GO:0045935", "GO:0051052", "GO:0051054", "GO:0072595", "GO:0019219", "GO:0008104", "GO:0033365", "GO:0006275", "GO:0051457", "GO:0045740", "GO:0090329", "GO:0034504", "GO:0032298", "GO:2000105", "GO:0030174" ]
[ "GO:0003674", "GO:0005488", "GO:0005515", "GO:0030332" ]
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0043229", "GO:0043227", "GO:0043231", "GO:0005634" ]
null
af_db/AF-A0A0A6YVQ0-F1-model_v4.cif.gz
null
null
null
A0A0A6YW72
Dachsous cadherin related 2
null
Mus musculus (Mouse)
3,346
Cell membrane {ECO:0000256|ARBA:ARBA00004251}; Single-pass type I membrane protein {ECO:0000256|ARBA:ARBA00004251}.
MSPAGRRMGEGRQPAGSPRGRPRGAGAQSSLLRLFVHAWLWAASGSSAQVFNLSLSVDEGLPPDTLVGDIRAGLPAAQQQDGNGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERQDHYSFVAATLLGEVVQVEIRVNDVNDHSPRFPRDSLQLDVSELSPPGTAFRLPGAQDPDAGLFSIQGYTLLQASDMPQDPTGPFFQLRYGTPGLPASPSLPVSSSPLEPLDLVLLRRLDREAAAAHELHIEAWDGGSPRRTGLLHVQLRVLDENDNPPVFEQGEYRATVREDAQPGSEVCRVRATDRDLGPNGLVRYSIRERQVPVASAGGGPLGDPGYFSVEELSGVVRVQRPLDREEQAWHQLVVQARDGGAEPEVATVRVSIDVLDVNDNPPAIHLLFLTEGGAVQVSEGAHPGDYVARVSVSDADGDPEKEEEAAGVLGARLLGAGSIKLSLESGNGVFALRPGGPPGVFFLCIEGLLDRESQDLYELRLVATDAGSPPLSTEESLLLWVSDLNDQPPVFSQEHYWASVSEAAVPGTSVVWVSALDADQAGTDHAKLRYELVQLSDPCQSEALSPEEECVPSFSINPDNGLISTIRALDREVQETVELRVVAQDLGEPPLSATCLVTITVDDVNDNEPVFRRQVYNVTLAEHAAVGHCFLQVKASDADAGLYGLVKYSLYDGFQSYEAPPAFQIDPQDGRICVSQDIDRERDPGTFDLLVKAKDGGGLSAQAFVRVEVDDVNDNYPVFTPSTYVTSISGQTPPGTEIINVLASDRDSGIYGTVAYELIPGDQSSLFTIDSTTGIIYLTSTLSHLEATTIFLMVCARDGGGLTAATNADVTIHIMQTTLAPAEFERPKYTFSVYEDVPEDTLVGTVKARESLNSSEPITYRISSGDPEGKFSIHRWLGSIRTLKPLDHEAQPMVVLTVQAQLGSSPACSSTEVNITVMDVNDNRPEFPTASDEIRISQTTPPGTALYLARAQDRDSGLNGLVRYSIASPQPSEFSMDQGRGVLYLRESLGSKADFRLILVAKDQGVPPQVSQLVLTVVIESQERIPAVAFENLVYQVEVSESLPLTTQILQVQAYPLYPWRPTSKTFYSLDVSVDSAVFGIHPHTGWIYLRRQLDYEFTQTYKFRVYVHTSEDRLLQNVSTSVIVHVLDENDHSPAFLQNRVFLNVEESPIPLGVIGKMTAIDADSGKNGQLSYFLLTDGKFFKMNPNTGELINWLALDREHQGHHQITVLVTDHGSPPRNATMLVYVTITDINDNWPFFPQCLPGKEFHFKVLEGQPVNTLVTTVFAKDLDEGLSAELTYSISSDYPAHFKIDANNGEIRTTSILSHDYRPSYRMTVIASDHGVPPLQGKAIINIQVIPLSKGRVLMSQNIRHLVIPENTKPSKIMSLMKSPDPLQQDHGGKLHFSIAAEDKDDHFEIDSSTGDLFLTKELDYEMTSHYLIRVISKDHSQSPAWNSTVFLSIDVEDQNEHSPSFQDEFIVISIEENVPVGTLVYVFNAKDGDGSFLNSRIQYFAESSSVGVNPFLIHPSSGALVTASPLDRENVPTFILTVTASDQAVNVTDRRWRTLVAEVVILDVNDHSPTFVSYPITYVREDAEVGAVVHRITAQDPDAEMNGEVAYSILSGNEDMVFVLDSSSGLLRIACPLDYEVKTQHILTLVAHDGGMPARSSSQTLTITVLDVNDETPAFKQLLYETSVKENQSPGVFVTRVEAEDTDSGVNSKHQFEIMPGPAFGLFEINPDTGEVVTAVTFDREAQGIFRLRVLVRDGGVPSLSSTADIICTIEDENDHAPEFIVLHHDIEILENRDPEVVYTVLAFDMDAGNNGAVTYHIAEGNTDEYFAIHTTSGELSTTRALDRELISNFTLTILCSDLGNPPRSSAMQLHVRVLDDNDHSPAFPMLHYQSSIREDAEVGTVVLVLSAVDRDEGLNGQVEYFLMEEVSGAFTIDRVTGILRTSHALDRESRSQHTFQAVARDCSTQGAKSSVLSILISVTDANDNDPVWEENPVDAFISPMLALNQTVVHLRASDPDAGPNGTVTFSFADRQSVFSIDGYTGEVKLQQNLSSEHFPIWLQLLATDQGTPARTTMGLLVVHKEGEGMKLSFSRYLYTGLVTENCEPGTSVVTVKAFAPVSSPDAITYSVVSGNEDGVFSLGSNSGQLIVEEPGLLDFEVRSEVRLIILAESNGHQAFTQVTVAIQDWNDNPPRFAQSVYQASVSEGQFYSVHVIQVSATDLDQGLNSQIEYSIVSGNQAGAFRIDELNGVILTNSILDYESSGSYSLIVQATDRGVPRLSGTALVKIQVTDINDNAPVFLPSEAVEIAENSLPGVIVARVSVHDADLNPAFTFSLVKESSSAAKFAISQDTGVVVLAQTLDFEEVTEYELIVRVSDSVHHTEGSVIIRVLDVNDNPPVFTQDFYQAAVPELTPGGYLVLTLSATDLESSGDISYRILSPPEGFTIDPRNGTIFTTNSVSVLEKIPTLRFLVEANDGGIPSLTALTLVEIEIQDVNNYAPEFPAGCYNLSLSEDTPIGSTLMTFSTIDGDYSFENTHTEYSIISGNLHNYFHIETSLLGSEHPHQQRGALVLLHALDREASASHKLVILASDHGCPPLSSTSVIAIDILDINDNAPTFSSRHYQAHVKESTPVGSHITMVSADDPDKGSHAEIIYGIISGNEKEHFYLEDRTGVLYLVKPLDYEETVAFTLTIQATDEEEKHVSFAAVHISVLDDNDHSPQFLSSTLACITPENLPPLSIICSVHALDFDTGPYGEVTYSIVSPCLVTHGMHPYQDLFAIDPLTGDIHTEQMLDYESVREYCLLVQAKDRGDASASLEVWVEVEGIDEFEPIFTQDQYFFSLREKGQGQQLIGRVEASDADAGVDGEVLYSLRTPSTVFSVNKTNGNIYWVRAPLLGSSQLVKEDTLEVKIIAHSPKPGSKSTSCSVFVNVSLPAEGHHRTVLVHSFSISLVVSLLVFLSLVCTLIVLILRHKQKDPLHSYEEKKTPSSPDADPKLTGAASELKAGQETAEYRGVTGPGEVMPAEWLNLMSVMEKDIIHLFRHSNYSGHCSVDGETAEDKEIQRINENPYRKDSDYALSDQGSRVPDSGIPRDSDQLSCLSGETDVMTSSEVMEASHMFEEGVGGEGCDVIYVQNNALSLRREATAGVLAESRRESFTSGSQEGRCVAPSTQMTSSDDVRGSYAWDYFLSWEPKFQHLASVFNDIARLKDEHMQVPGIPKDTSFVFPPPLITAVAQPGIKAVPPRMPAITLGQVLPKFPRSPLPYHGGSLPEVMTPNFSPSLSLLTMQTPARSPMLPDGESRGTHMLGPWHDRKAEDEVQG
[ "GO:0072001", "GO:0032502", "GO:0009987", "GO:0008283", "GO:0001822", "GO:0048856", "GO:0010463", "GO:0007275", "GO:0072006", "GO:0032501", "GO:0048731", "GO:0072137", "GO:0048513", "GO:0008150" ]
[ "GO:0008150", "GO:0032502", "GO:0009987", "GO:0032501", "GO:0008283", "GO:0048856", "GO:0007275", "GO:0010463", "GO:0072006", "GO:0048731", "GO:0048513", "GO:0072001", "GO:0001822", "GO:0072137" ]
null
null
[ "IPR002126", "IPR015919", "IPR020894" ]
null
10090.ENSMUSP00000141425
[ "10090.ENSMUSP00000077574" ]
[ { "protein2": "10090.ENSMUSP00000077574", "neighborhood": 0, "fusion": 0, "cooccurence": 70, "coexpression": 0, "experimental": 0, "database": 900, "textmining": 135, "combined_score": 912 } ]
A0A0A6YXZ9
Protocadherin gamma subfamily C, 5
null
Mus musculus (Mouse)
107
null
MRPMASPQQAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNA
[ "GO:0050808", "GO:0009987", "GO:0016043", "GO:0065007", "GO:0071840", "GO:1901214", "GO:1901215", "GO:0043066", "GO:0042981", "GO:0008150", "GO:0060548", "GO:0043524", "GO:0010941", "GO:0050789", "GO:0034330", "GO:0043523", "GO:0043069", "GO:0048523", "GO:0043067", "GO:0048519", "GO:0050794", "GO:0110165", "GO:0005575", "GO:0016020" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0050789", "GO:0048519", "GO:0071840", "GO:0048523", "GO:0050794", "GO:0016043", "GO:0060548", "GO:0010941", "GO:1901214", "GO:1901215", "GO:0034330", "GO:0043069", "GO:0043067", "GO:0050808", "GO:0043066", "GO:0042981", "GO:0043524", "GO:0043523" ]
null
[ "GO:0005575", "GO:0110165", "GO:0016020" ]
[ "IPR031904" ]
af_db/AF-A0A0A6YXZ9-F1-model_v4.cif.gz
null
null
null
A0A0A6YY53
Immunoglobulin heavy constant gamma 2C
null
Mus musculus (Mouse)
335
null
XKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRVPITQNPCPPLKECPPCAAPDLLGGPSVFIFPPKIKDVLMISLSPMVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNRALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGFLPAEIAVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKSTWERGSLFACSVVHEGLHNHLTTKTISRSLGK
[ "GO:0002455", "GO:0006952", "GO:0009605", "GO:0002449", "GO:0002376", "GO:0019724", "GO:0002443", "GO:0002252", "GO:0019730", "GO:0002250", "GO:0006950", "GO:0008150", "GO:0019731", "GO:0016064", "GO:0043207", "GO:0050896", "GO:0051707", "GO:0006955", "GO:0042742", "GO:0009607", "GO:0009617", "GO:0006959", "GO:0098542", "GO:0044419", "GO:0002460", "GO:0032991", "GO:0110165", "GO:0005575", "GO:0042571", "GO:0005576", "GO:0019814", "GO:0005615", "GO:0003823", "GO:0003674", "GO:0005488" ]
[ "GO:0008150", "GO:0002376", "GO:0050896", "GO:0044419", "GO:0009605", "GO:0002252", "GO:0006950", "GO:0051707", "GO:0006955", "GO:0009607", "GO:0006952", "GO:0002443", "GO:0002250", "GO:0043207", "GO:0009617", "GO:0006959", "GO:0098542", "GO:0002455", "GO:0002449", "GO:0019730", "GO:0042742", "GO:0002460", "GO:0019724", "GO:0019731", "GO:0016064" ]
[ "GO:0003674", "GO:0005488", "GO:0003823" ]
[ "GO:0005575", "GO:0032991", "GO:0110165", "GO:0005576", "GO:0019814", "GO:0005615", "GO:0042571" ]
[ "IPR007110", "IPR036179", "IPR013783", "IPR003006", "IPR003597", "IPR050380" ]
null
null
null
null
A0A0A8P3N1
Lymphocyte antigen 86
null
Danio rerio (Zebrafish) (Brachydanio rerio)
166
null
MKTYFNMLLFLILGLVQMDRAHSQDPQWPLHTICNSNKLTVTYRSCVISDPLQDVGVSFLPCPNKLTDPTTVRIAFILRQSITEFYSSIKLFLNGLHVWGVDEPLCLPQFPRFTFCGSRRGEMITFEMLIKSKVDLPLKGDFNLMVHGINQDGFQIACVNATLSFW
[ "GO:0006952", "GO:0009605", "GO:0002376", "GO:0006950", "GO:0008150", "GO:0043207", "GO:0140546", "GO:0050896", "GO:0009615", "GO:0051607", "GO:0051707", "GO:0045087", "GO:0006955", "GO:0009607", "GO:0098542", "GO:0044419" ]
[ "GO:0008150", "GO:0002376", "GO:0050896", "GO:0044419", "GO:0009605", "GO:0006950", "GO:0051707", "GO:0006955", "GO:0009607", "GO:0006952", "GO:0043207", "GO:0009615", "GO:0045087", "GO:0098542", "GO:0140546", "GO:0051607" ]
null
null
[ "IPR014756", "IPR039945", "IPR003172" ]
af_db/AF-A0A0A8P3N1-F1-model_v4.cif.gz
7955.ENSDARP00000157223
[ "7955.ENSDARP00000116931" ]
[ { "protein2": "7955.ENSDARP00000116931", "neighborhood": 0, "fusion": 0, "cooccurence": 359, "coexpression": 391, "experimental": 880, "database": 0, "textmining": 957, "combined_score": 997 } ]
A0A0B4JD42
Odorant-binding protein 56i, isoform B
null
Drosophila melanogaster (Fruit fly)
129
null
MVVCVQRTQVQAGPIKDQCMAAAGITAQDVANRHETDDPGHSVKCFFRCFLENIGIIADNQIIPGAFDRVLGHIVTAEAVERMEATCNMIKSETSHDESCEFAWQISECYEGVRLSDVKKGQRTRNHRG
[ "GO:0000003", "GO:0008150", "GO:0019953", "GO:0110165", "GO:0005575", "GO:0005576", "GO:0005615" ]
[ "GO:0008150", "GO:0000003", "GO:0019953" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005576", "GO:0005615" ]
[ "IPR006170", "IPR036728" ]
af_db/AF-A0A0B4JD42-F1-model_v4.cif.gz
null
null
null
A0A0B4K7D0
Limostatin, isoform C
null
Drosophila melanogaster (Fruit fly)
120
null
MTTTMAAPQQQEVPHALLDIETPNQFNYSPSPLAQPDSLRSKPYFDFLSTLYAHDTAKSNLFRPYSVRQRRDADVQKLSRPRRAIVFRPLFVYKQQEIRKQEIRDRNAQRRHDLNRLQRV
[ "GO:0046888", "GO:0009605", "GO:0009991", "GO:0048878", "GO:0065008", "GO:0009743", "GO:0065007", "GO:0010648", "GO:0023057", "GO:1903530", "GO:0051049", "GO:0055088", "GO:0051051", "GO:0008150", "GO:0042221", "GO:0090276", "GO:0002791", "GO:0090087", "GO:0042594", "GO:0050896", "GO:0050789", "GO:0050848", "GO:0010646", "GO:0071310", "GO:0009267", "GO:0055090", "GO:0033554", "GO:0031667", "GO:0070887", "GO:0032879", "GO:0042593", "GO:0050794", "GO:0009966", "GO:0042592", "GO:0048583", "GO:0033500", "GO:0051716", "GO:0023051", "GO:0009987", "GO:0002792", "GO:1901700", "GO:0031668", "GO:0071322", "GO:0051046", "GO:0006950", "GO:0010817", "GO:0071496", "GO:0048523", "GO:0070328", "GO:0048519", "GO:0031669", "GO:1901701", "GO:0010033", "GO:0090278", "GO:1902531", "GO:0007154", "GO:0051048", "GO:1903531", "GO:0046883" ]
[ "GO:0008150", "GO:0065007", "GO:0050896", "GO:0050789", "GO:0042592", "GO:0009987", "GO:0048519", "GO:0009605", "GO:0048878", "GO:0065008", "GO:0023057", "GO:0051051", "GO:0042221", "GO:0032879", "GO:0050794", "GO:0048583", "GO:0051716", "GO:0023051", "GO:0006950", "GO:0048523", "GO:0007154", "GO:0046888", "GO:0009991", "GO:0010648", "GO:1903530", "GO:0051049", "GO:0055088", "GO:0042594", "GO:0010646", "GO:0033554", "GO:0070887", "GO:0009966", "GO:0033500", "GO:1901700", "GO:0031668", "GO:0010817", "GO:0071496", "GO:0010033", "GO:0051048", "GO:1903531", "GO:0046883", "GO:0009743", "GO:0090276", "GO:0090087", "GO:0071310", "GO:0009267", "GO:0055090", "GO:0031667", "GO:0042593", "GO:0002792", "GO:0051046", "GO:0031669", "GO:1901701", "GO:0090278", "GO:1902531", "GO:0002791", "GO:0050848", "GO:0071322", "GO:0070328" ]
null
null
null
af_db/AF-A0A0B4K7D0-F1-model_v4.cif.gz
null
null
null
A0A0B4KEW8
Pawn, isoform C
null
Drosophila melanogaster (Fruit fly)
1,343
null
MRRKPQNLTHSIPSSRAGDRGGGGGGVGRGTSRPSAISNNRRPRDHRHLMAMVVSTLPLALLLLLVQTTAGQHESVSQISPKSSSHRSPDRQRIESTMADSVNGLAEGQSSPLDVNDNETRAERVERSASPILHDRQPIGPNDVHFPEDLEKDVSAGRYFHYNIKPTGTFDNQDEQPERTHQGIRAGKTLSQGGSSSEQSFLGRGDLRPLVSGSPIRPSPSNTATSATAASATQAPHSPRQNGNPDIQDIITGIVKLLNGNVNVHANTQGIRRPSASRINNRGPPRISEAQNLPIDYEAQKPGTSMRPPPYPFDRPERPFITGVPIPEQIVPVRPGFVSNRPPWYRNKPRPPIATSVGGNRRPLPQYKPLPAPPVQAPLQPQDPLDRKNEQEKEQNHQEQPQPTDDVVLPTDTTYDSEFSNEDANAQYIEVSDQDTDATGGEVEDELQPPPPPPSTTNNPPTTPTNPSKKKHKPKPGSEKKKLPEESPQDEGFSTIIETSSVVHTVMGMSSTYVPMSMDSSESLGLDPSTEEVIFMTANRTPTLEPSVTSSLGTSSSSNPASAIQPTSSKEHTKTTTTTTTTTSSSTSTTTSTTTPPSTESVSPNSSNANTNATPPAPYHPRPGIVLDDPEFKPGGRPRPPVQRPPAQQTLPLPAVQPTRQHLPPGYGEIFDVTLSAIQGPGPKGSGSQQTINIKPYGSYAAGGGQGDIIVSASDPPAGATTPATRLPQLPGSGSGSGSGSGTGSGGASTPGVGVSSGGGGGSGSSISPAAPANAVTQSSGGYVVPETEVVDLQGHSKPQGGAPTTNAGPTRPHYRQRPTQPPVRIDTCIVGDDSTCDQAQHERCKTDNGVSSCHCRPGYSRRKHREPCRRVISFHLGMRVDRIYEHRIVWDTKLMDKHSEPFGQLSYESIRALDSAMSMTPYSDEFMEAKVNNIYRGDPNLGGSGVYVNMTIKLDESVETLRPNLRSDVQKHLLGVLHRRNNNIGNSVLYVSSPEGAVSALQDLDECQSPELNDCHSGASCSNTWGSFRCACEAGLRDPWADQPARSGRECQACADSVCNNHGTCSYAEDGAQLCTCDSSHYGAQCEIDGEVLGVAIGASVAAIIIIVLTLVCLIMWSRRWQREQKNAMGSPVFGYMNTAPLKSAGLPQAGYQVTLEDRMRWAQIADVMAQTNHYGQAEPIGPTRPSSAMFAYPNLGAMGMGTLGGMSLQSTMQMHPSATLAPPVPLPRRLGLGPRSNGMRTLENSSSSEEEDRADLLGRNFQVPRPKSRSNGSIANQSGIYYDVDYEPSGNGIGNSSVDHLYGSQNQSVTHSSGHSHIPGPQGIPMSTYTSGRAPSSYYMK
[ "GO:0032502", "GO:0022416", "GO:0048856", "GO:0008407", "GO:0009653", "GO:0009887", "GO:0048513", "GO:0008150", "GO:0007423" ]
[ "GO:0008150", "GO:0032502", "GO:0048856", "GO:0009653", "GO:0009887", "GO:0048513", "GO:0008407", "GO:0007423", "GO:0022416" ]
null
null
[ "IPR050751", "IPR001881", "IPR000742", "IPR000152", "IPR018097", "IPR049883" ]
null
null
null
null
A0A0B4KEZ2
Nervy, isoform D
null
Drosophila melanogaster (Fruit fly)
757
Nucleus {ECO:0000256|ARBA:ARBA00004123}.
MMALDGKAIIKEEITDKDAYDAAAAAAAAVAAGAALAVASAAAVQVPPASSSSAGSASSAAAAATNNTTSAAATAAAISRRLKASSSGGDKSSTSSSSSKDSSHTSSSRSERDRERERERERERDRLCRTPPDSPPDSSRSLAPRSPHSPLQLHQHPQRNASVSPVVNGSSSGGGGVGSSGTSPTPTPGSQHAASLAAAAAAAAAAHVEQARLVSKMRKFLGALVQFSQELGQPEVCERVRALVLSLCSGSISVEEFRLALQEAINLPLRPYVVPLLKNSIALVQREILALARATNQSALQYVTNNEQAVMEFAPHGVASAEFGDIFIQLEAPTSNGSSAVFKRRSSDSMMEHGGHNGLQEWNEYMASGGAGYPPPPSKRLTLHPAHSVVAYGEYGVSSAEGLPSAAAFMQRDERDLRMSEAQARHAAPPQRAGNPQPNPNAAAPGAPGAGGEEEWKNIHTMLNCISAMVDKTKRAITILQQRGIEPQHPNSGQEVTPAAMAELRRQTEEKVAEFKRNAEDAVTQVKRQAVIEIQRAVVAAETRAAEIMTQERLRMEKFFMEMSRHSSGERDLDNKSPSMASAQNGSNLQQQCWNCGRKATETCSGCNMARYCSASCQYRDWDSHHQVCGNTRASELSAKHLHSASNLSLRNAMATRSPPTPNSAAHLQAAAAAAAAAAGAREAVSAPVGGPGAGIAVGTGAGSGGQSGGGGGGGGGGGGGAAAAAVAAATPGALVANGLGSKXRIRMMKPKKKYLC
[ "GO:0032989", "GO:0009605", "GO:0040011", "GO:0000902", "GO:0048667", "GO:0048869", "GO:0048856", "GO:0022008", "GO:0007275", "GO:0009653", "GO:0009887", "GO:0000904", "GO:0007411", "GO:0030030", "GO:0008150", "GO:0042221", "GO:0007399", "GO:0050896", "GO:0022416", "GO:0048468", "GO:0042330", "GO:0030154", "GO:0031175", "GO:0097485", "GO:0032990", "GO:0048731", "GO:0048513", "GO:0007423", "GO:0048812", "GO:0048699", "GO:0032502", "GO:0009987", "GO:0016043", "GO:0071840", "GO:0120039", "GO:0120036", "GO:0061564", "GO:0006935", "GO:0048858", "GO:0007409", "GO:0008407", "GO:0030182", "GO:0032501", "GO:0048666", "GO:0005622", "GO:0043229", "GO:0043226", "GO:0110165", "GO:0005575", "GO:0043227", "GO:0005634", "GO:0043231" ]
[ "GO:0008150", "GO:0040011", "GO:0050896", "GO:0032502", "GO:0009987", "GO:0032501", "GO:0009605", "GO:0048869", "GO:0048856", "GO:0007275", "GO:0009653", "GO:0042221", "GO:0042330", "GO:0071840", "GO:0032989", "GO:0000902", "GO:0009887", "GO:0048468", "GO:0030154", "GO:0048731", "GO:0048513", "GO:0016043", "GO:0006935", "GO:0022008", "GO:0000904", "GO:0030030", "GO:0007399", "GO:0097485", "GO:0032990", "GO:0007423", "GO:0048858", "GO:0008407", "GO:0030182", "GO:0048666", "GO:0048667", "GO:0007411", "GO:0022416", "GO:0031175", "GO:0048699", "GO:0120039", "GO:0120036", "GO:0048812", "GO:0061564", "GO:0007409" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0043229", "GO:0043227", "GO:0043231", "GO:0005634" ]
[ "IPR013289", "IPR013293", "IPR014896", "IPR037249", "IPR003894", "IPR002893" ]
null
7227.FBpp0303462
null
null
A0A067YRV0
Zinc finger FYVE domain-containing protein 26
Phosphatidylinositol 3-phosphate-binding protein required for the abscission step in cytokinesis: recruited to the midbody during cytokinesis and acts as a regulator of abscission. May also be required for efficient homologous recombination DNA double-strand break repair. {ECO:0000256|ARBA:ARBA00044939}.
Danio rerio (Zebrafish) (Brachydanio rerio)
2,269
null
MHPFGREEETSRRELFGFFRRCLQRGEWELAAACVSQLGEARAEDPHSPRDIVKAIVTHPYPLRWETVGSPHRLAWYWLQVLERPTEIKVSVSVKRELEFLLLLEELEDIPQSVLKELHEAFLYSEEVKGKAPGDSASPLSAALLSCLRSLLTRQQPRLCHSLISFLSNGDPSRDHTLQDAFIQHLTEQVKVPAKDRNREWVEQVCSVLALAPWGSDRSGAQLEPLWEGLWAAREGLMTEERILGCLLRPQSQALLMAYSSTALRLLKDKLLAEAPHTQVDLPDLERVMLGLCCHKDKRLAWKAIYFECLSSGKHFLEQVLLTGLDLIKREEFSKLETLLHSEFQPLSRLLLLLGWMHCQSLESAKTLLTVLHHRQPQSNDSALSDLACTLSCQLGVLEWCTQNNPGISHDALLSHLHMLDHHSALYVLHCLTPLAKFEEHKVLELLQRTGDPSQVDSPSSSVQRNITLFRGFCAMKYALYAISVNARTHAHTGSLDCEPLHELQTEAAQEDETAEGCSNLFQHYLSECQLYLEAVPALFRLELLENIFSLLFLSDSDFTQQTSTATETQPYTNTETSKPKSTKEVNTAEHFLKAENEGERMDELNQINPQLGHLTSGCRGFLVDLNVMEGILRLVREGLEGVCGVGQEDGRALGADVELAESLGCSVTAETFSARLQRLSKYTAEAQWRLQIVTSNHGNGNDGLYLPSPLPSPALPLKRQGSGSSGTSSRRRRKHHRHRSERHVSSERQNGEVSTSTSDGGVCVSVVCRGTETCPCGGSHSWLVPAMLSPPESLLIACIRRGNYIEAQQVIAMYGLENSECAGELVFMDRYREVLIELAQVEQKIESQSLSTSSSSSEGLGTLGATPAGRTRMGSSSRLTLKSIGSAAAAGMAFYSISDVADRLMSTPSRPIPCLEDSYWLSQCTIDSPDFVRPLVEELSPAAMAAFDLSCCQCQLWKTSRQLLETAERRLSSFLEARGVRVDPKVPHANGIRGFPSVLQQISKILNKTSTNKGMSKTDCNGEENAVCSPFGCSAQEVLLSCHSTLTEESITIQQNLNQRLEVTLQTLSSATNTSVDSLVGSNLLTALAEQAALKQSELDCHPVRTAMKQLLQYLDQLCPLVPDGAPDRPDYIRSFFDYVNVLASVLVRSLGSEDQSTVVKLGNPLLLLLQSPAQLLSHLLFDRQVSPDRVLSLLQQERLRLSVQQVVVQRCCETLPLWDSRAVNFSQRVSGLNGGAFCPASIASILQQYAQDCSPSLDLSDPTTTSDPSSESEVSVEDVSAASTSLSTSPPSPSSSSPSSSFLLTPSALSFLKSRSPLVAALACLSASRGGVTRVTSSGWSGLPSYFRGSGRKEAVLDGEQISREGEALLKNFPILRMYLRTMAEPVLGVSLEADEGLGVALCGKPVVGMLFSGLQGNAAQAMAAEAFQQALNNGDLNRALDLLELYAQPCSQEGALRDKLLAFTALQESSSAEQLFRVRDWELRGRVVLQGLDRWPLQQCLDLLHFCLSDQNTKDPLREQLQQRKQELDMYQRMLRLQPSLPWETWQELREESTKNPESVFSQMLEAREFELCAQWVQLYSVSDQSGMQLQTEHLLYLLEHNHTEEAFQLLEALSDSMGLEVSERALDRRPGLAACHFLSDYLTLHFQSQMTPARRRHIHALHLGSKVLLTLPEASRQDYFSLLSDPLLMLEQMLMNLKVDWAAVAITTLRSLLLAQDAGITTQHIDTLLADYARKALDFPYAPREWSRSDSVISLQDAFLQCPAQESCPSSPSHTPPPSTGGTPMQTPSSERRPSGKKIRPLATPFTPPEKTPDRKDWIPDHKQHICMVCQRERFTMFNRRHHCRRCGRLVCHSCSSKKMAVAGFDEPVRVCDQCYNFFHTDSDEELEQGEAGSPSSIDEVLNGVLSLPEVSRKQYRLSPNPAENQQLKSEFYYEQAPSASLCVAILTLHSDHAACGQQLIDHCRSLSRKLTNPEVDARLLTDVMRQLLFSAKLMFVNAGCTQEPALCDSYISKVDVLKILVTANYKYIPSLDDIQETAAVTRLRNQLLELEYYQLAVEVSTKSALDPNGVWQAWAMASLKAGNLSGAREKFVRCLKAPVDRNQLNHGPRLLQEIIQHLESTVKLTLSQTMDEDILASLRELEEALSDSAPPEGTESKVQRCNFHQECLFYLFTYGTHLSLISFYLRHDCLKDALTYLQNKGCSDDVFLEGIFQPCLERGRLGALQGLLENLDPTLETWGRYLLSACQLLQRRGHYHSLTTFVLR
[ "GO:0032989", "GO:0000902", "GO:0019953", "GO:0007276", "GO:0048667", "GO:0048869", "GO:0048856", "GO:0022008", "GO:0007281", "GO:0007275", "GO:0009653", "GO:0000904", "GO:0030030", "GO:0008150", "GO:0007399", "GO:0022412", "GO:0007292", "GO:0048468", "GO:0030154", "GO:0031175", "GO:0048599", "GO:0032990", "GO:0048731", "GO:0048699", "GO:0048812", "GO:0048477", "GO:0022414", "GO:0032502", "GO:0009987", "GO:0016043", "GO:0071840", "GO:0009994", "GO:0120039", "GO:0120036", "GO:0061564", "GO:0032504", "GO:0003006", "GO:0048858", "GO:0048609", "GO:0007409", "GO:0030182", "GO:0000003", "GO:0032501", "GO:0048666" ]
[ "GO:0008150", "GO:0022414", "GO:0032502", "GO:0009987", "GO:0000003", "GO:0032501", "GO:0019953", "GO:0048869", "GO:0048856", "GO:0007275", "GO:0009653", "GO:0022412", "GO:0071840", "GO:0032504", "GO:0003006", "GO:0048609", "GO:0032989", "GO:0000902", "GO:0007276", "GO:0007281", "GO:0048468", "GO:0030154", "GO:0048731", "GO:0016043", "GO:0009994", "GO:0022008", "GO:0000904", "GO:0030030", "GO:0007399", "GO:0007292", "GO:0048599", "GO:0032990", "GO:0048477", "GO:0048858", "GO:0030182", "GO:0048666", "GO:0048667", "GO:0031175", "GO:0048699", "GO:0120039", "GO:0120036", "GO:0048812", "GO:0061564", "GO:0007409" ]
null
null
[ "IPR028730", "IPR000306", "IPR017455", "IPR011011", "IPR013083" ]
null
null
null
null
A0A087WNQ6
Sycp3 like Y-linked
null
Mus musculus (Mouse)
110
null
METLKVFLGTGDVRNDIYKTLHIKRKWMETYVKESFKGSNQKLERFCKTNERERKNINNKFCEQYITTFQKSDMDVQKFNEEKEKSVNSCQKEQQALKLSKCSQNQTLEA
[ "GO:0032502", "GO:0019953", "GO:0060255", "GO:0007276", "GO:0048869", "GO:0009987", "GO:0065007", "GO:0009566", "GO:0008150", "GO:0022412", "GO:0032504", "GO:0003006", "GO:0048232", "GO:0007530", "GO:0050789", "GO:0019222", "GO:0048609", "GO:0030154", "GO:0007338", "GO:0000003", "GO:0007283", "GO:0010468", "GO:0032501", "GO:0048515", "GO:0022414", "GO:0005622", "GO:0043229", "GO:0043226", "GO:0110165", "GO:0005737", "GO:0005575", "GO:0043227", "GO:0005634", "GO:0043231", "GO:0005515", "GO:0005488", "GO:0003674" ]
[ "GO:0008150", "GO:0032502", "GO:0009987", "GO:0065007", "GO:0050789", "GO:0000003", "GO:0032501", "GO:0022414", "GO:0019953", "GO:0048869", "GO:0009566", "GO:0022412", "GO:0032504", "GO:0003006", "GO:0019222", "GO:0048609", "GO:0060255", "GO:0007276", "GO:0007530", "GO:0030154", "GO:0007338", "GO:0007283", "GO:0048515", "GO:0048232", "GO:0010468" ]
[ "GO:0003674", "GO:0005488", "GO:0005515" ]
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0005737", "GO:0043229", "GO:0043227", "GO:0043231", "GO:0005634" ]
[ "IPR051443", "IPR006888" ]
af_db/AF-A0A087WNQ6-F1-model_v4.cif.gz
null
null
null
A0A097HUX0
25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (EC 1.14.15.18) (25-hydroxyvitamin D-1alpha-hydroxylase)
null
Danio rerio (Zebrafish) (Brachydanio rerio)
505
null
MMMVLHQALKVTGRSALPLLRFAERWADVIRAPPTPQVKTLEQMPGPSPARFIRDLFMKRGFSRLHQLQLEGRQKYGPMWKASFGPILTVHVAEPELIQQVLRQEGQHPVRSELSSWKDYRALRGEGYGLLTAEGEEWQCVRSLLSKHMLRPQAVEAYDGALNAVVSDLLQKLKLRSQESSSRIVSDISAEFYRFGLEGISSVLFESRIGCLDAVVPVETERFIQSINTMFVMTLLTMAMPQWLHRLLPKPWDTFCRCWDVMFEFAKGHIDQRLQEEKQKLECGEQLEGRYLTYFLSQAGLPLTSVYSNVTELLLAGVDTISSTLSWSLYELSRHPDVQTALRDEVLSVMKDRSVPQASDVAAMPLLKAVVKEILRLYPVIPANARVINKDIEVGGYVIPKNTLITLCHYATSRDPQQFRDPDSFRPQRWGDRSDRSHPYATVPFGVGKRSCIGRRIAELEVYLALSRILMHFTMEPVRENDTVHPMTRTLLVPERQIDLRFTER
[ "GO:0032502", "GO:0030097", "GO:0048468", "GO:0009987", "GO:0071425", "GO:0008283", "GO:0048856", "GO:0048869", "GO:0030154", "GO:0072089", "GO:0008150", "GO:0016709", "GO:0004498", "GO:0003674", "GO:0016705", "GO:0003824", "GO:0004497", "GO:0016491" ]
[ "GO:0008150", "GO:0032502", "GO:0009987", "GO:0008283", "GO:0048856", "GO:0048869", "GO:0048468", "GO:0030154", "GO:0072089", "GO:0030097", "GO:0071425" ]
[ "GO:0003674", "GO:0003824", "GO:0016491", "GO:0016705", "GO:0004497", "GO:0016709", "GO:0004498" ]
null
[ "IPR050479", "IPR001128", "IPR017972", "IPR002401", "IPR036396" ]
af_db/AF-A0A097HUX0-F1-model_v4.cif.gz
null
null
null
A0A0A6YWR3
Signal-regulatory protein beta 1A
null
Mus musculus (Mouse)
182
null
MLLLDAWTHIPHSVLLLILLLGFKDVTKRNNMDFSIRISNVTPADSGTYYCVKFQRGSSEPDIEIQSGGGTELLVLAKPSSPMVSGPAARAVPQQTVTFTCRSHGFFPRNLTLKWFKNGDEISHLETSVEPEETSVSYRVSSTVQVVLEPRDVRSQIICEVDHVTLDRAPLRGIAHISEFIQ
[ "GO:0051234", "GO:0051716", "GO:0051649", "GO:0051641", "GO:0009987", "GO:0060627", "GO:0065007", "GO:0023052", "GO:0051179", "GO:0050764", "GO:0050794", "GO:0016192", "GO:0048518", "GO:0051049", "GO:0008150", "GO:0006909", "GO:0035556", "GO:0050896", "GO:0050789", "GO:0051050", "GO:0032879", "GO:0007154", "GO:0007165", "GO:0006810", "GO:0050766", "GO:0071944", "GO:0005575", "GO:0110165", "GO:0016020", "GO:0005886" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0023052", "GO:0051179", "GO:0048518", "GO:0050896", "GO:0050789", "GO:0051234", "GO:0051716", "GO:0051641", "GO:0050794", "GO:0051050", "GO:0032879", "GO:0007154", "GO:0007165", "GO:0051649", "GO:0060627", "GO:0051049", "GO:0035556", "GO:0006810", "GO:0050766", "GO:0050764", "GO:0016192", "GO:0006909" ]
null
[ "GO:0005575", "GO:0110165", "GO:0071944", "GO:0016020", "GO:0005886" ]
[ "IPR051755", "IPR007110", "IPR036179", "IPR013783", "IPR003597", "IPR013106" ]
af_db/AF-A0A0A6YWR3-F1-model_v4.cif.gz
null
null
null
A0A0A6YX79
Protocadherin 1
null
Mus musculus (Mouse)
45
null
MGPLRPSPGPGGQRLLLPPLLLALLLLLAPSASHTTQVVYKVPEE
[ "GO:0098609", "GO:0009987", "GO:0007155", "GO:0016339", "GO:0008150", "GO:0007156", "GO:0098742", "GO:0110165", "GO:0070161", "GO:0005911", "GO:0071944", "GO:0005575", "GO:0016020", "GO:0005886", "GO:0030054", "GO:0005515", "GO:0005488", "GO:0003674" ]
[ "GO:0008150", "GO:0009987", "GO:0007155", "GO:0098609", "GO:0098742", "GO:0016339", "GO:0007156" ]
[ "GO:0003674", "GO:0005488", "GO:0005515" ]
[ "GO:0005575", "GO:0110165", "GO:0071944", "GO:0016020", "GO:0030054", "GO:0070161", "GO:0005886", "GO:0005911" ]
null
af_db/AF-A0A0A6YX79-F1-model_v4.cif.gz
null
null
null
A0A0A6YYP6
Signal-regulatory protein beta 1A
null
Mus musculus (Mouse)
397
null
MLLLDAWTHIPHSVLLLILLLGFKGAAVRELKVIQPVKSFFVGAGGSATLNCTVTSLLPVGPIRWYRGVGQSRLLIYPFTGEHSPRITNVSDVTKRNNMDFSIRISNVTPADSGTYYCVKFQRGSSEPDIEIQSGGGTELLVLAKPSSPMVSGPAARAVPQQTVTFTCRSHGFFPRNLTLKWFKNGDEISHLETSVEPEETSVSYRVSSTVQVVLEPRDVRSQIICEVDHVTLDRAPLRGIAHISEFIQVPPTLEIRQQPTMVWNVINVTCQIQKFYPPSFQLTWLENGNISRREVPFTLIVNKDGTYNWISCLLVNISALEENMVVTCKVEHDEQAEVIETHTVLVTEHQRVKGTATKSELKTAGIAKIPVAVLLGSKILLLIAATVIYMHKKQNA
[ "GO:0051234", "GO:0051716", "GO:0051649", "GO:0051641", "GO:0009987", "GO:0060627", "GO:0065007", "GO:0023052", "GO:0051179", "GO:0050764", "GO:0050794", "GO:0016192", "GO:0048518", "GO:0051049", "GO:0008150", "GO:0006909", "GO:0035556", "GO:0050896", "GO:0050789", "GO:0051050", "GO:0032879", "GO:0007154", "GO:0007165", "GO:0006810", "GO:0050766", "GO:0071944", "GO:0005575", "GO:0110165", "GO:0016020", "GO:0005886" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0023052", "GO:0051179", "GO:0048518", "GO:0050896", "GO:0050789", "GO:0051234", "GO:0051716", "GO:0051641", "GO:0050794", "GO:0051050", "GO:0032879", "GO:0007154", "GO:0007165", "GO:0051649", "GO:0060627", "GO:0051049", "GO:0035556", "GO:0006810", "GO:0050766", "GO:0050764", "GO:0016192", "GO:0006909" ]
null
[ "GO:0005575", "GO:0110165", "GO:0071944", "GO:0016020", "GO:0005886" ]
[ "IPR051755", "IPR007110", "IPR036179", "IPR013783", "IPR003597", "IPR003599", "IPR013106" ]
af_db/AF-A0A0A6YYP6-F1-model_v4.cif.gz
null
null
null
A0A0B4K6C1
Shal K[+] channel interacting protein, isoform G
null
Drosophila melanogaster (Fruit fly)
1,034
null
MAVSNIVCEWLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSIRSLREKGAASVYFMLNDPNSLSGSMEILCETPPNNELELVLREQLETDGVRLTAHPYSTPDGQRGHLEGLASVYCELLMAPFGDILATIERARQAAWAERSPLHSAAQVVGGSGGAGGSTGSGSGGAASGGSGGSSGVLHHRQQHGHRGHSMHGAGLPNSHSQPIYVPGKYSPSSCLSDKEEDEIYGFGYGVFAPRVARGGLTQQQQLLQQQTLQTQQSIQQQQQQMQQQQQQLPIVPGQQQQGPHQHQTLPPNVAHLNFVQQNCLSPRSAYFYEFPPTAEGRETKKRTTLARLLKGLKTVNRRDRNNQQNGAQARAANDRLRHFQMINGGAGGQQHSFEETIHRLKVQEAMRKKEKFQREHEEILRDIRQGLLQMSRGEGRMDDTYMYDEALRTGGGMGIAGLGMPLGVGGNGGGGGAAHYAGGRVRFSNNRESTGVISLRSAGDISLPQRGPPRRGLIVPQQPPNPPTIIPLTHARSHDRESGDYAGSISDLQSVTSRFSTVSIGTNNCTARYRTLSGGIGESPSLSPSPSSDYEDIGVTRGHGCLPPSLLAAKAKKNGLPHGKANTICQKATVHHSGEMRSSAKEIGAFNENGRNFVATKDTSRDFSNSQDNTDRGSMSDQAFACSASSVESLPSASGSSTQALVRPGSPHSSISAEDRTSMASCICKAKALVDSLPNPYDKEALKFKKGDLIDVLSMNASGIWKGRCHGRVGHFKFINVEVLPEQRMKNSSSKTLAAGSRLANSGNGSHNGGPCSVEDLLIRIGLKEYTSVFVLNGYEDLELFKELEPADLDYLGILNQEHRAKLLTAVQLLHDIESTNFARTGSDVDIPGSSSENDEARLNNINMKHGASPFGRRHFPRDSGCYEGSPLPSSQTPTQAVNSTDESNSLDDVVTKCSSEIMKRVESARRCKDNPFKTTLPGGGRLGKKSFLGGNGLMADDTLTRGGLSEKSSDSGVSSSSLSSGPLKSST
[ "GO:0003008", "GO:0050877", "GO:0007600", "GO:0007606", "GO:0032501", "GO:0008150", "GO:0007608" ]
[ "GO:0008150", "GO:0032501", "GO:0003008", "GO:0050877", "GO:0007600", "GO:0007606", "GO:0007608" ]
null
null
[ "IPR001660", "IPR051725", "IPR013761", "IPR036028", "IPR001452" ]
af_db/AF-A0A0B4K6C1-F1-model_v4.cif.gz
null
null
null
A0A0B4K7N3
Antares, isoform B
null
Drosophila melanogaster (Fruit fly)
272
Secreted {ECO:0000256|ARBA:ARBA00004613}.
MKMWYLYLFLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALKTGILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHFSRASVNNLVPYEEGQIPAGKCATGPSQMYQFLCSEDEYVDANSMVVESNMPSSDQIQVDI
[ "GO:0046692", "GO:0019953", "GO:0065008", "GO:0060180", "GO:0019098", "GO:0065007", "GO:0045924", "GO:0044706", "GO:0045434", "GO:0007621", "GO:0008150", "GO:0007320", "GO:0032504", "GO:0007620", "GO:0007617", "GO:0048609", "GO:0046008", "GO:0046693", "GO:0000003", "GO:0032501", "GO:0007610", "GO:0044703", "GO:0022414", "GO:0110165", "GO:0005575", "GO:0005576", "GO:0005615" ]
[ "GO:0008150", "GO:0065007", "GO:0000003", "GO:0032501", "GO:0022414", "GO:0019953", "GO:0065008", "GO:0019098", "GO:0044706", "GO:0032504", "GO:0048609", "GO:0007610", "GO:0044703", "GO:0046692", "GO:0045924", "GO:0007320", "GO:0007617", "GO:0060180", "GO:0007621", "GO:0007620", "GO:0046008", "GO:0046693", "GO:0045434" ]
null
[ "GO:0005575", "GO:0110165", "GO:0005576", "GO:0005615" ]
[ "IPR014044", "IPR035940", "IPR034763" ]
af_db/AF-A0A0B4K7N3-F1-model_v4.cif.gz
7227.FBpp0297539
[ "7227.FBpp0086228", "7227.FBpp0079243", "7227.FBpp0311701", "7227.FBpp0290920", "7227.FBpp0307158", "7227.FBpp0084680", "7227.FBpp0087560", "7227.FBpp0311741", "7227.FBpp0077991", "7227.FBpp0083547", "7227.FBpp0083834", "7227.FBpp0079415", "7227.FBpp0084682", "7227.FBpp0307765" ]
[ { "protein2": "7227.FBpp0086228", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 242, "experimental": 0, "database": 0, "textmining": 669, "combined_score": 738 }, { "protein2": "7227.FBpp0079243", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 385, "experimental": 0, "database": 0, "textmining": 653, "combined_score": 777 }, { "protein2": "7227.FBpp0311701", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 285, "experimental": 0, "database": 0, "textmining": 606, "combined_score": 706 }, { "protein2": "7227.FBpp0290920", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 185, "experimental": 0, "database": 0, "textmining": 893, "combined_score": 909 }, { "protein2": "7227.FBpp0307158", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 410, "experimental": 0, "database": 0, "textmining": 606, "combined_score": 757 }, { "protein2": "7227.FBpp0084680", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 178, "experimental": 0, "database": 0, "textmining": 705, "combined_score": 747 }, { "protein2": "7227.FBpp0087560", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 198, "experimental": 0, "database": 0, "textmining": 891, "combined_score": 908 }, { "protein2": "7227.FBpp0311741", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 512, "experimental": 0, "database": 0, "textmining": 492, "combined_score": 741 }, { "protein2": "7227.FBpp0077991", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 126, "experimental": 0, "database": 0, "textmining": 799, "combined_score": 816 }, { "protein2": "7227.FBpp0083547", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 458, "experimental": 0, "database": 0, "textmining": 666, "combined_score": 811 }, { "protein2": "7227.FBpp0083834", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 201, "experimental": 0, "database": 0, "textmining": 651, "combined_score": 709 }, { "protein2": "7227.FBpp0079415", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 501, "experimental": 0, "database": 0, "textmining": 670, "combined_score": 828 }, { "protein2": "7227.FBpp0084682", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 450, "experimental": 0, "database": 0, "textmining": 911, "combined_score": 948 }, { "protein2": "7227.FBpp0307765", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 204, "experimental": 0, "database": 0, "textmining": 890, "combined_score": 908 } ]
A0A0B4KEI1
Uncharacterized protein, isoform C
null
Drosophila melanogaster (Fruit fly)
136
Mitochondrion membrane {ECO:0000256|ARBA:ARBA00004325}.
MYIHISENNTVAISLTDRLKASKLTRRGNKFSNLFKMSSNSLFETDEDVAQANKLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGLAYTMAKEYLLHEEPKSNTRPDE
[ "GO:0098771", "GO:0050801", "GO:0042592", "GO:0048878", "GO:0008150", "GO:0055070", "GO:0055080" ]
[ "GO:0008150", "GO:0042592", "GO:0048878", "GO:0098771", "GO:0050801", "GO:0055070", "GO:0055080" ]
null
null
[ "IPR007667", "IPR050355" ]
af_db/AF-A0A0B4KEI1-F1-model_v4.cif.gz
7227.FBpp0302903
[ "7227.FBpp0078918", "7227.FBpp0082459", "7227.FBpp0078919", "7227.FBpp0100180", "7227.FBpp0100177" ]
[ { "protein2": "7227.FBpp0078918", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 103, "experimental": 684, "database": 0, "textmining": 164, "combined_score": 742 }, { "protein2": "7227.FBpp0082459", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 46, "experimental": 684, "database": 0, "textmining": 169, "combined_score": 727 }, { "protein2": "7227.FBpp0078919", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 101, "experimental": 684, "database": 0, "textmining": 164, "combined_score": 741 }, { "protein2": "7227.FBpp0100180", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 773, "database": 0, "textmining": 186, "combined_score": 807 }, { "protein2": "7227.FBpp0100177", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 773, "database": 0, "textmining": 170, "combined_score": 803 } ]
A0A0B4KEQ6
Uncharacterized protein, isoform D
null
Drosophila melanogaster (Fruit fly)
72
Mitochondrion membrane {ECO:0000256|ARBA:ARBA00004325}.
MLVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGLAYTMAKEYLLHEEPKSNTRPDE
[ "GO:0098771", "GO:0050801", "GO:0042592", "GO:0048878", "GO:0008150", "GO:0055070", "GO:0055080" ]
[ "GO:0008150", "GO:0042592", "GO:0048878", "GO:0098771", "GO:0050801", "GO:0055070", "GO:0055080" ]
null
null
[ "IPR007667", "IPR050355" ]
af_db/AF-A0A0B4KEQ6-F1-model_v4.cif.gz
null
null
null
A0A060IVL7
Tripartite motif containing 69 protein
null
Danio rerio (Zebrafish) (Brachydanio rerio)
548
null
MRETPANFQQDQNPETPPILSPSQQESQSRRARRTEQSMSSSLPAQNKMDKQKLRPEIPPRVSKSSAQRLSRDLTCSICLDLFKQPVSLPCDHTFCEACITSYWSGPRVKCQAGSGSCPQCRKVFHGKSYRPNRIVANIVESYCQGMEESGVRLGAVSEPAPTTPLCMRHREELKLYCEEDQELVCLVCGISQDHRAHTLVCVQDAQKRYRASLTTSANALQKELNTALECERETEEEVKKLKDHTADLKQRIEAQFSELHQFLYQEEKLLQVKLKTEERRELIRLDEHKALLSVEISRLRRAVNDIEDKLSEQDPYTLLRSIKGLLQRQPPKFERPTLTPPSLCEGRFAGPLQYRVWKSLKGSIYPVPSAITFNSKTANPWLSLTSSLTCVRYQTFNSSVQDNPQRFNAALSLMGGQGFTKGRHYWEVEVYSSTVWTVGVARESVTRKGVINTMPANGFWTLSLSYGVQYMAGTSPPTLLSLEEPLARIGVYLDYKRGLVSFYNAESMTHLYTFRDTFTETLFPYFNLGFLDKVHENEPLKVFMPKI
[ "GO:0035295", "GO:0007420", "GO:0050793", "GO:0048856", "GO:0065007", "GO:1904748", "GO:0043009", "GO:0007275", "GO:0042981", "GO:0008150", "GO:0007399", "GO:0060548", "GO:0010941", "GO:0009888", "GO:0003002", "GO:0050789", "GO:0021915", "GO:0060322", "GO:0043069", "GO:0022004", "GO:0043067", "GO:0048731", "GO:0007389", "GO:0048513", "GO:0050794", "GO:0030917", "GO:0032502", "GO:0009790", "GO:0007417", "GO:0021700", "GO:0043066", "GO:0021532", "GO:0051093", "GO:0060429", "GO:0048523", "GO:0048519", "GO:0032501", "GO:0021732", "GO:0009952", "GO:0009792", "GO:1904746", "GO:0071695", "GO:0021903" ]
[ "GO:0008150", "GO:0065007", "GO:0050789", "GO:0032502", "GO:0048519", "GO:0032501", "GO:0050793", "GO:0048856", "GO:0007275", "GO:0022004", "GO:0007389", "GO:0050794", "GO:0021700", "GO:0051093", "GO:0048523", "GO:0035295", "GO:1904748", "GO:0060548", "GO:0010941", "GO:0009888", "GO:0003002", "GO:0060322", "GO:0048731", "GO:0048513", "GO:0030917", "GO:0009790", "GO:1904746", "GO:0071695", "GO:0007420", "GO:0007399", "GO:0021915", "GO:0043069", "GO:0043067", "GO:0007417", "GO:0021532", "GO:0060429", "GO:0021732", "GO:0009952", "GO:0009792", "GO:0043009", "GO:0042981", "GO:0043066", "GO:0021903" ]
null
null
[ "IPR001870", "IPR043136", "IPR003879", "IPR013320", "IPR006574", "IPR003877", "IPR050143", "IPR027370", "IPR000315", "IPR001841", "IPR013083", "IPR017907" ]
af_db/AF-A0A060IVL7-F1-model_v4.cif.gz
null
null
null
A0A096MJT2
Protein tyrosine phosphatase, non-receptor type 3
null
Rattus norvegicus (Rat)
92
null
MTSRLRALGGRINNIRTSELPKEKTRSEVTCSIRFLDGLVQTFKVNKQDLGQSLLDMAYGHLGVTEKEYFGLQHGDDPVDSPEVSPVSCIFE
[ "GO:0048732", "GO:0031100", "GO:0032502", "GO:0001889", "GO:0031099", "GO:0048856", "GO:0061008", "GO:0007275", "GO:0032501", "GO:0048731", "GO:0097421", "GO:0048513", "GO:0008150" ]
[ "GO:0008150", "GO:0032502", "GO:0032501", "GO:0048856", "GO:0007275", "GO:0031099", "GO:0048731", "GO:0048513", "GO:0048732", "GO:0031100", "GO:0061008", "GO:0001889", "GO:0097421" ]
null
null
[ "IPR000299", "IPR018979", "IPR029071" ]
af_db/AF-A0A096MJT2-F1-model_v4.cif.gz
null
null
null
A0A0A6YVT4
Protocadherin gamma subfamily C, 5
null
Mus musculus (Mouse)
55
null
MRPMASPQVAGKCKPRPTLTGVSLKPRDPARADPKMVMKLAPGPTTSLIQRCCKP
[ "GO:0050808", "GO:0009987", "GO:0016043", "GO:0065007", "GO:0071840", "GO:1901214", "GO:1901215", "GO:0043066", "GO:0042981", "GO:0008150", "GO:0060548", "GO:0043524", "GO:0010941", "GO:0050789", "GO:0034330", "GO:0043523", "GO:0043069", "GO:0048523", "GO:0043067", "GO:0048519", "GO:0050794", "GO:0110165", "GO:0005575", "GO:0016020" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0050789", "GO:0048519", "GO:0071840", "GO:0048523", "GO:0050794", "GO:0016043", "GO:0060548", "GO:0010941", "GO:1901214", "GO:1901215", "GO:0034330", "GO:0043069", "GO:0043067", "GO:0050808", "GO:0043066", "GO:0042981", "GO:0043524", "GO:0043523" ]
null
[ "GO:0005575", "GO:0110165", "GO:0016020" ]
null
af_db/AF-A0A0A6YVT4-F1-model_v4.cif.gz
null
null
null
A0A0A6YWE3
Pleiomorphic adenoma gene-like 1
null
Mus musculus (Mouse)
121
Nucleus {ECO:0000256|ARBA:ARBA00004123}.
MAPFRCQKCGKSFVTLEKFTIHNYSHSRERPFKCSKAECGKAFVSKYKLMRHMATHSPQKIHQCTHCEKTFNRKDHLKNHLQTHDPNKISYACDDCGKKYHTMLGYKRHLALHSASNGDLT
[ "GO:0060538", "GO:0007519", "GO:0032502", "GO:0060255", "GO:0048869", "GO:0009987", "GO:0048856", "GO:0065007", "GO:0061061", "GO:0008150", "GO:0007517", "GO:0009888", "GO:0050789", "GO:0019222", "GO:0030154", "GO:0010468", "GO:0035914", "GO:0048513", "GO:0060537", "GO:0005515", "GO:0005488", "GO:0003674" ]
[ "GO:0008150", "GO:0032502", "GO:0009987", "GO:0065007", "GO:0050789", "GO:0048869", "GO:0048856", "GO:0019222", "GO:0060255", "GO:0061061", "GO:0009888", "GO:0030154", "GO:0048513", "GO:0007517", "GO:0010468", "GO:0035914", "GO:0060537", "GO:0060538", "GO:0007519" ]
[ "GO:0003674", "GO:0005488", "GO:0005515" ]
null
[ "IPR036236", "IPR013087" ]
af_db/AF-A0A0A6YWE3-F1-model_v4.cif.gz
null
null
null
A0A0A6YWM6
Protocadherin gamma subfamily C, 3
null
Mus musculus (Mouse)
78
null
MVAEARSSGLVSPWRTVGVLLLLAALTEASTIIHYEILEERERGFPVGNVVTDLGLDLGSLSARRLRVVSGASRRFFE
[ "GO:0050808", "GO:0009987", "GO:0016043", "GO:0065007", "GO:0071840", "GO:1901214", "GO:1901215", "GO:0043066", "GO:0016339", "GO:0042981", "GO:0008150", "GO:0007156", "GO:0098742", "GO:0060548", "GO:0043524", "GO:0010941", "GO:0098609", "GO:0050789", "GO:0034330", "GO:0043523", "GO:0043069", "GO:0048523", "GO:0043067", "GO:0048519", "GO:0007155", "GO:0050794", "GO:0110165", "GO:0070161", "GO:0005911", "GO:0071944", "GO:0005575", "GO:0016020", "GO:0005886", "GO:0030054" ]
[ "GO:0008150", "GO:0009987", "GO:0065007", "GO:0050789", "GO:0048519", "GO:0071840", "GO:0048523", "GO:0007155", "GO:0050794", "GO:0016043", "GO:0060548", "GO:0010941", "GO:0098609", "GO:1901214", "GO:1901215", "GO:0098742", "GO:0034330", "GO:0043069", "GO:0043067", "GO:0050808", "GO:0043066", "GO:0016339", "GO:0042981", "GO:0007156", "GO:0043524", "GO:0043523" ]
null
[ "GO:0005575", "GO:0110165", "GO:0071944", "GO:0016020", "GO:0030054", "GO:0070161", "GO:0005886", "GO:0005911" ]
[ "IPR013164" ]
af_db/AF-A0A0A6YWM6-F1-model_v4.cif.gz
null
null
null
A0A0B4JD76
O/E-associated zinc finger protein, isoform C
null
Drosophila melanogaster (Fruit fly)
1,366
null
MSRRKQAKPRACLKLGEKEDEENTGLLEPKEELLSGDEDNEDNEGEDEDEEVADEVAPEGGGGERPQLVPNESQQQSWPTADEPAAPAAVAKEEEAEEGSEELQHPRDEVVASDAAANANGHCKSSGHEEDAVDAEEPEDLELDDELLSLSGDEDYDDEELQSLDSFYSDMYSTHTSSSYSPSISDGTMTPNSHHLIGAPTAAGQEDHPTEGKINGGADGEDLPKPKRLPHFHHHHHHHYHHQQALKIANKLRKINKEAKMGATAGGGATGAASKFDKLTGEGIKSRGDGSYQCQFCEKTFPRLGYLKHHVQSHAEHLPFKCEYCSKLFKHKRSRDRHKKLHTNERNYKCPHCEAAFSRSDHLKIHMKTHDIQKPFQCSMCNRGYNTAAALTSHMQKHKKNAAILAAGGNPNALNYSPRSTGSASASVSSNGSLQKRRYALALASDSSPSRMDFPKRSRSNHVGGTTTTATPTPLLRCSYCPKVTEFSSLEQLNAHLQSVHEQPQTQAVKTPVQEGEGFQLSCEYCTMKFGNIAGLFQHMRSTHMDRLSSPNSYYEHFNRLATAGTFSPRLALDLPKIKPDLGSPERESRPAEDDLPTDLSNNKRRPLTPNPQAQTPLAPPSAPPGVFFCNQCNAGLPDFESFRNHLKSHIAEGMQLVCPHCGMSLPEQSEFERHVVGHFLITGSEFNCSSSCGKSFAKSEDLQQHLLSEHVLTLLKCSLCSELCESRMAMQLHLACAHSQETKLLRCSACLELFRSDAEFHVHVKTRHQLGGHPTLGATSSAPTNPLQCMFCRAVCSSELEMHFHLAAHARQFRCPSCPETFHVEFLLDRHMQSQHGGVKDKEANSPNMGSLYVNALLPPLAAAAAAAAATNNNSSIIDYNVAFKGLFGGASGGAGSGGGGAQSGGAPPSANKFYSPLQVDTNALKAQTSPHPALMYGLSQRYLMEMYAAKSTSPSGNEGVGNSQPPAPQATAPPPPPNASTATFSCGMCERQDLRSEAELHSHRKLAHNLKTGVSLRCAYCAGNFKSRAELEQHMKSCHNSTGKHKCLICDEVFPSPAILAEHKLQHSKVGQSGKCSHCGQPLEDVAAFRAHLSEHGSDGASLPLACICCRQTLHSEFELSLHAKFHTKSSSSGGSLQEPVCALCLEPLPDATEGPAKLCDKCCRKHNLNGKRGKHSEPATSLPAPPSAFVENRCNLCKMILPHAQKLQEHLVEHTFAGTEQRGFNCYICSAVFTAPGGLLNHMGEHGAHSRPYDCNLCPEKFFFRAELEHHQRGHELRPQARPPAAKVEVPSIRNTSPGQSPVRSPTIVKQELYETDTVESAGVEDEPENHPDEEEYIEVEQMPHETRPSGIGSQLERSTSSA
[ "GO:0032502", "GO:0035277", "GO:0048856", "GO:0007275", "GO:0032501", "GO:0009653", "GO:0048731", "GO:0007424", "GO:0008150", "GO:0060541" ]
[ "GO:0008150", "GO:0032502", "GO:0032501", "GO:0048856", "GO:0007275", "GO:0009653", "GO:0035277", "GO:0048731", "GO:0060541", "GO:0007424" ]
null
null
[ "IPR036236", "IPR013087" ]
null
null
null
null
A0A0B4K762
Limostatin, isoform B
null
Drosophila melanogaster (Fruit fly)
152
null
MFAYTWQFPSLHSFLVPSLQLAPLILVILATTMTTTMAAPQQQEVPHALLDIETPNQFNYSPSPLAQPDSLRSKPYFDFLSTLYAHDTAKSNLFRPYSVRQRRDADVQKLSRPRRAIVFRPLFVYKQQEIRKQEIRDRNAQRRHDLNRLQRV
[ "GO:0046888", "GO:0009605", "GO:0009991", "GO:0048878", "GO:0065008", "GO:0009743", "GO:0065007", "GO:0010648", "GO:0023057", "GO:1903530", "GO:0051049", "GO:0055088", "GO:0051051", "GO:0008150", "GO:0042221", "GO:0090276", "GO:0002791", "GO:0090087", "GO:0042594", "GO:0050896", "GO:0050789", "GO:0050848", "GO:0010646", "GO:0071310", "GO:0009267", "GO:0055090", "GO:0033554", "GO:0031667", "GO:0070887", "GO:0032879", "GO:0042593", "GO:0050794", "GO:0009966", "GO:0042592", "GO:0048583", "GO:0033500", "GO:0051716", "GO:0023051", "GO:0009987", "GO:0002792", "GO:1901700", "GO:0031668", "GO:0071322", "GO:0051046", "GO:0006950", "GO:0010817", "GO:0071496", "GO:0048523", "GO:0070328", "GO:0048519", "GO:0031669", "GO:1901701", "GO:0010033", "GO:0090278", "GO:1902531", "GO:0007154", "GO:0051048", "GO:1903531", "GO:0046883" ]
[ "GO:0008150", "GO:0065007", "GO:0050896", "GO:0050789", "GO:0042592", "GO:0009987", "GO:0048519", "GO:0009605", "GO:0048878", "GO:0065008", "GO:0023057", "GO:0051051", "GO:0042221", "GO:0032879", "GO:0050794", "GO:0048583", "GO:0051716", "GO:0023051", "GO:0006950", "GO:0048523", "GO:0007154", "GO:0046888", "GO:0009991", "GO:0010648", "GO:1903530", "GO:0051049", "GO:0055088", "GO:0042594", "GO:0010646", "GO:0033554", "GO:0070887", "GO:0009966", "GO:0033500", "GO:1901700", "GO:0031668", "GO:0010817", "GO:0071496", "GO:0010033", "GO:0051048", "GO:1903531", "GO:0046883", "GO:0009743", "GO:0090276", "GO:0090087", "GO:0071310", "GO:0009267", "GO:0055090", "GO:0031667", "GO:0042593", "GO:0002792", "GO:0051046", "GO:0031669", "GO:1901701", "GO:0090278", "GO:1902531", "GO:0002791", "GO:0050848", "GO:0071322", "GO:0070328" ]
null
null
null
af_db/AF-A0A0B4K762-F1-model_v4.cif.gz
7227.FBpp0297147
[ "7227.FBpp0296961" ]
[ { "protein2": "7227.FBpp0296961", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 0, "textmining": 830, "combined_score": 830 } ]
A0A0B4KEU5
Coronin
null
Drosophila melanogaster (Fruit fly)
534
null
MSFRVVRSSKFRHVYGQALKREQCYDNIRVSKSSWDSTFCAVNPKFLAIIVESAGGGAFIVLPHNKVGRMWQVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPDGGLSRTLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSHPDIVYSACFNWDGSKLVTTCKDKKIRIYDPRTAELESEAMCHEGSKATRAIFLRHGLIFTTGFNRSSERQYSLRAPDALNEPIVMVELDTSNGVMFPLYDADTNMIYLCGKGDSVIRYFEVTPEPPFVHYINTFQTTEPQRGIGLMPKRGCDVTTCEVAKFYRMNNNGLCQVISMTVPRKSDLFQEDLYPDTLAEDAAITAEEWIDGKDADPITFSLKGGYVSSSVNKSLPAKKAGNILNKPRGDSASSGATSSSAGGGNFASGNNNEASEGGPPAAVLSEKDLRTIQDEIRKLKAIIVKQENRIRALEAKEDARNKNGSDAAPASAGAATSDGKASESANDHASTSAGTSKDED
[ "GO:0006952", "GO:0009605", "GO:0032502", "GO:0048856", "GO:0061061", "GO:0006950", "GO:0008150", "GO:0043207", "GO:0050896", "GO:0007527", "GO:0007525", "GO:0051707", "GO:0009620", "GO:0050832", "GO:0009607", "GO:0098542", "GO:0044419" ]
[ "GO:0008150", "GO:0032502", "GO:0050896", "GO:0044419", "GO:0009605", "GO:0048856", "GO:0006950", "GO:0051707", "GO:0009607", "GO:0006952", "GO:0061061", "GO:0043207", "GO:0009620", "GO:0098542", "GO:0007525", "GO:0050832", "GO:0007527" ]
null
null
[ "IPR015505", "IPR015048", "IPR015943", "IPR019775", "IPR036322", "IPR001680" ]
af_db/AF-A0A0B4KEU5-F1-model_v4.cif.gz
null
null
null
A0A0B4KEX9
Uncharacterized protein, isoform D
null
Drosophila melanogaster (Fruit fly)
592
null
MHEAESVGGLGTESTPESPMSPQTPDPALLDVRQKVHRFEAFRTNICFIKQERHSLKLLENRRHPSFEDQSEDHHTPPATPPRRIRLPGLGSRGSSRSSSIPSFQAGIHEVRSEDEVDQISDFETDSHTAAEEYLVVDTTSEVVPSEEVADSKVDQQQVQRSISADQSKEALTLPLKMRNDFPRNYRSTPRRKTEIIGTTNEHLVGKFHSVYQPKDEEEEVEIELRDKSDKCVHPILEELIKTEEAYVNNLFTGIENYGNIFQRKDLPLGLRGKKYDLFGNIEQIAEFHRDEFLPMLQRNRRDLKRLFDEFLQFLDQHCFYGYVIFTMNKQKSLKLCDLYKNYFTSIRLERDDKLGINSFLVQPIQRMARYPLLLTQFINTFFKNRDIVMKPLIESCCRLEKRLRALLTTTNESEIINDIVDCHEFNVYYQGKFRKVNEFQVLDHKLKRSYRSKVFIFDKCIIYTEIKGKNLLFHGRYPCEHIGISAKTKSFTLYYERRKQQECEFTADPVQIAIWLDLIRDMINNYANEERQKLQERYSRENDHLHRKAPSFSLYRDSNRFSSDSGIGNIWIMPKADEDTISNRTTWYAAT
[ "GO:0032502", "GO:0035114", "GO:0048736", "GO:0048856", "GO:0002165", "GO:0007552", "GO:0007275", "GO:0035107", "GO:0009653", "GO:0009887", "GO:0048563", "GO:0009886", "GO:0007478", "GO:0008150", "GO:0007560", "GO:0007444", "GO:0048737", "GO:0007480", "GO:0035120", "GO:0032501", "GO:0048513", "GO:0009791", "GO:0048707", "GO:0048569", "GO:0035218" ]
[ "GO:0008150", "GO:0032502", "GO:0032501", "GO:0048856", "GO:0007275", "GO:0009653", "GO:0009791", "GO:0048736", "GO:0002165", "GO:0007552", "GO:0035107", "GO:0009887", "GO:0009886", "GO:0048513", "GO:0035114", "GO:0048563", "GO:0007560", "GO:0007444", "GO:0048737", "GO:0035120", "GO:0048707", "GO:0048569", "GO:0007478", "GO:0007480", "GO:0035218" ]
null
null
[ "IPR035899", "IPR000219", "IPR011993", "IPR051336" ]
af_db/AF-A0A0B4KEX9-F1-model_v4.cif.gz
null
null
null
A0A075B6A3
Immunoglobulin heavy constant alpha
null
Mus musculus (Mouse)
344
null
XSARNPTIYPLTLPRALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGGYTMSSQLTLPAVECPEGESVKCSVQHDSNAVQELDVKCSGPPPPCPPCPPSCHPSLSLQRPALEDLLLGSDASLTCTLNGLRNPEGAVFTWEPSTGKDAVQKKAVQNSCGCYSVSSVLPGCAERWNSGASFKCTVTHPESDTLTGTIAKITVNTFPPQVHLLPPPSEELALNELVSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAELWKQGDQYSCMVGHEALPMNFTQKTIDRLSGKPTNVSVSVIMSEGDGICY
[ "GO:0002455", "GO:0002449", "GO:0002376", "GO:0019724", "GO:0002443", "GO:0002252", "GO:0002250", "GO:0008150", "GO:0016064", "GO:0002385", "GO:0050896", "GO:0002251", "GO:0006955", "GO:0006959", "GO:0002460", "GO:0032991", "GO:0005575", "GO:0042571", "GO:0005576", "GO:0110165", "GO:0019814", "GO:0005615", "GO:0003823", "GO:0003674", "GO:0005488" ]
[ "GO:0008150", "GO:0002376", "GO:0050896", "GO:0002252", "GO:0006955", "GO:0002443", "GO:0002250", "GO:0002251", "GO:0006959", "GO:0002455", "GO:0002449", "GO:0002385", "GO:0002460", "GO:0019724", "GO:0016064" ]
[ "GO:0003674", "GO:0005488", "GO:0003823" ]
[ "GO:0005575", "GO:0032991", "GO:0110165", "GO:0005576", "GO:0019814", "GO:0005615", "GO:0042571" ]
[ "IPR007110", "IPR036179", "IPR013783", "IPR003006", "IPR003597", "IPR003599", "IPR050380" ]
null
null
null
null
A0A096MJ68
Secretory leukocyte peptidase inhibitor
null
Rattus norvegicus (Rat)
107
Secreted {ECO:0000256|ARBA:ARBA00004613}.
MRLQDAIKIGACPARKPAQCLKREKPECGTDWECPGKQRCCQDTCGFKCLNPVPIRGPVKKKPGRCLKFQGKCLMLNPPNKCQNDGQCDGKYKCCEGMCGKVCLPPV
[ "GO:0050727", "GO:0048583", "GO:0031347", "GO:0050789", "GO:0032101", "GO:0048519", "GO:0065007", "GO:0048585", "GO:0080134", "GO:0050728", "GO:0008150", "GO:0031348", "GO:0032102" ]
[ "GO:0008150", "GO:0050789", "GO:0048519", "GO:0065007", "GO:0048583", "GO:0048585", "GO:0032101", "GO:0080134", "GO:0031348", "GO:0032102", "GO:0050727", "GO:0031347", "GO:0050728" ]
null
null
[ "IPR036645", "IPR008197", "IPR050514" ]
af_db/AF-A0A096MJ68-F1-model_v4.cif.gz
10116.ENSRNOP00000068012
[ "10116.ENSRNOP00000014981" ]
[ { "protein2": "10116.ENSRNOP00000014981", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 78, "experimental": 336, "database": 0, "textmining": 644, "combined_score": 762 } ]
A0A096MJV3
Heat shock transcription factor 4
null
Rattus norvegicus (Rat)
329
Nucleus {ECO:0000256|ARBA:ARBA00004123}.
MQEAPAALPTEPGPSPVPAFLGKLWALVGDPGTDHLIRWSPSGTSFLVSDQSRFAKEVLPQYFKHSNMASFVRQLNMYGFRKVVSIEQGGLLRPERDHVEFQHPSFVRGCEQLLERVRRKVPALRGDDTRWRPEDLGRLLGEVQALRGVQESTEARLQELRQQNEILWREVVTLRQSHSQQHRVIGKLIQCLFGPLQTGPSSTGAKRKLSLMLDEGSACSASAKFNACPVSGALLQDPYFIQSHPHRCPWLWCRPSWKGKGASALRGPGAYNSLNQGAPGRYLTGELWAWIAVTGAQRVCCPPCCFGLPLKLWSPWMRWVLACMDENGP
[ "GO:0065007", "GO:1903507", "GO:0051172", "GO:0008150", "GO:0010556", "GO:0050789", "GO:0019222", "GO:0010605", "GO:0009889", "GO:0050794", "GO:0051171", "GO:0031326", "GO:1903506", "GO:0060255", "GO:0031323", "GO:0009890", "GO:0019219", "GO:0010558", "GO:2001141", "GO:1902679", "GO:0031327", "GO:0080090", "GO:0051252", "GO:0031324", "GO:0051253", "GO:0006355", "GO:0048523", "GO:0048519", "GO:0045892", "GO:0045934", "GO:0010468", "GO:0009892", "GO:0005622", "GO:0043229", "GO:0043226", "GO:0110165", "GO:0005575", "GO:0043227", "GO:0005634", "GO:0043231", "GO:0003676", "GO:0003677", "GO:0042802", "GO:0005488", "GO:0043565", "GO:0097159", "GO:0003674", "GO:1901363", "GO:0005515" ]
[ "GO:0008150", "GO:0065007", "GO:0050789", "GO:0048519", "GO:0019222", "GO:0050794", "GO:0048523", "GO:0009892", "GO:0051172", "GO:0010605", "GO:0009889", "GO:0051171", "GO:0060255", "GO:0031323", "GO:0009890", "GO:0080090", "GO:0031324", "GO:0010556", "GO:0031326", "GO:0019219", "GO:0010558", "GO:0031327", "GO:0051252", "GO:0051253", "GO:0045934", "GO:0010468", "GO:2001141", "GO:1902679", "GO:0006355", "GO:1903507", "GO:1903506", "GO:0045892" ]
[ "GO:0003674", "GO:0005488", "GO:0097159", "GO:1901363", "GO:0005515", "GO:0003676", "GO:0042802", "GO:0003677", "GO:0043565" ]
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0043229", "GO:0043227", "GO:0043231", "GO:0005634" ]
[ "IPR000232", "IPR036388", "IPR036390" ]
null
null
null
null
A0A096MK39
Heat shock transcription factor 4
null
Rattus norvegicus (Rat)
489
Nucleus {ECO:0000256|ARBA:ARBA00004123}.
MQEAPAALPTEPGPSPVPAFLGKLWALVGDPGTDHLIRWSPSGTSFLVSDQSRFAKEVLPQYFKHSNMASFVRQLNMYGFRKVVSIEQGGLLRPERDHVEFQHPSFVRGCEQLLERVRRKVPALRGDDTRWRPEDLGRLLGEVQALRGVQESTEARLQELRQQNEILWREVVTLRQSHSQQHRVIGKLIQCLFGPLQTGPSSTGAKRKLSLMLDEGSACSASAKFNACPVSGALLQDPYFIQSPLPETTVGLSPHRARGPIISDIPEDCPSPEGHRLSPSSAGRRVKGLALLKEEPASPGGDGEAGLALAPNECDFCVTAPPPLPVAVVQAILEGKGSFSPEGPRSIQQPEPRGPREVPDRGTLGLDRGNRSPESLLPPVLLRPPPETVEPMDALGPSLHGREWTLMDLDMELSLMQPLAPERAEAELTVKDLTSSGVGKDHTLGTPLMLDVQADLEGAALSVPGALTLYNATESNASYLDPGASPSSP
[ "GO:0065007", "GO:1903507", "GO:0051172", "GO:0008150", "GO:0010556", "GO:0050789", "GO:0019222", "GO:0010605", "GO:0009889", "GO:0050794", "GO:0051171", "GO:0031326", "GO:1903506", "GO:0060255", "GO:0031323", "GO:0009890", "GO:0019219", "GO:0010558", "GO:2001141", "GO:1902679", "GO:0031327", "GO:0080090", "GO:0051252", "GO:0031324", "GO:0051253", "GO:0006355", "GO:0048523", "GO:0048519", "GO:0045892", "GO:0045934", "GO:0010468", "GO:0009892", "GO:0005622", "GO:0043229", "GO:0043226", "GO:0110165", "GO:0005575", "GO:0043227", "GO:0005634", "GO:0043231", "GO:0003676", "GO:0003677", "GO:0042802", "GO:0005488", "GO:0043565", "GO:0097159", "GO:0003674", "GO:1901363", "GO:0005515" ]
[ "GO:0008150", "GO:0065007", "GO:0050789", "GO:0048519", "GO:0019222", "GO:0050794", "GO:0048523", "GO:0009892", "GO:0051172", "GO:0010605", "GO:0009889", "GO:0051171", "GO:0060255", "GO:0031323", "GO:0009890", "GO:0080090", "GO:0031324", "GO:0010556", "GO:0031326", "GO:0019219", "GO:0010558", "GO:0031327", "GO:0051252", "GO:0051253", "GO:0045934", "GO:0010468", "GO:2001141", "GO:1902679", "GO:0006355", "GO:1903507", "GO:1903506", "GO:0045892" ]
[ "GO:0003674", "GO:0005488", "GO:0097159", "GO:1901363", "GO:0005515", "GO:0003676", "GO:0042802", "GO:0003677", "GO:0043565" ]
[ "GO:0005575", "GO:0110165", "GO:0005622", "GO:0043226", "GO:0043229", "GO:0043227", "GO:0043231", "GO:0005634" ]
[ "IPR000232", "IPR036388", "IPR036390" ]
af_db/AF-A0A096MK39-F1-model_v4.cif.gz
10116.ENSRNOP00000068369
[ "10116.ENSRNOP00000007727", "10116.ENSRNOP00000051301", "10116.ENSRNOP00000055204", "10116.ENSRNOP00000029527" ]
[ { "protein2": "10116.ENSRNOP00000007727", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 0, "database": 0, "textmining": 736, "combined_score": 735 }, { "protein2": "10116.ENSRNOP00000051301", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 44, "experimental": 0, "database": 0, "textmining": 719, "combined_score": 719 }, { "protein2": "10116.ENSRNOP00000055204", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 64, "experimental": 0, "database": 0, "textmining": 698, "combined_score": 705 }, { "protein2": "10116.ENSRNOP00000029527", "neighborhood": 0, "fusion": 0, "cooccurence": 0, "coexpression": 0, "experimental": 67, "database": 0, "textmining": 848, "combined_score": 852 } ]
A0A0A6YXW6
Immunoglobulin heavy constant alpha
null
Mus musculus (Mouse)
389
null
XSARNPTIYPLTLPRALSSDPVIIGCLIHDYFPSGTMNVTWGKSGKDITTVNFPPALASGGGYTMSSQLTLPAVECPEGESVKCSVQHDSNAVQELDVKCSGPPPPCPPCPPSCHPSLSLQRPALEDLLLGSDASLTCTLNGLRNPEGAVFTWEPSTGKDAVQKKAVQNSCGCYSVSSVLPGCAERWNSGASFKCTVTHPESDTLTGTIAKITVNTFPPQVHLLPPPSEELALNELVSLTCLVRAFNPKEVLVRWLHGNEELSPESYLVFEPLKEPGEGATTYLVTSVLRVSAELWKQGDQYSCMVGHEALPMNFTQKTIDRLSERQEPLSYVLLDQSEDILEEEAPGASLWPTTVTFLTLFLLSLFYSTALTVTTVRGPFGSKEVPQY
[ "GO:0002455", "GO:0002449", "GO:0002376", "GO:0019724", "GO:0002443", "GO:0002252", "GO:0002250", "GO:0008150", "GO:0016064", "GO:0002385", "GO:0050896", "GO:0002251", "GO:0006955", "GO:0006959", "GO:0002460", "GO:0032991", "GO:0005575", "GO:0042571", "GO:0005576", "GO:0110165", "GO:0019814", "GO:0005615", "GO:0003823", "GO:0003674", "GO:0005488" ]
[ "GO:0008150", "GO:0002376", "GO:0050896", "GO:0002252", "GO:0006955", "GO:0002443", "GO:0002250", "GO:0002251", "GO:0006959", "GO:0002455", "GO:0002449", "GO:0002385", "GO:0002460", "GO:0019724", "GO:0016064" ]
[ "GO:0003674", "GO:0005488", "GO:0003823" ]
[ "GO:0005575", "GO:0032991", "GO:0110165", "GO:0005576", "GO:0019814", "GO:0005615", "GO:0042571" ]
[ "IPR007110", "IPR036179", "IPR013783", "IPR003006", "IPR003597", "IPR050380" ]
null
null
null
null